NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

Overview
NameNADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
Smed IDSMED30027215
Length (bp)870
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial (SMED30027215) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial (SMED30027215) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial (SMED30027215) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial (SMED30027215) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027215

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30027215h1SMcG0004786 dd_Smed_v4_2735_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027215h1SMcG0004786 dd_Smed_v4_2735_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027215h1SMcG0004786 dd_Smed_v4_2735_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027215h1SMcG0004786 dd_Smed_v4_2735_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Human
Match: NDUFS7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:HGNC Symbol;Acc:HGNC:7714])

HSP 1 Score: 243.432 bits (620), Expect = 2.493e-80
Identity = 123/157 (78.34%), Postives = 144/157 (91.72%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S++ E  VA+LDD++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQSDV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIY+PGCPP+AEALLYG LQLQ+KIKR    Q+WYR+
Sbjct:   57 SSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR 213          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Human
Match: NDUFS7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:HGNC Symbol;Acc:HGNC:7714])

HSP 1 Score: 196.823 bits (499), Expect = 3.715e-62
Identity = 104/136 (76.47%), Postives = 122/136 (89.71%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPG----CPPSAE 624
            S++ E  VA+LDD++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQSDV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIY+PG     PP+ E
Sbjct:   57 SSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGRAGTAPPTRE 192          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Human
Match: NDUFS7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:HGNC Symbol;Acc:HGNC:7714])

HSP 1 Score: 196.823 bits (499), Expect = 3.715e-62
Identity = 104/136 (76.47%), Postives = 122/136 (89.71%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPG----CPPSAE 624
            S++ E  VA+LDD++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQSDV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIY+PG     PP+ E
Sbjct:   57 SSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGRAGTAPPTRE 192          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Human
Match: NDUFS7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:HGNC Symbol;Acc:HGNC:7714])

HSP 1 Score: 195.667 bits (496), Expect = 2.599e-61
Identity = 104/136 (76.47%), Postives = 122/136 (89.71%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPG----CPPSAE 624
            S++ E  VA+LDD++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQSDV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIY+PG     PP+ E
Sbjct:   87 SSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGRAGTAPPTRE 222          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Human
Match: NDUFS7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:HGNC Symbol;Acc:HGNC:7714])

HSP 1 Score: 192.2 bits (487), Expect = 9.397e-61
Identity = 100/125 (80.00%), Postives = 117/125 (93.60%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVP 603
            S++ E  VA+LDD++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQSDV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIY+P
Sbjct:   57 SSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIP 181          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Celegans
Match: nduf-7 (Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q94360])

HSP 1 Score: 249.21 bits (635), Expect = 2.764e-83
Identity = 130/190 (68.42%), Postives = 155/190 (81.58%), Query Frame = 1
Query:  151 ATTSLRLQKTPKIVDDQE----LSPLKGPF---SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            A  + RL  T  I  + E    ++    PF   S+K E A+ARLDD++N  ++GSIWP+TFGLACCAVEMMH AAPRYDMDR+G++FRASPRQ+D+I VAGT+TNKMA ALR+IYDQM   KWVISMGSCANGGGYYHY+YSV+RGCDR+IPVDIYVPGCPP+AEALLYG LQLQKKIKR   +Q+WYR+
Sbjct:   10 AVGTRRLASTQAIASNSEAPKGIATTGTPFLNPSSKAEYALARLDDVLNLAQRGSIWPLTFGLACCAVEMMHFAAPRYDMDRYGVVFRASPRQADLIFVAGTVTNKMAPALRRIYDQMPEAKWVISMGSCANGGGYYHYAYSVLRGCDRVIPVDIYVPGCPPTAEALLYGVLQLQKKIKRKREAQLWYRR 199          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Celegans
Match: nduf-7 (Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q94360])

HSP 1 Score: 249.21 bits (635), Expect = 2.764e-83
Identity = 130/190 (68.42%), Postives = 155/190 (81.58%), Query Frame = 1
Query:  151 ATTSLRLQKTPKIVDDQE----LSPLKGPF---SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            A  + RL  T  I  + E    ++    PF   S+K E A+ARLDD++N  ++GSIWP+TFGLACCAVEMMH AAPRYDMDR+G++FRASPRQ+D+I VAGT+TNKMA ALR+IYDQM   KWVISMGSCANGGGYYHY+YSV+RGCDR+IPVDIYVPGCPP+AEALLYG LQLQKKIKR   +Q+WYR+
Sbjct:   10 AVGTRRLASTQAIASNSEAPKGIATTGTPFLNPSSKAEYALARLDDVLNLAQRGSIWPLTFGLACCAVEMMHFAAPRYDMDRYGVVFRASPRQADLIFVAGTVTNKMAPALRRIYDQMPEAKWVISMGSCANGGGYYHYAYSVLRGCDRVIPVDIYVPGCPPTAEALLYGVLQLQKKIKRKREAQLWYRR 199          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Fly
Match: ND-20 (gene:FBgn0030718 transcript:FBtr0340417)

HSP 1 Score: 264.618 bits (675), Expect = 6.190e-89
Identity = 145/216 (67.13%), Postives = 173/216 (80.09%), Query Frame = 1
Query:   70 SDSIFKMLSLISLSKYGTIPFLSFRNLATTSLRLQKTPKIVDDQELSPLKG--PFSNK----VEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S ++ + L   + +   +I  L   NLA   +R Q+T  + +  +  P KG  PF  K     E ++ARLDD++N+GRKGSIWP+TFGLACCAVEMMH+AAPRYDMDR+G++FRASPRQ+DVIIVAGTLTNKMA ALRK+YDQM  P+WVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPP+AEAL+YG LQLQKK+KRM + QMWYRK
Sbjct:    8 SSTLSRALQKATQTPNASISALPALNLAL--VRQQQTLPVAEVAQNLPKKGYSPFGTKQSSVAEWSLARLDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGVLQLQKKVKRMKTLQMWYRK 221          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Fly
Match: ND-20 (gene:FBgn0030718 transcript:FBtr0074152)

HSP 1 Score: 264.618 bits (675), Expect = 6.190e-89
Identity = 145/216 (67.13%), Postives = 173/216 (80.09%), Query Frame = 1
Query:   70 SDSIFKMLSLISLSKYGTIPFLSFRNLATTSLRLQKTPKIVDDQELSPLKG--PFSNK----VEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S ++ + L   + +   +I  L   NLA   +R Q+T  + +  +  P KG  PF  K     E ++ARLDD++N+GRKGSIWP+TFGLACCAVEMMH+AAPRYDMDR+G++FRASPRQ+DVIIVAGTLTNKMA ALRK+YDQM  P+WVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPP+AEAL+YG LQLQKK+KRM + QMWYRK
Sbjct:    8 SSTLSRALQKATQTPNASISALPALNLAL--VRQQQTLPVAEVAQNLPKKGYSPFGTKQSSVAEWSLARLDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGVLQLQKKVKRMKTLQMWYRK 221          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Fly
Match: ND-20 (gene:FBgn0030718 transcript:FBtr0074151)

HSP 1 Score: 264.618 bits (675), Expect = 6.190e-89
Identity = 145/216 (67.13%), Postives = 173/216 (80.09%), Query Frame = 1
Query:   70 SDSIFKMLSLISLSKYGTIPFLSFRNLATTSLRLQKTPKIVDDQELSPLKG--PFSNK----VEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S ++ + L   + +   +I  L   NLA   +R Q+T  + +  +  P KG  PF  K     E ++ARLDD++N+GRKGSIWP+TFGLACCAVEMMH+AAPRYDMDR+G++FRASPRQ+DVIIVAGTLTNKMA ALRK+YDQM  P+WVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPP+AEAL+YG LQLQKK+KRM + QMWYRK
Sbjct:    8 SSTLSRALQKATQTPNASISALPALNLAL--VRQQQTLPVAEVAQNLPKKGYSPFGTKQSSVAEWSLARLDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGVLQLQKKVKRMKTLQMWYRK 221          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Fly
Match: ND-20L (gene:FBgn0039669 transcript:FBtr0085440)

HSP 1 Score: 253.062 bits (645), Expect = 1.904e-84
Identity = 140/212 (66.04%), Postives = 167/212 (78.77%), Query Frame = 1
Query:   88 MLSLISLSKY-GTIPFLSFRNLATTSLRLQKTPKIVDDQELSPLKGPFS-------NKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            M+S + L++  G +       L +  LR QKT  + D +  +P K  +S          E   ARLDD++N+GRKGS+WP+TFGLACCAVEMMH+AAPRYDMDR+G++FRASPRQ+DV+IVAGTLTNKMA A RKIYDQM  P+WVISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEAL+YG LQLQKK+KRM + QMWYRK
Sbjct:    1 MISFLKLARNPGQLLLPGSGVLQSQWLRGQKTMPVYDYRCQNPPKWGYSAFGRNQKTWGEWTCARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVLIVAGTLTNKMAPAFRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALMYGILQLQKKVKRMRTLQMWYRK 212          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Fly
Match: ND-20L (gene:FBgn0039669 transcript:FBtr0339902)

HSP 1 Score: 253.062 bits (645), Expect = 1.904e-84
Identity = 140/212 (66.04%), Postives = 167/212 (78.77%), Query Frame = 1
Query:   88 MLSLISLSKY-GTIPFLSFRNLATTSLRLQKTPKIVDDQELSPLKGPFS-------NKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            M+S + L++  G +       L +  LR QKT  + D +  +P K  +S          E   ARLDD++N+GRKGS+WP+TFGLACCAVEMMH+AAPRYDMDR+G++FRASPRQ+DV+IVAGTLTNKMA A RKIYDQM  P+WVISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEAL+YG LQLQKK+KRM + QMWYRK
Sbjct:    1 MISFLKLARNPGQLLLPGSGVLQSQWLRGQKTMPVYDYRCQNPPKWGYSAFGRNQKTWGEWTCARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVLIVAGTLTNKMAPAFRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALMYGILQLQKKVKRMRTLQMWYRK 212          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Zebrafish
Match: ndufs7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:ZFIN;Acc:ZDB-GENE-041111-261])

HSP 1 Score: 241.121 bits (614), Expect = 1.167e-79
Identity = 123/157 (78.34%), Postives = 143/157 (91.08%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S+K E  + +LDD++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQ+DV+IVAGTLTNKMA ALRK+YDQM  P++VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEALLYG LQLQ+KIKR    ++WYRK
Sbjct:   61 SSKGEYVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGTLQLQRKIKREKRMKIWYRK 217          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Zebrafish
Match: ndufs7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:ZFIN;Acc:ZDB-GENE-041111-261])

HSP 1 Score: 241.891 bits (616), Expect = 1.603e-79
Identity = 123/157 (78.34%), Postives = 143/157 (91.08%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S+K E  + +LDD++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQ+DV+IVAGTLTNKMA ALRK+YDQM  P++VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEALLYG LQLQ+KIKR    ++WYRK
Sbjct:   90 SSKGEYVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGTLQLQRKIKREKRMKIWYRK 246          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Zebrafish
Match: ndufs7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:ZFIN;Acc:ZDB-GENE-041111-261])

HSP 1 Score: 241.891 bits (616), Expect = 1.603e-79
Identity = 123/157 (78.34%), Postives = 143/157 (91.08%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S+K E  + +LDD++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQ+DV+IVAGTLTNKMA ALRK+YDQM  P++VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEALLYG LQLQ+KIKR    ++WYRK
Sbjct:   90 SSKGEYVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGTLQLQRKIKREKRMKIWYRK 246          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Xenopus
Match: ddx31 (DEAD-box helicase 31 [Source:Xenbase;Acc:XB-GENE-5831374])

HSP 1 Score: 246.128 bits (627), Expect = 2.198e-81
Identity = 133/206 (64.56%), Postives = 159/206 (77.18%), Query Frame = 1
Query:   82 FKMLSLISLSKYGTIPFLSFRNLATTSLRLQKTPKIVDDQELSPLKGPFSNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            F+  SL +L      P     N  +     QK+  +   + L P     SNK E  + +LD+++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQ+DV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEALLYG LQLQKKIKR    ++WYRK
Sbjct:   17 FRPASLAALHTRTWNPPTQTENATSLLPVRQKSSAVTAKKSLLP-----SNKGEFVITKLDELVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLRVWYRK 217          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Mouse
Match: Ndufs7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:MGI Symbol;Acc:MGI:1922656])

HSP 1 Score: 241.506 bits (615), Expect = 1.234e-79
Identity = 121/156 (77.56%), Postives = 142/156 (91.03%), Query Frame = 1
Query:  232 NKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            ++ E  V +LDD+IN+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQ+DV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEALLYG LQLQ+KIKR    ++WYR+
Sbjct:   69 SRAEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKREQKLKIWYRR 224          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Mouse
Match: Ndufs7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:MGI Symbol;Acc:MGI:1922656])

HSP 1 Score: 241.506 bits (615), Expect = 1.234e-79
Identity = 121/156 (77.56%), Postives = 142/156 (91.03%), Query Frame = 1
Query:  232 NKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            ++ E  V +LDD+IN+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQ+DV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEALLYG LQLQ+KIKR    ++WYR+
Sbjct:   69 SRAEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKREQKLKIWYRR 224          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. UniProt/SwissProt
Match: sp|Q94360|NDUS7_CAEEL (Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nduf-7 PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 3.516e-82
Identity = 130/190 (68.42%), Postives = 155/190 (81.58%), Query Frame = 1
Query:  151 ATTSLRLQKTPKIVDDQE----LSPLKGPF---SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            A  + RL  T  I  + E    ++    PF   S+K E A+ARLDD++N  ++GSIWP+TFGLACCAVEMMH AAPRYDMDR+G++FRASPRQ+D+I VAGT+TNKMA ALR+IYDQM   KWVISMGSCANGGGYYHY+YSV+RGCDR+IPVDIYVPGCPP+AEALLYG LQLQKKIKR   +Q+WYR+
Sbjct:   10 AVGTRRLASTQAIASNSEAPKGIATTGTPFLNPSSKAEYALARLDDVLNLAQRGSIWPLTFGLACCAVEMMHFAAPRYDMDRYGVVFRASPRQADLIFVAGTVTNKMAPALRRIYDQMPEAKWVISMGSCANGGGYYHYAYSVLRGCDRVIPVDIYVPGCPPTAEALLYGVLQLQKKIKRKREAQLWYRR 199          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. UniProt/SwissProt
Match: sp|A8XFG2|NDUS7_CAEBR (Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Caenorhabditis briggsae OX=6238 GN=nduf-7 PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 3.633e-82
Identity = 130/190 (68.42%), Postives = 156/190 (82.11%), Query Frame = 1
Query:  151 ATTSLRLQKTPKIVDDQE----LSPLKGPF---SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            A ++ RL  T  I  + E    ++    PF   S+K E A+ARLDD++N  ++GSIWP+TFGLACCAVEMMH AAPRYDMDR+G++FRASPRQ+D+I VAGT+TNKMA ALR+IYDQM   KWVISMGSCANGGGYYHY+YSV+RGCDR+IPVDIYVPGCPP+AEALLYG LQLQKKIKR   +Q+WYR+
Sbjct:   10 ALSTRRLASTQAIASNSEAPKGIATTGTPFLNPSSKAEYALARLDDVMNLAQRGSIWPLTFGLACCAVEMMHFAAPRYDMDRYGVVFRASPRQADLIFVAGTVTNKMAPALRRIYDQMPEAKWVISMGSCANGGGYYHYAYSVLRGCDRVIPVDIYVPGCPPTAEALLYGVLQLQKKIKRKREAQLWYRR 199          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. UniProt/SwissProt
Match: sp|P42026|NDUS7_BOVIN (NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS7 PE=1 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 5.969e-80
Identity = 125/157 (79.62%), Postives = 144/157 (91.72%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S++ E  VA+LDD+IN+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQSDV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEALLYG LQLQKKIKR    ++WYR+
Sbjct:   60 SSRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLRIWYRR 216          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. UniProt/SwissProt
Match: sp|Q0MQI0|NDUS7_PANTR (NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pan troglodytes OX=9598 GN=NDUFS7 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 8.088e-80
Identity = 123/157 (78.34%), Postives = 144/157 (91.72%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S++ E  VA+LDD++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQSDV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIY+PGCPP+AEALLYG LQLQ+KIKR    Q+WYR+
Sbjct:   57 SSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR 213          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. UniProt/SwissProt
Match: sp|P0CB83|NDUS7_PONAB (NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pongo abelii OX=9601 GN=NDUFS7 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 8.729e-80
Identity = 124/157 (78.98%), Postives = 144/157 (91.72%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S++ E  VA+LDD+IN+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQSDV+IVAGTLTNKMA ALRK+YDQM  P++V+SMGSCANGGGYYHYSYSVVRGCDRI+PVDIY+PGCPP+AEALLYG LQLQ+KIKR    Q+WYR+
Sbjct:   57 SSRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR 213          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. TrEMBL
Match: A0A151I9R2 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Cyphomyrmex costatus OX=456900 GN=ALC62_13583 PE=3 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 2.290e-89
Identity = 146/188 (77.66%), Postives = 166/188 (88.30%), Query Frame = 1
Query:  142 RNLATTSLRLQKTPKIVDDQELSPLKGPF--SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            +++AT S   +   ++ + Q++ P   PF  SNK E A+AR+DD++N+GRKGSIWPMTFGLACCAVEMMH+AAPRYDMDRFG++FRASPRQSDVIIVAGTLTNKMA ALRKIYDQM  PKWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPP+AEALLYG LQLQKKIKRM +SQ+WYRK
Sbjct:   37 KDMATESSVQEAKTQLPEKQKVEPYS-PFQPSNKAEYALARVDDLLNWGRKGSIWPMTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQSDVIIVAGTLTNKMAPALRKIYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALLYGILQLQKKIKRMQTSQVWYRK 223          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. TrEMBL
Match: A0A151X9B0 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial (Fragment) OS=Trachymyrmex zeteki OX=64791 GN=ALC60_04104 PE=3 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 9.889e-89
Identity = 147/189 (77.78%), Postives = 168/189 (88.89%), Query Frame = 1
Query:  142 RNLAT-TSLRLQKT--PKIVDDQELSPLKGPFSNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            +++AT +S++  KT  P+    +  SP +GP SN  E A+ARLDD++N+GRKGSIWPMTFGLACCAVEMMH+AAPRYDMDRFG++FRASPRQSDVIIVAGTLTNKMA ALRKIYDQM  P+WVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPP+AEALLYG LQLQKKIKRM ++Q+WYRK
Sbjct:   36 KDMATESSVQEAKTQLPEKSKVEPYSPFQGP-SNMAEYALARLDDLLNWGRKGSIWPMTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQSDVIIVAGTLTNKMAPALRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALLYGVLQLQKKIKRMQTTQVWYRK 223          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. TrEMBL
Match: A0A3S1BEA5 (Oxidored_q6 domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_010623 PE=3 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 3.667e-87
Identity = 134/169 (79.29%), Postives = 153/169 (90.53%), Query Frame = 1
Query:  193 DDQELSPLKGPFSNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            + +  SP +GPFS+K E A+ RLDD++N+GRK S+WPMTFGLACCAVEMMH A PRYDMDRFG++FRASPRQSDV+IVAGTLTNKMA ALRKIYDQM  P+WVISMGSCANGGGYYHYSY+VVRGCDR++PVDIYVPGCPP+AEALLYG LQLQKK+KRM + QMWYRK
Sbjct:   69 EKKPYSPFQGPFSSKAEYALTRLDDLLNWGRKSSMWPMTFGLACCAVEMMHFAGPRYDMDRFGVVFRASPRQSDVLIVAGTLTNKMAPALRKIYDQMPEPRWVISMGSCANGGGYYHYSYAVVRGCDRVVPVDIYVPGCPPTAEALLYGVLQLQKKVKRMSTLQMWYRK 237          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. TrEMBL
Match: A0A1D2AHI0 (Nadh dehydrogenase (Fragment) OS=Ornithodoros brasiliensis OX=888526 PE=3 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 3.706e-87
Identity = 141/190 (74.21%), Postives = 166/190 (87.37%), Query Frame = 1
Query:  151 ATTSLRL--QKTPKIVDDQELSPLKGPFS-----NKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            A++S++   Q +P+ V   E +P+K P+S     NKVE A+AR DD++N+GRKGSIWP+TFGLACCAVEMMH+AAPRYDMDR+G++FRASPRQ+DVIIVAGT+TNKMA ALRK+YDQM  P+WVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPP+AEAL+YG L LQ+KIKRMD  QMWYRK
Sbjct:   23 ASSSVKFAQQVSPENVAQTESAPVKRPYSPFKPANKVEFALARADDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTVTNKMAPALRKVYDQMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILLLQRKIKRMDGVQMWYRK 212          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. TrEMBL
Match: A0A4S2KYI7 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Temnothorax longispinosus OX=300112 GN=DBV15_04312 PE=3 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.842e-87
Identity = 144/189 (76.19%), Postives = 164/189 (86.77%), Query Frame = 1
Query:  142 RNLATTSLRLQKTPKIVDDQELSPLKGPF---SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            +++AT S   +  P + +  ++ P   PF   SN  E A+AR+DDI+N+GRKGSIWPMTFGLACCAVEMMH+AAPRYDMDRFG++FRASPRQSDVIIVAGTLTNKMA ALRKIYDQM  P+WVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPP+AEALLYG LQLQKKIKRM ++Q+WYRK
Sbjct:   77 KDMATESSVQKAKPALPEKPKVEPYS-PFQQPSNMAEYALARIDDILNWGRKGSIWPMTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQSDVIIVAGTLTNKMAPALRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALLYGVLQLQKKIKRMQTAQVWYRK 264          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Cavefish
Match: ndufs7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:NCBI gene;Acc:103023339])

HSP 1 Score: 242.662 bits (618), Expect = 3.845e-80
Identity = 123/157 (78.34%), Postives = 143/157 (91.08%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S+K E  + +LDD++N+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQ+DV+IVAGTLTNKMA ALRK+YDQM  P++VISMGSCANGGGYYHYSYSVVRGCDRI+PVDIYVPGCPP+AEALLYG LQLQ+KIKR    ++WYRK
Sbjct:   75 SSKGEYVITKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGTLQLQRKIKREKKMRIWYRK 231          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Nematostella
Match: EDO41067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5C5])

HSP 1 Score: 229.565 bits (584), Expect = 9.335e-76
Identity = 122/185 (65.95%), Postives = 147/185 (79.46%), Query Frame = 1
Query:  148 LATTSLRLQKTPKIVDDQELSPLKGPFSNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIK-RMDSSQMWYRK 699
            L   SLRL K  K      +SP KG F   V   V +LDD++N+ R+ S+WP+ FGLACC +EMMH AAPRYDMDRFG++FRASPRQ DV++V+GT+TNKMA ALR++YDQM  P+WVIS+GSCAN GGYY++SYSVVRGCDRIIPVDIYVPGCPPSAEALL+G LQLQKK++ +     MWYRK
Sbjct:   27 LRPASLRLMKN-KTSTSSAVSP-KGRFDATVGYVVTKLDDLVNWSRRSSLWPLMFGLACCGIEMMHFAAPRYDMDRFGVVFRASPRQIDVMLVSGTVTNKMAPALRRLYDQMPEPRWVISVGSCANSGGYYYHSYSVVRGCDRIIPVDIYVPGCPPSAEALLFGVLQLQKKVRLKHHPIAMWYRK 209          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Nematostella
Match: EDO30410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0V9])

HSP 1 Score: 206.453 bits (524), Expect = 9.337e-68
Identity = 111/133 (83.46%), Postives = 122/133 (91.73%), Query Frame = 1
Query:  304 MTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIK-RMDSSQMWYRK 699
            MTFGLACCAVEMMH AAPRYDMDRFG++FRASPRQ+DV+IVAGTLTNKMA ALRK+YDQM  P+WVISMGSCANGGGYYHYSYSVVRGCDR+IPVDIYVPGCPP+AEALLYG LQLQKK++ +     MWYRK
Sbjct:    1 MTFGLACCAVEMMHFAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRVIPVDIYVPGCPPTAEALLYGVLQLQKKVRLKHHPITMWYRK 133          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Medaka
Match: ndufs7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:NCBI gene;Acc:101166042])

HSP 1 Score: 233.802 bits (595), Expect = 1.024e-76
Identity = 125/157 (79.62%), Postives = 143/157 (91.08%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S+K E  V +LDD+IN+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQ+DV+IVAGTLTNKMA ALRK+YDQM  P++VISMGSCANGGGYYHYSY+VVRGCDRI+PVDIYVPGCPP+AEALLYG LQLQKKIKR    ++WYRK
Sbjct:   63 SSKGEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRIVPVDIYVPGCPPTAEALLYGTLQLQKKIKREKKIKIWYRK 219          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Medaka
Match: ndufs7 (NADH:ubiquinone oxidoreductase core subunit S7 [Source:NCBI gene;Acc:101166042])

HSP 1 Score: 231.106 bits (588), Expect = 5.286e-76
Identity = 125/157 (79.62%), Postives = 143/157 (91.08%), Query Frame = 1
Query:  229 SNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            S+K E  V +LDD+IN+ R+ S+WPMTFGLACCAVEMMHMAAPRYDMDRFG++FRASPRQ+DV+IVAGTLTNKMA ALRK+YDQM  P++VISMGSCANGGGYYHYSY+VVRGCDRI+PVDIYVPGCPP+AEALLYG LQLQKKIKR    ++WYRK
Sbjct:   44 SSKGEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRIVPVDIYVPGCPPTAEALLYGTLQLQKKIKREKKIKIWYRK 200          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Planmine SMEST
Match: SMESG000020264.1 (SMESG000020264.1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.078e-139
Identity = 204/204 (100.00%), Postives = 204/204 (100.00%), Query Frame = 1
Query:   88 MLSLISLSKYGTIPFLSFRNLATTSLRLQKTPKIVDDQELSPLKGPFSNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            MLSLISLSKYGTIPFLSFRNLATTSLRLQKTPKIVDDQELSPLKGPFSNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK
Sbjct:    1 MLSLISLSKYGTIPFLSFRNLATTSLRLQKTPKIVDDQELSPLKGPFSNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 204          
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Planmine SMEST
Match: SMESG000035542.1 (SMESG000035542.1)

HSP 1 Score: 279.641 bits (714), Expect = 5.042e-95
Identity = 143/164 (87.20%), Postives = 157/164 (95.73%), Query Frame = 1
Query:  208 SPLKGPFSNKVEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGILFRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQMWYRK 699
            SPL+ P +NKVE A+A+LDD+INFGRKGSIWPMTFGLACCA+EMMHMAAPRYDMDRFG+LFRASPRQ+DVIIVAGTLTNKMATALRK+YDQM+ PKWVI+MGSCA GGGYYHYSYSVVRGCDRIIP DI+VPGCPPSAEALLYGFLQLQKKIKR ++SQMWYRK
Sbjct:   49 SPLQVPLTNKVEFALAKLDDLINFGRKGSIWPMTFGLACCAIEMMHMAAPRYDMDRFGLLFRASPRQTDVIIVAGTLTNKMATALRKVYDQMYPPKWVIAMGSCAIGGGYYHYSYSVVRGCDRIIPCDIFVPGCPPSAEALLYGFLQLQKKIKRHNASQMWYRK 212          
The following BLAST results are available for this feature:
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NDUFS72.493e-8078.34NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
NDUFS73.715e-6276.47NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
NDUFS73.715e-6276.47NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
NDUFS72.599e-6176.47NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
NDUFS79.397e-6180.00NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nduf-72.764e-8368.42Probable NADH dehydrogenase [ubiquinone] iron-sulf... [more]
nduf-72.764e-8368.42Probable NADH dehydrogenase [ubiquinone] iron-sulf... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ND-206.190e-8967.13gene:FBgn0030718 transcript:FBtr0340417[more]
ND-206.190e-8967.13gene:FBgn0030718 transcript:FBtr0074152[more]
ND-206.190e-8967.13gene:FBgn0030718 transcript:FBtr0074151[more]
ND-20L1.904e-8466.04gene:FBgn0039669 transcript:FBtr0085440[more]
ND-20L1.904e-8466.04gene:FBgn0039669 transcript:FBtr0339902[more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ndufs71.167e-7978.34NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
ndufs71.603e-7978.34NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
ndufs71.603e-7978.34NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ddx312.198e-8164.56DEAD-box helicase 31 [Source:Xenbase;Acc:XB-GENE-5... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ndufs71.234e-7977.56NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
Ndufs71.234e-7977.56NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q94360|NDUS7_CAEEL3.516e-8268.42Probable NADH dehydrogenase [ubiquinone] iron-sulf... [more]
sp|A8XFG2|NDUS7_CAEBR3.633e-8268.42Probable NADH dehydrogenase [ubiquinone] iron-sulf... [more]
sp|P42026|NDUS7_BOVIN5.969e-8079.62NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
sp|Q0MQI0|NDUS7_PANTR8.088e-8078.34NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
sp|P0CB83|NDUS7_PONAB8.729e-8078.98NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A151I9R22.290e-8977.66NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
A0A151X9B09.889e-8977.78NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
A0A3S1BEA53.667e-8779.29Oxidored_q6 domain-containing protein OS=Elysia ch... [more]
A0A1D2AHI03.706e-8774.21Nadh dehydrogenase (Fragment) OS=Ornithodoros bras... [more]
A0A4S2KYI73.842e-8776.19NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufs73.845e-8078.34NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO410679.335e-7665.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO304109.337e-6883.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ndufs71.024e-7679.62NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
ndufs75.286e-7679.62NADH:ubiquinone oxidoreductase core subunit S7 [So... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000020264.12.078e-139100.00SMESG000020264.1[more]
SMESG000035542.15.042e-9587.20SMESG000035542.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027215 ID=SMED30027215|Name=NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=870bp
CAAATTTTGAAAATTTAATTTTTTATTCGAATATAATTTTTTAATAAATA
TATATTAAATAACATTACTTCAGATTCTATTTTCAAAATGTTAAGTCTCA
TTAGTCTTAGTAAATATGGGACTATTCCATTTTTATCCTTTAGAAATCTT
GCCACTACTTCATTACGATTACAGAAAACTCCAAAAATAGTTGATGATCA
AGAACTTTCGCCTTTGAAAGGTCCATTCAGCAATAAAGTTGAAATTGCAG
TGGCAAGATTAGATGATATTATTAATTTTGGACGAAAAGGTTCGATCTGG
CCTATGACATTTGGATTGGCTTGTTGTGCTGTGGAAATGATGCATATGGC
AGCTCCACGATACGACATGGATCGTTTTGGAATATTATTTAGAGCAAGTC
CTAGACAATCTGATGTAATTATCGTCGCAGGAACTTTAACCAATAAAATG
GCAACTGCTCTTCGTAAAATATATGATCAAATGCATTATCCAAAATGGGT
GATTTCAATGGGCTCGTGTGCGAATGGTGGTGGCTATTATCATTATTCTT
ATAGTGTTGTTAGGGGTTGTGATCGAATAATTCCCGTAGATATTTATGTG
CCTGGTTGCCCTCCGTCAGCTGAAGCCCTTCTCTATGGATTTCTACAATT
GCAAAAGAAAATCAAGCGAATGGACAGCTCTCAAATGTGGTATAGAAAAT
AAAAGTTTTCTCTTATGCTGATTCTTAGCCAAAGTCGTTTTAATAAAATA
AAAGTTTTCTGTTGTTTCTTTGATCATTCCAAATGCGATTGTCATTTTTT
GTGAGCTAATGTTTTTGTGCCTATTGAATTGTATTGTTATTATTATTTTT
TAATAAATCGATTACATCTG
back to top

protein sequence of SMED30027215-orf-1

>SMED30027215-orf-1 ID=SMED30027215-orf-1|Name=SMED30027215-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=205bp
MLSLISLSKYGTIPFLSFRNLATTSLRLQKTPKIVDDQELSPLKGPFSNK
VEIAVARLDDIINFGRKGSIWPMTFGLACCAVEMMHMAAPRYDMDRFGIL
FRASPRQSDVIIVAGTLTNKMATALRKIYDQMHYPKWVISMGSCANGGGY
YHYSYSVVRGCDRIIPVDIYVPGCPPSAEALLYGFLQLQKKIKRMDSSQM
WYRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR006137NADH_UbQ_OxRdtase-like_20kDa
IPR006138NADH_UQ_OxRdtase_20Kd_su
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0051536iron-sulfur cluster binding
GO:0048038quinone binding
GO:0008137NADH dehydrogenase (ubiquinone) activity
GO:00515394 iron, 4 sulfur cluster binding
GO:0046872metal ion binding
GO:0016491oxidoreductase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006137NADH:ubiquinone oxidoreductase-like, 20kDa subunitPFAMPF01058Oxidored_q6coord: 79..187
e-value: 1.7E-22
score: 79.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.12280coord: 50..204
e-value: 4.7E-79
score: 265.2
NoneNo IPR availablePANTHERPTHR11995NADH DEHYDROGENASEcoord: 39..204
NoneNo IPR availablePANTHERPTHR11995:SF19NADH DEHYDROGENASE [UBIQUINONE] IRON-SULFUR PROTEIN 7, MITOCHONDRIALcoord: 39..204
NoneNo IPR availableSUPERFAMILYSSF56770HydA/Nqo6-likecoord: 53..201
IPR006138NADH-ubiquinone oxidoreductase, 20 Kd subunitTIGRFAMTIGR01957TIGR01957coord: 53..194
e-value: 3.6E-73
score: 242.2
IPR006138NADH-ubiquinone oxidoreductase, 20 Kd subunitPROSITEPS01150COMPLEX1_20Kcoord: 160..176