Solute carrier family 49 member 3

Overview
NameSolute carrier family 49 member 3
Smed IDSMED30027213
Length (bp)1603
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Solute carrier family 49 member 3 (SMED30027213) t-SNE clustered cells

Violin plots show distribution of expression levels for Solute carrier family 49 member 3 (SMED30027213) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Solute carrier family 49 member 3 (SMED30027213) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Solute carrier family 49 member 3 (SMED30027213) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027213

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027213SMESG000022425.1 Contig4995GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027213SMESG000032659.1 Contig6742GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027213SMESG000032659.1 Contig4995GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30027213SMESG000032659.1 dd_Smed_v4_5238_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027213SMESG000022425.1 Contig4995GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027213SMESG000032659.1 Contig4995GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30027213SMESG000032659.1 dd_Smed_v4_5238_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Solute carrier family 49 member 3 vs. Ensembl Human
Match: SLC49A3 (solute carrier family 49 member 3 [Source:HGNC Symbol;Acc:HGNC:26177])

HSP 1 Score: 182.956 bits (463), Expect = 2.388e-50
Identity = 132/371 (35.58%), Postives = 213/371 (57.41%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP-FCISCGILVI-SFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
            Y +RW  L A+S LN +N  LW+SFA V+D +A    +S++ IN+LSLV+ V++   G+  IW +D  GLR   +   WLN + ++LR      +V     +   M GQ + +LAQ L +FSPAKLA+LWFP HQRA A  +  M NPLG+L+ ++L P  ++      +  G+  I + +  LL T  ++ S PP PP+  +         F + ++  + +  +++L++  G  +G+    S LLEQILC  G+S  F+G CGAL I  G++G+   G   D+TK FTE  +  +   +   + F++++Q     + +AA+ + +G FG ++  VA+ELA E SFPV E  +TG++ V GQ   ++ ++
Sbjct:   26 YARRWVFLLAISLLNCSNATLWLSFAPVADVIAEDLVLSMEQINWLSLVYLVVSTPFGVAAIWILDSVGLRAATILGAWLNFAGSVLRMVPCM-VVGTQNPFAFLMGGQSLCALAQSLVIFSPAKLAALWFPEHQRATANMLATMSNPLGVLVANVLSPVLVKKGEDIPLMLGVYTIPAGVVCLLSTICLWESVPPTPPSAGAASSTS--EKFLDGLKLLMWNKAYVILAVCLGGMIGISASFSALLEQILCASGHSSGFSGLCGALFITFGILGALALGPYVDRTKHFTEATKIGLCLFSLACVPFALVSQLQGQTLALAATCSLLGLFGFSVGPVAMELAVECSFPVGEGAATGMIFVLGQAEGILIML 393          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Human
Match: SLC49A3 (solute carrier family 49 member 3 [Source:HGNC Symbol;Acc:HGNC:26177])

HSP 1 Score: 180.259 bits (456), Expect = 2.638e-49
Identity = 135/378 (35.71%), Postives = 215/378 (56.88%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP-FCISCGILVI-SFISALLPTFLIYRSRPPVPP-----TTFSDRPIDGHN--PFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
            Y +RW  L A+S LN +N  LW+SFA V+D +A    +S++ IN+LSLV+ V++   G+  IW +D  GLR   +   WLN + ++LR      +V     +   M GQ + +LAQ L +FSPAKLA+LWFP HQRA A  +  M NPLG+L+ ++L P  ++      +  G+  I + +  LL T  ++ S PP PP     ++ S++ +DG      W +         +++L++  G  +G+    S LLEQILC  G+S  F+G CGAL I  G++G+   G   D+TK FTE  +  +   +   + F++++Q     + +AA+ + +G FG ++  VA+ELA E SFPV E  +TG++ V GQ   ++ ++
Sbjct:   26 YARRWVFLLAISLLNCSNATLWLSFAPVADVIAEDLVLSMEQINWLSLVYLVVSTPFGVAAIWILDSVGLRAATILGAWLNFAGSVLRMVPCM-VVGTQNPFAFLMGGQSLCALAQSLVIFSPAKLAALWFPEHQRATANMLATMSNPLGVLVANVLSPVLVKKGEDIPLMLGVYTIPAGVVCLLSTICLWESVPPTPPSAGAASSTSEKFLDGLKLQLMWNKA--------YVILAVCLGGMIGISASFSALLEQILCASGHSSGFSGLCGALFITFGILGALALGPYVDRTKHFTEATKIGLCLFSLACVPFALVSQLQGQTLALAATCSLLGLFGFSVGPVAMELAVECSFPVGEGAATGMIFVLGQAEGILIML 394          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Human
Match: SLC49A3 (solute carrier family 49 member 3 [Source:HGNC Symbol;Acc:HGNC:26177])

HSP 1 Score: 147.517 bits (371), Expect = 1.640e-38
Identity = 114/332 (34.34%), Postives = 188/332 (56.63%), Query Frame = 2
Query:  311 LDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP-FCISCGILVI-SFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
            ++ IN+LSLV+ V++   G+  IW +D  GLR   +   WLN + ++LR      +V     +   M GQ + +LAQ L +FSPAKLA+LWFP HQRA A  +  M NPLG+L+ ++L P  ++      +  G+  I + +  LL T  ++ S PP PP+  +         F + ++  + +  +++L++  G  +G+    S LLEQILC  G+S  F+G CGAL I  G++G+   G   D+TK FTE  +  +   +   + F++++Q     + +AA+ + +G FG ++  VA+ELA E SFPV E  +TG++ V GQ   ++ ++
Sbjct:    1 MEQINWLSLVYLVVSTPFGVAAIWILDSVGLRAATILGAWLNFAGSVLRMVPCM-VVGTQNPFAFLMGGQSLCALAQSLVIFSPAKLAALWFPEHQRATANMLATMSNPLGVLVANVLSPVLVKKGEDIPLMLGVYTIPAGVVCLLSTICLWESVPPTPPSAGAASSTS--EKFLDGLKLLMWNKAYVILAVCLGGMIGISASFSALLEQILCASGHSSGFSGLCGALFITFGILGALALGPYVDRTKHFTEATKIGLCLFSLACVPFALVSQLQGQTLALAATCSLLGLFGFSVGPVAMELAVECSFPVGEGAATGMIFVLGQAEGILIML 329          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Human
Match: SLC49A3 (solute carrier family 49 member 3 [Source:HGNC Symbol;Acc:HGNC:26177])

HSP 1 Score: 91.2781 bits (225), Expect = 2.174e-20
Identity = 78/226 (34.51%), Postives = 123/226 (54.42%), Query Frame = 2
Query:  311 LDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP-FCISCGILVI-SFISALLPTFLIYRSRPPVPP-----TTFSDRPIDGHN--PFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSD 961
            ++ IN+LSLV+ V++   G+  IW +D  GLR   +   WLN + ++LR      +V     +   M GQ + +LAQ L +FSPAKLA+LWFP HQRA A  +  M NPLG+L+ ++L P  ++      +  G+  I + +  LL T  ++ S PP PP     ++ S++ +DG      W +         +++L++  G  +G+    S LLEQILC  G+S 
Sbjct:    1 MEQINWLSLVYLVVSTPFGVAAIWILDSVGLRAATILGAWLNFAGSVLRMVPCM-VVGTQNPFAFLMGGQSLCALAQSLVIFSPAKLAALWFPEHQRATANMLATMSNPLGVLVANVLSPVLVKKGEDIPLMLGVYTIPAGVVCLLSTICLWESVPPTPPSAGAASSTSEKFLDGLKLQLMWNK--------AYVILAVCLGGMIGISASFSALLEQILCASGHSS 217          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Human
Match: FLVCR2 (feline leukemia virus subgroup C cellular receptor family member 2 [Source:HGNC Symbol;Acc:HGNC:20105])

HSP 1 Score: 91.6633 bits (226), Expect = 5.102e-19
Identity = 103/378 (27.25%), Postives = 195/378 (51.59%), Query Frame = 2
Query:  197 KQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFI------EYSPFCISCGILVISFISALLPTFLI--YRSRPPVPPTTFSDRPIDGHNP---FWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQ-ILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVF 1294
            ++RW ++   S  +  N   WI + S+++    F+ VS   I++LS+ + +  I L LPV W ++KFGLR   +    LN   A ++  S        + +P+ + GQ++ S+AQ   +  P+++AS+WF +++ + A +V   GN LGI +G L+PP  +      +   + IS    +I  ++ LL   +I  ++ +P  PP+          +P   +   +     +L F++L +T+G+  G F  LSTLL + ++  +   +  AG  G  ++ +G++G+ ISG+  D++K + E      + T  G++ ++        +V +  +   +G F      +  E A E+++P SE IS+GLL +S Q+F ++F
Sbjct:   82 RRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSAFAIDWLSMCYMLTYIPLLLPVAWLLEKFGLRTIALTGSALNCLGAWVKLGSLKP-----HLFPVTVVGQLICSVAQVFILGMPSRIASVWFGANEVSTACSVAVFGNQLGIAIGFLVPPVLVPNIEDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPPSRAQSLSYALTSPDASYLGSIARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIGLTIVIAGMLGAVISGIWLDRSKTYKETTLVVYIMTLVGMVVYTFTLNLGHLWV-VFITAGTMGFFMTGYLPLGFEFAVELTYPESEGISSGLLNISAQVFGIIF 453          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Celegans
Match: B0416.5 (pep chromosome:WBcel235:X:9268626:9270853:-1 gene:WBGene00015181.1 transcript:B0416.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0416.5)

HSP 1 Score: 197.978 bits (502), Expect = 1.181e-56
Identity = 144/383 (37.60%), Postives = 224/383 (58.49%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGIL--VISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCI-VCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQ 1330
            +YKQRW +L A++ LN TN + WI +A   + +  F+  S     +LS+V+ + TI +G+  +W   ++GLR   +  GW N   A++R  S+   V  + R+PI M GQ + ++A P  MF P K+A  WFP  QRA+AT++G M NPLG+L+ +L+ P  ++     I   I   V S I+ L+ TF + RS P +PPT  + +P      F   M+ C SS  +I+L +  G G+G+F  L T++ ++LCP GYS+ F+G C AL+I  G+ G+  S +  D+TK + E ++  +     FG+I F  LT +  + V +  +    G  G+A Y + LELA+E +FPVSE  STGL+V+SGQI SV+++ + +    P Q
Sbjct:   41 VYKQRWIVLLAVALLNNTNTMSWIGYAPSGNYVNSFYGES--SAAWLSMVYMMCTIPVGMFAMWAGREWGLRTAVLIAGWANGIGAVIRVISSLDFVPQDLRFPICMTGQGIAAIAYPFIMFLPTKVAGSWFPDTQRAIATSIGVMSNPLGVLMANLISPAIVKSPEHVIWLNIFTCVPSLIAMLIATFGVNRSEPKIPPTFSASKP---QMDFVSGMKSCFSSKQYIILLIVMGGGIGMFNCLYTVMLELLCPSGYSNFFSGVCAALMIVGGVFGAAASSIFVDRTKLYEETLKIALGAAVIFGLI-FLQLTLHQGYSVILGVTCLLFGVLGLATYPIGLELASECTFPVSEATSTGLIVLSGQIQSVIYVFIMKNFARPLQ 417          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Celegans
Match: C05G5.1 (pep chromosome:WBcel235:X:14734443:14740088:-1 gene:WBGene00007347.1 transcript:C05G5.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05G5.1)

HSP 1 Score: 174.866 bits (442), Expect = 1.228e-48
Identity = 147/445 (33.03%), Postives = 248/445 (55.73%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP----FCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEI--VQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVIS---GSSAKNY------WRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTE 1480
            +Y +RW  L A+S +NF+NG  WI++A+++     +++ S   + + +++F V++I +G    W IDKFGLR       W N    ++R  ++   +D + R+PIA+ GQ V + AQP  MF P KLA+ WF  ++RA+A T+ +M NP+GI +   L P F+  +     F ++  +  ++ I  +L  F I +S+PP P T   D  +D   PF E ++ C  S  FIVLS+  G G+GLF  L   L+  LC  GY+  F G  G LLI SGL+G+ ISG++ DK   F ++  V FCI       ++  I  + V ++V +  S+   GA G ++Y + LE+  E +FPV+E  STGL+++ GQ+  V +++++ +    P    +P+   I     ++++N+      W F +++  ++V+ ++ +   F  KY R+  E
Sbjct:   12 VYPKRWIYLLAVSMINFSNGNTWITYAAITFYTNNYYSNSNAAL-FFNVIFMVLSIPVGFLACWWIDKFGLRSAYHIGTWANFIGNIIRLVASGTFIDPSLRFPIAITGQAVAAFAQPFVMFLPTKLAAYWFADNERAIANTLSSMSNPIGIAVMYSLAPVFVNKTTPDNFFNMNIAVTAVAVIPVILSLF-INKSKPPTPATPSRDTDVDAP-PFLEGVKICFKSKTFIVLSICLGGGVGLFNALYNNLQPALCVKGYNPTFNGGMGTLLIMSGLVGAAISGIIVDKWGEFEKVMKVSFCIAGVAAASLSICINYEGVQWWVIL--SIFIFGAAGFSIYPIGLEMGVEATFPVAEATSTGLIIMIGQVQGVFYVIMTNLAVGKP----DPHDMAIQTCVDTNSQNHTVLTWKWPFLIWLICISVLITSFVAF-FWPKYKRRNYE 446          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Celegans
Match: B0416.5 (pep chromosome:WBcel235:X:9268634:9270855:-1 gene:WBGene00015181.1 transcript:B0416.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0416.5)

HSP 1 Score: 158.688 bits (400), Expect = 1.047e-42
Identity = 130/383 (33.94%), Postives = 201/383 (52.48%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGIL--VISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCI-VCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQ 1330
            +YKQRW +L A++ LN TN + WI +A   + +  F+ +                                              A++R  S+   V  + R+PI M GQ + ++A P  MF P K+A  WFP  QRA+AT++G M NPLG+L+ +L+ P  ++     I   I   V S I+ L+ TF + RS P +PPT  + +P      F   M+ C SS  +I+L +  G G+G+F  L T++ ++LCP GYS+ F+G C AL+I  G+ G+  S +  D+TK + E ++  +     FG+I F  LT +  + V +  +    G  G+A Y + LELA+E +FPVSE  STGL+V+SGQI SV+++ + +    P Q
Sbjct:   41 VYKQRWIVLLAVALLNNTNTMSWIGYAPSGNYVNSFYGIG---------------------------------------------AVIRVISSLDFVPQDLRFPICMTGQGIAAIAYPFIMFLPTKVAGSWFPDTQRAIATSIGVMSNPLGVLMANLISPAIVKSPEHVIWLNIFTCVPSLIAMLIATFGVNRSEPKIPPTFSASKP---QMDFVSGMKSCFSSKQYIILLIVMGGGIGMFNCLYTVMLELLCPSGYSNFFSGVCAALMIVGGVFGAAASSIFVDRTKLYEETLKIALGAAVIFGLI-FLQLTLHQGYSVILGVTCLLFGVLGLATYPIGLELASECTFPVSEATSTGLIVLSGQIQSVIYVFIMKNFARPLQ 374          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Celegans
Match: C42C1.8 (pep chromosome:WBcel235:IV:12291046:12293287:1 gene:WBGene00016586.1 transcript:C42C1.8.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C42C1.8)

HSP 1 Score: 117.857 bits (294), Expect = 5.729e-28
Identity = 116/374 (31.02%), Postives = 198/374 (52.94%), Query Frame = 2
Query:  203 RWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGIL-VISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVI---AFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQV 1312
            RWF+L +++ LNF+N   WI++A V + +   +    +   + S+++  +++  G   ++   K  L +  +A   LN   AL+R  ST   VD   R+PI + GQ + ++A P  MF P+K+++  FP  QR +ATT+G M NPLG+++ +L+ P  ++ S       IL VI FI   +  F    S   + P     R     N +         +L + +L    G G+G+F  L T++ Q+LCP GY ++ AG C  L+IG G+IG+ ++ +  DK K +   +   IV   F VI    F  +++  +  + +     A G  G+A Y V LELA E ++P +  +S+G +V+ GQ+FSV+ + + ++
Sbjct:   84 RWFLLVSVALLNFSNTCSWIAYAPVGNYVNALYGE--ESAAWFSMIYMFVSVPFGFIGMYIGSKNTLNVPLIAACVLNAIGALIRALSTQPQVDPQNRFPICLLGQSIAAMAYPFIMFLPSKISATCFPPSQRTIATTIGVMANPLGVMVVNLVAPLIVQSSD---DVWILNVILFIICFVALFFAGCSLGCLKPDETKQRK---SNDYATSCGSVFGNLNYDILMFALGGGIGMFNSLYTMMLQMLCPSGYGNQVAGICAVLMIGCGMIGATVASIYVDKHKNYRTAM---IVLMNFAVIFGVGFLWMSKVPNMSLILFFISGAFGFCGLAAYPVGLELAIECTYPAAPEVSSGFIVLVGQLFSVLIVAIIKI 446          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Celegans
Match: C42C1.8 (pep chromosome:WBcel235:IV:12291046:12293317:1 gene:WBGene00016586.1 transcript:C42C1.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C42C1.8)

HSP 1 Score: 117.857 bits (294), Expect = 5.729e-28
Identity = 116/374 (31.02%), Postives = 198/374 (52.94%), Query Frame = 2
Query:  203 RWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGIL-VISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVI---AFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQV 1312
            RWF+L +++ LNF+N   WI++A V + +   +    +   + S+++  +++  G   ++   K  L +  +A   LN   AL+R  ST   VD   R+PI + GQ + ++A P  MF P+K+++  FP  QR +ATT+G M NPLG+++ +L+ P  ++ S       IL VI FI   +  F    S   + P     R     N +         +L + +L    G G+G+F  L T++ Q+LCP GY ++ AG C  L+IG G+IG+ ++ +  DK K +   +   IV   F VI    F  +++  +  + +     A G  G+A Y V LELA E ++P +  +S+G +V+ GQ+FSV+ + + ++
Sbjct:   84 RWFLLVSVALLNFSNTCSWIAYAPVGNYVNALYGE--ESAAWFSMIYMFVSVPFGFIGMYIGSKNTLNVPLIAACVLNAIGALIRALSTQPQVDPQNRFPICLLGQSIAAMAYPFIMFLPSKISATCFPPSQRTIATTIGVMANPLGVMVVNLVAPLIVQSSD---DVWILNVILFIICFVALFFAGCSLGCLKPDETKQRK---SNDYATSCGSVFGNLNYDILMFALGGGIGMFNSLYTMMLQMLCPSGYGNQVAGICAVLMIGCGMIGATVASIYVDKHKNYRTAM---IVLMNFAVIFGVGFLWMSKVPNMSLILFFISGAFGFCGLAAYPVGLELAIECTYPAAPEVSSGFIVLVGQLFSVLIVAIIKI 446          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Fly
Match: CG1358 (gene:FBgn0033196 transcript:FBtr0303287)

HSP 1 Score: 85.1149 bits (209), Expect = 2.684e-17
Identity = 117/401 (29.18%), Postives = 199/401 (49.63%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRI--------TCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCG-------ILVISFISALLPTFLI-YRSRPPVPPTTFSDRPIDGHNPFWEQMRF------CISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPF--GYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAI-------GAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
            +Y +RW +L    + + +N + WI +  +++ + R++ +S   +++ S+++ ++ I L  P  W +DK GLRI        TCV   W+ + S           VD +  Y ++  GQ + +LAQ   +  PA+LA++WF   Q + AT+VG  GN LG+ +G +LPP  +  SP   + G        LV    S LL   +I ++ +PP PP+   +      +   EQ+ F       +++  FI L L++G+ +G+F  +STLL  ++  +  G+    AG  G  ++ +G++GS +SG+V DKT  F E        TT  V A S++  ++  +      +A +       G F      V  E  AE++FP  E  S+GLL  S Q F + F +
Sbjct:   52 VYARRWAVLILFVFYSSSNAMQWIQYTIINNIITRYYGISDKWVDWTSMIYMILYIPLIFPGSWFLDKVGLRITALVGIVGTCVGA-WIKVFS-----------VDPSLFY-VSFIGQSIVALAQVCILSLPARLAAVWFGPDQVSSATSVGVFGNQLGVAVGFVLPPMLVPNSPDLETVGSDLQMMFYLVAGLTSILLVLMVIFFQDKPPTPPSAAQEAAQLLESSEAEQVSFMQSLKNLMTNRNFIFLLLSYGINVGVFYAISTLLNPVVLKYYPGHEVD-AGRIGLSIVLAGMLGSVVSGIVLDKTHKFKE--------TTLAVYALSMVGMWIFTFTLDTGHIAVVYLTASLLGFFMTGYLPVGFEFGAELTFPEPEGTSSGLLNASAQTFGICFTL 430          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Fly
Match: CG1358 (gene:FBgn0033196 transcript:FBtr0088948)

HSP 1 Score: 85.1149 bits (209), Expect = 2.684e-17
Identity = 117/401 (29.18%), Postives = 199/401 (49.63%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRI--------TCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCG-------ILVISFISALLPTFLI-YRSRPPVPPTTFSDRPIDGHNPFWEQMRF------CISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPF--GYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAI-------GAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
            +Y +RW +L    + + +N + WI +  +++ + R++ +S   +++ S+++ ++ I L  P  W +DK GLRI        TCV   W+ + S           VD +  Y ++  GQ + +LAQ   +  PA+LA++WF   Q + AT+VG  GN LG+ +G +LPP  +  SP   + G        LV    S LL   +I ++ +PP PP+   +      +   EQ+ F       +++  FI L L++G+ +G+F  +STLL  ++  +  G+    AG  G  ++ +G++GS +SG+V DKT  F E        TT  V A S++  ++  +      +A +       G F      V  E  AE++FP  E  S+GLL  S Q F + F +
Sbjct:   52 VYARRWAVLILFVFYSSSNAMQWIQYTIINNIITRYYGISDKWVDWTSMIYMILYIPLIFPGSWFLDKVGLRITALVGIVGTCVGA-WIKVFS-----------VDPSLFY-VSFIGQSIVALAQVCILSLPARLAAVWFGPDQVSSATSVGVFGNQLGVAVGFVLPPMLVPNSPDLETVGSDLQMMFYLVAGLTSILLVLMVIFFQDKPPTPPSAAQEAAQLLESSEAEQVSFMQSLKNLMTNRNFIFLLLSYGINVGVFYAISTLLNPVVLKYYPGHEVD-AGRIGLSIVLAGMLGSVVSGIVLDKTHKFKE--------TTLAVYALSMVGMWIFTFTLDTGHIAVVYLTASLLGFFMTGYLPVGFEFGAELTFPEPEGTSSGLLNASAQTFGICFTL 430          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Fly
Match: CG1358 (gene:FBgn0033196 transcript:FBtr0088950)

HSP 1 Score: 85.1149 bits (209), Expect = 2.684e-17
Identity = 117/401 (29.18%), Postives = 199/401 (49.63%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRI--------TCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCG-------ILVISFISALLPTFLI-YRSRPPVPPTTFSDRPIDGHNPFWEQMRF------CISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPF--GYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAI-------GAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
            +Y +RW +L    + + +N + WI +  +++ + R++ +S   +++ S+++ ++ I L  P  W +DK GLRI        TCV   W+ + S           VD +  Y ++  GQ + +LAQ   +  PA+LA++WF   Q + AT+VG  GN LG+ +G +LPP  +  SP   + G        LV    S LL   +I ++ +PP PP+   +      +   EQ+ F       +++  FI L L++G+ +G+F  +STLL  ++  +  G+    AG  G  ++ +G++GS +SG+V DKT  F E        TT  V A S++  ++  +      +A +       G F      V  E  AE++FP  E  S+GLL  S Q F + F +
Sbjct:   52 VYARRWAVLILFVFYSSSNAMQWIQYTIINNIITRYYGISDKWVDWTSMIYMILYIPLIFPGSWFLDKVGLRITALVGIVGTCVGA-WIKVFS-----------VDPSLFY-VSFIGQSIVALAQVCILSLPARLAAVWFGPDQVSSATSVGVFGNQLGVAVGFVLPPMLVPNSPDLETVGSDLQMMFYLVAGLTSILLVLMVIFFQDKPPTPPSAAQEAAQLLESSEAEQVSFMQSLKNLMTNRNFIFLLLSYGINVGVFYAISTLLNPVVLKYYPGHEVD-AGRIGLSIVLAGMLGSVVSGIVLDKTHKFKE--------TTLAVYALSMVGMWIFTFTLDTGHIAVVYLTASLLGFFMTGYLPVGFEFGAELTFPEPEGTSSGLLNASAQTFGICFTL 430          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Fly
Match: CG1358 (gene:FBgn0033196 transcript:FBtr0088949)

HSP 1 Score: 85.1149 bits (209), Expect = 2.684e-17
Identity = 117/401 (29.18%), Postives = 199/401 (49.63%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRI--------TCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCG-------ILVISFISALLPTFLI-YRSRPPVPPTTFSDRPIDGHNPFWEQMRF------CISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPF--GYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAI-------GAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
            +Y +RW +L    + + +N + WI +  +++ + R++ +S   +++ S+++ ++ I L  P  W +DK GLRI        TCV   W+ + S           VD +  Y ++  GQ + +LAQ   +  PA+LA++WF   Q + AT+VG  GN LG+ +G +LPP  +  SP   + G        LV    S LL   +I ++ +PP PP+   +      +   EQ+ F       +++  FI L L++G+ +G+F  +STLL  ++  +  G+    AG  G  ++ +G++GS +SG+V DKT  F E        TT  V A S++  ++  +      +A +       G F      V  E  AE++FP  E  S+GLL  S Q F + F +
Sbjct:   52 VYARRWAVLILFVFYSSSNAMQWIQYTIINNIITRYYGISDKWVDWTSMIYMILYIPLIFPGSWFLDKVGLRITALVGIVGTCVGA-WIKVFS-----------VDPSLFY-VSFIGQSIVALAQVCILSLPARLAAVWFGPDQVSSATSVGVFGNQLGVAVGFVLPPMLVPNSPDLETVGSDLQMMFYLVAGLTSILLVLMVIFFQDKPPTPPSAAQEAAQLLESSEAEQVSFMQSLKNLMTNRNFIFLLLSYGINVGVFYAISTLLNPVVLKYYPGHEVD-AGRIGLSIVLAGMLGSVVSGIVLDKTHKFKE--------TTLAVYALSMVGMWIFTFTLDTGHIAVVYLTASLLGFFMTGYLPVGFEFGAELTFPEPEGTSSGLLNASAQTFGICFTL 430          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Zebrafish
Match: CR855367.1 (feline leukemia virus subgroup C cellular receptor family, member 2b [Source:NCBI gene;Acc:569329])

HSP 1 Score: 91.6633 bits (226), Expect = 3.351e-19
Identity = 97/380 (25.53%), Postives = 187/380 (49.21%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFC--ISCGILVISFISALLPTFL------IYRSRPPVPPT--TFSDRPI--DGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVF 1294
            LYK+RW I+   S  +  N   WI +  +++   RF+ V    I+++S+++ +  I L  PV W +DK GLR+  +    LN +   ++ +S    +     +P+   GQ   S+AQ   +  P+++AS+WF S + + A ++G  GN LGI +G L+PP  +        ++  I V+ +I+A + TFL      +++ RP +PPT    + R I  + ++     +R   +    +++          +   + L   I+  +   +  AG  G  ++ +G++GS I G+  D++K + +      + +  G++ ++        +V +  +  A+G F      +  E A E+++P SE  S+GLL  S Q+F ++F
Sbjct:   38 LYKKRWVIVCLFSSYSLCNSYQWIQYGIINNIFMRFYGVDSFTIDWMSMIYMLTYIPLIFPVSWLLDKKGLRVIALVAAALNCAGTWIKVASARPDL-----FPVTFLGQFTCSVAQVFILGMPSRIASVWFGSDEVSTACSIGVFGNQLGIAIGFLVPPILVPNVDDLDELAAHIRVMFYITAGVATFLFVLVVIVFQERPEIPPTLAQAAARRISPESYSYTASILRLLRNKAFILLVITYGLNVGCFYAVSTLLNRMIIEHYPGEEVNAGRIGLTIVVAGMVGSLICGIWLDRSKTYKQTTLAVYLMSLMGLVIYAFTLDLHHLWV-VFITAGALGFFMTGYLPLGFEFAVELTYPESEGTSSGLLNCSAQVFGIIF 411          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Zebrafish
Match: flvcr2b (feline leukemia virus subgroup C cellular receptor family, member 2b [Source:ZFIN;Acc:ZDB-GENE-041210-312])

HSP 1 Score: 90.8929 bits (224), Expect = 4.942e-19
Identity = 97/380 (25.53%), Postives = 187/380 (49.21%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFC--ISCGILVISFISALLPTFL------IYRSRPPVPPT--TFSDRPI--DGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVF 1294
            LYK+RW I+   S  +  N   WI +  +++   RF+ V    I+++S+++ +  I L  PV W +DK GLR+  +    LN +   ++ +S    +     +P+   GQ   S+AQ   +  P+++AS+WF S + + A ++G  GN LGI +G L+PP  +        ++  I V+ +I+A + TFL      +++ RP +PPT    + R I  + ++     +R   +    +++          +   + L   I+  +   +  AG  G  ++ +G++GS I G+  D++K + +      + +  G++ ++        +V +  +  A+G F      +  E A E+++P SE  S+GLL  S Q+F ++F
Sbjct:   50 LYKKRWVIVCLFSSYSLCNSYQWIQYGIINNIFMRFYGVDSFTIDWMSMIYMLTYIPLIFPVSWLLDKKGLRVIALVAAALNCAGTWIKVASARPDL-----FPVTFLGQFTCSVAQVFILGMPSRIASVWFGSDEVSTACSIGVFGNQLGIAIGFLVPPILVPNVDDLDELAAHIRVMFYITAGVATFLFVLVVIVFQERPEIPPTLAQAAARRISPESYSYTASILRLLRNKAFILLVITYGLNVGCFYAVSTLLNRMIIEHYPGEEVNAGRIGLTIVIAGMVGSLICGIWLDRSKTYKQTTLAVYLMSLVGLVIYAFTLDLHHLWV-VFITAGALGFFMTGYLPLGFEFAVELTYPESEGTSSGLLNCSAQVFGIIF 423          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Zebrafish
Match: flvcr2b (feline leukemia virus subgroup C cellular receptor family, member 2b [Source:ZFIN;Acc:ZDB-GENE-041210-312])

HSP 1 Score: 90.8929 bits (224), Expect = 6.122e-19
Identity = 97/380 (25.53%), Postives = 187/380 (49.21%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFC--ISCGILVISFISALLPTFL------IYRSRPPVPPT--TFSDRPI--DGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVF 1294
            LYK+RW I+   S  +  N   WI +  +++   RF+ V    I+++S+++ +  I L  PV W +DK GLR+  +    LN +   ++ +S    +     +P+   GQ   S+AQ   +  P+++AS+WF S + + A ++G  GN LGI +G L+PP  +        ++  I V+ +I+A + TFL      +++ RP +PPT    + R I  + ++     +R   +    +++          +   + L   I+  +   +  AG  G  ++ +G++GS I G+  D++K + +      + +  G++ ++        +V +  +  A+G F      +  E A E+++P SE  S+GLL  S Q+F ++F
Sbjct:   38 LYKKRWVIVCLFSSYSLCNSYQWIQYGIINNIFMRFYGVDSFTIDWMSMIYMLTYIPLIFPVSWLLDKKGLRVIALVAAALNCAGTWIKVASARPDL-----FPVTFLGQFTCSVAQVFILGMPSRIASVWFGSDEVSTACSIGVFGNQLGIAIGFLVPPILVPNVDDLDELAAHIRVMFYITAGVATFLFVLVVIVFQERPEIPPTLAQAAARRISPESYSYTASILRLLRNKAFILLVITYGLNVGCFYAVSTLLNRMIIEHYPGEEVNAGRIGLTIVIAGMVGSLICGIWLDRSKTYKQTTLAVYLMSLVGLVIYAFTLDLHHLWV-VFITAGALGFFMTGYLPLGFEFAVELTYPESEGTSSGLLNCSAQVFGIIF 411          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Zebrafish
Match: flvcr1 (feline leukemia virus subgroup C cellular receptor 1 [Source:ZFIN;Acc:ZDB-GENE-041014-359])

HSP 1 Score: 74.7146 bits (182), Expect = 9.088e-14
Identity = 101/390 (25.90%), Postives = 189/390 (48.46%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXX----------XXXXXXYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTT----FSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQ-ILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVL 1315
            LY +R+ +L   S  +  N   WI ++ +++    ++ V+   I++LS+V+ V  + L  P  W +DK GLR+T +    LN   A ++ +S    +     + + M  Q++ S+AQ   +  P+++AS+WF   + + A     +GN LG+ +           +      + ++   +  G   +S +  LL  F+I + RPP+PP+      S  P + ++ + + +     + PFI+L +++G+  G F  +STLL Q I+  +   +   G  G  L+ +G+ GS + G+  D+TK +        V +  G++ F+  T  V   V I  +   +G F      +  E   EI++P SE  S+GLL    Q+F ++F ++   L
Sbjct:   72 LYWRRFAVLAVFSLYSLVNAFQWIQYSIITNIFMDYYGVTSIAIDWLSVVYMVAYVPLIFPATWLLDKKGLRVTALLGAGLNALGAWVKCASVGPGL-----FWVTMTAQIICSVAQVFILGLPSRIASVWFGPREVSTACAFAVLGNQLGVAIGFLLPPVLVPNTADDKDLMGHNISIMFYGTAAVSTLLFLLTIFVI-KDRPPLPPSKAQAVLSTGPAEDYS-YKKSIINLFRNKPFILLLISYGIMTGSFYSVSTLLNQMIITHYKGEELNTGRIGLTLVVAGMFGSILCGIWLDRTKTYKLTTLIVYVLSFIGMVVFT-FTLNVHLLV-IFFTAGVLGFFMTGYLPIGFEFGVEITYPESEGTSSGLLNAFAQVFGIIFTLIQGKL 452          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Zebrafish
Match: slc49a4 (solute carrier family 49 member 4 [Source:ZFIN;Acc:ZDB-GENE-040912-167])

HSP 1 Score: 72.0182 bits (175), Expect = 5.241e-13
Identity = 49/155 (31.61%), Postives = 77/155 (49.68%), Query Frame = 2
Query:  164 TEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAM 628
            T   P  S +Y +RWF+L   S L F  G++W ++  + ++    F  S  DI  L L  PV   +  L  +W +DK GLR + +   +  +  A LR   +  L D+ YR  +   GQ++  LA P  M +   L++ WF   QRA AT + ++
Sbjct:   25 TSTQPVFSRVYGRRWFVLTMFSLLGFMQGLVWNTWGPIQNSAKHVFEFSSTDIAILVLWGPV-GYLPWLLFMWLMDKKGLRASLLLSAFFMVLGAALR---SVPLKDLYYRRWMIHGGQLLNGLAGPTVMSAAPLLSTTWFAPDQRATATAIASL 175          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Xenopus
Match: prdm15 (PR domain 15 [Source:Xenbase;Acc:XB-GENE-1013930])

HSP 1 Score: 216.853 bits (551), Expect = 1.284e-63
Identity = 169/448 (37.72%), Postives = 257/448 (57.37%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMF---GQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCIS-CGILVISFISA-LLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITF------INTHE 1504
            YK+RWF+L  +  L+ TN +LWISFA V+D  A FF  SLD +NYLSLV+ +I I +G    W ID  GL+   V   WLN+  +++R  +    ++ +  Y    +   GQ + ++AQPL +F PAKLAS+WFP HQRA A  + +M NPLG+LL +++ P  +    +     GI  +  I+A +L T  I    PP PP+  +        PF   +R  +++  +++L L FG G+G+FT +S+ LEQILC  GYS+ FAG CGAL I  G IG+F+ G+  D+TK F E+V+ C   T    IAF+++  + +  V +A   + +G FG A+  V +ELA E S+PV E  STGL  +SGQI  +++++L Q L   P     P+   ++ +   ++    + M+++   GS + ++ F  KY R   E+ F      +NTHE
Sbjct:   37 YKRRWFVLGVICLLSCTNAMLWISFAPVADVTASFFKCSLDVVNYLSLVYLIIAIPVGFGASWLIDTLGLKYAIVFSSWLNMIGSIIRCGAIVPYLNPSGSYTGIYYLFTGQSLCAIAQPLVLFVPAKLASVWFPEHQRATANMIASMSNPLGVLLANIISPSVVTKEEYIAHMLGIYTVPAIAACILATAGIRAKSPPTPPSASAFN--SASEPFIAGIRQLLTNRAYVILMLCFGAGIGIFTAISSFLEQILCFRGYSNLFAGVCGALFIFFGFIGAFVCGLYVDRTKKFKEVVKTCFALTALTSIAFALVINFREQTVLVACVCSLLGLFGFAISPVGMELAVECSYPVGEGSSTGLAFISGQIQGIIYMILFQKL-TRPFATSGPSPCGMNQTEIYDWSTSMLVMAALCSFGSCIFIIFFHTKYKRLLAEVNFNGLKEELNTHE 481          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Xenopus
Match: prdm15 (PR domain 15 [Source:Xenbase;Acc:XB-GENE-1013930])

HSP 1 Score: 209.534 bits (532), Expect = 6.700e-61
Identity = 163/434 (37.56%), Postives = 250/434 (57.60%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMF---GQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCIS-CGILVISFISA-LLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTE 1480
            YK+RWF+L  +  L+ TN +LWISFA V+D  A FF  SLD +NYLSLV+ +I I +G    W ID  GL+   +   WLN+  +++R  +    ++ +  Y    +   GQ + ++AQPL +F PAKLAS+WFP HQRA A  + +M NPLG+LL +++ P  +    +     GI  +  I+A +L T  I    PP PP+  +        PF   +R  +++  +++L L FG G+G+FT +S+ LEQILC  GYS+ FAG CGAL I  G IG+F+ G+  D+TK F E+V+ C   T    IAF+++  + +  V +A   + +G FG A+  V +ELA E S+PV E  STGL  +SGQI  +++++L Q L   P     P+   ++ +   ++    + M+++   GS + ++ F  KY R   E
Sbjct:   37 YKRRWFVLGVICLLSCTNAMLWISFAPVADVTASFFKCSLDVVNYLSLVYLIIAIPVGFGASWLIDTLGLKYAVIFSSWLNMIGSIIRCGAIVPYLNPSGSYTGIYYLFTGQSLCAIAQPLVLFVPAKLASVWFPEHQRATANMIASMSNPLGVLLANIISPSVVTKEEYIAHMLGIYTVPAIAACILATAGIRAKSPPTPPSASAFN--SASEPFIAGIRQLLTNRAYVILMLCFGAGIGIFTAISSFLEQILCFRGYSNLFAGVCGALFIFFGFIGAFVCGLYVDRTKKFKEVVKTCFALTALTSIAFALVINFREQTVLVACVCSLLGLFGFAISPVGMELAVECSYPVGEGSSTGLAFISGQIQGIIYMILFQKL-TRPFATSGPSPCGMNQTEIYDWSTSMLVMAALCSFGSCIFIIFFHTKYKRLLAE 467          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Xenopus
Match: prdm15 (PR domain 15 [Source:Xenbase;Acc:XB-GENE-1013930])

HSP 1 Score: 209.534 bits (532), Expect = 9.759e-61
Identity = 163/434 (37.56%), Postives = 250/434 (57.60%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMF---GQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCIS-CGILVISFISA-LLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTE 1480
            YK+RWF+L  +  L+ TN +LWISFA V+D  A FF  SLD +NYLSLV+ +I I +G    W ID  GL+   +   WLN+  +++R  +    ++ +  Y    +   GQ + ++AQPL +F PAKLAS+WFP HQRA A  + +M NPLG+LL +++ P  +    +     GI  +  I+A +L T  I    PP PP+  +        PF   +R  +++  +++L L FG G+G+FT +S+ LEQILC  GYS+ FAG CGAL I  G IG+F+ G+  D+TK F E+V+ C   T    IAF+++  + +  V +A   + +G FG A+  V +ELA E S+PV E  STGL  +SGQI  +++++L Q L   P     P+   ++ +   ++    + M+++   GS + ++ F  KY R   E
Sbjct:   37 YKRRWFVLGVICLLSCTNAMLWISFAPVADVTASFFKCSLDVVNYLSLVYLIIAIPVGFGASWLIDTLGLKYAVIFSSWLNMIGSIIRCGAIVPYLNPSGSYTGIYYLFTGQSLCAIAQPLVLFVPAKLASVWFPEHQRATANMIASMSNPLGVLLANIISPSVVTKEEYIAHMLGIYTVPAIAACILATAGIRAKSPPTPPSASAFN--SASEPFIAGIRQLLTNRAYVILMLCFGAGIGIFTAISSFLEQILCFRGYSNLFAGVCGALFIFFGFIGAFVCGLYVDRTKKFKEVVKTCFALTALTSIAFALVINFREQTVLVACVCSLLGLFGFAISPVGMELAVECSYPVGEGSSTGLAFISGQIQGIIYMILFQKL-TRPFATSGPSPCGMNQTEIYDWSTSMLVMAALCSFGSCIFIIFFHTKYKRLLAE 467          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Xenopus
Match: ndufs5 (NADH:ubiquinone oxidoreductase subunit S5 [Source:Xenbase;Acc:XB-GENE-946984])

HSP 1 Score: 99.3673 bits (246), Expect = 1.158e-21
Identity = 108/401 (26.93%), Postives = 194/401 (48.38%), Query Frame = 2
Query:  143 HSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRA-------LATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGILVISFISALL--PTFLIYRSRPPVPPTT----FSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKF--AGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
             +   ++    P  + LY++R+ IL   S  +  N   WI ++ ++    +F+ V+ D I++LS+V+ V  + L  P  W +DK GLRIT +    LN   A L+ +S    +     + + MF Q V S+AQ   +  P+++AS+WF   + +       L   +G     L   +        +E +   IS      + +S LL   T  +++ +P +PP+       D   + ++     M     ++PF++L +++G+  G F  +STLL Q++  F Y D+   AG  G  L+ +G++GS I G+  D +K + +      + +  G++ F+  T  +D  V +  +   +G F      +  E A EI++P SE  S+GLL  S QIF ++F +
Sbjct:   45 QAERQAMLPGQPLETRLYRRRFLILAVFSLYSLVNAYQWIQYSIITSIFTQFYQVTSDKIDWLSVVYMVAYVPLIFPATWLLDKKGLRITALLGSGLNCLGAWLKCASVRPDL-----FGVTMFAQTVCSVAQVFILGLPSQVASVWFGPKEVSTACATAVLGNQLGTAIGFLLPPVLVPKVDDDVELTGHNISIMFYGTAVVSTLLFILTIAVFKEKPKIPPSQSQALLQDEATEDYSYKISIMNL-FRNVPFVLLLISYGIMTGSFYSVSTLLNQMIT-FHYPDEEVNAGRIGLTLVLAGMVGSIICGLWLDYSKTYKQTTLIVYILSFIGMLVFT-FTLDLDNLVVVFVTGGVLGFFMTGYLPLGFEFAVEITYPESEGTSSGLLNASAQIFGILFTL 437          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Xenopus
Match: ndufs5 (NADH:ubiquinone oxidoreductase subunit S5 [Source:Xenbase;Acc:XB-GENE-946984])

HSP 1 Score: 99.3673 bits (246), Expect = 1.222e-21
Identity = 108/401 (26.93%), Postives = 194/401 (48.38%), Query Frame = 2
Query:  143 HSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRA-------LATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGILVISFISALL--PTFLIYRSRPPVPPTT----FSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKF--AGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
             +   ++    P  + LY++R+ IL   S  +  N   WI ++ ++    +F+ V+ D I++LS+V+ V  + L  P  W +DK GLRIT +    LN   A L+ +S    +     + + MF Q V S+AQ   +  P+++AS+WF   + +       L   +G     L   +        +E +   IS      + +S LL   T  +++ +P +PP+       D   + ++     M     ++PF++L +++G+  G F  +STLL Q++  F Y D+   AG  G  L+ +G++GS I G+  D +K + +      + +  G++ F+  T  +D  V +  +   +G F      +  E A EI++P SE  S+GLL  S QIF ++F +
Sbjct:   48 QAERQAMLPGQPLETRLYRRRFLILAVFSLYSLVNAYQWIQYSIITSIFTQFYQVTSDKIDWLSVVYMVAYVPLIFPATWLLDKKGLRITALLGSGLNCLGAWLKCASVRPDL-----FGVTMFAQTVCSVAQVFILGLPSQVASVWFGPKEVSTACATAVLGNQLGTAIGFLLPPVLVPKVDDDVELTGHNISIMFYGTAVVSTLLFILTIAVFKEKPKIPPSQSQALLQDEATEDYSYKISIMNL-FRNVPFVLLLISYGIMTGSFYSVSTLLNQMIT-FHYPDEEVNAGRIGLTLVLAGMVGSIICGLWLDYSKTYKQTTLIVYILSFIGMLVFT-FTLDLDNLVVVFVTGGVLGFFMTGYLPLGFEFAVEITYPESEGTSSGLLNASAQIFGILFTL 440          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Mouse
Match: Mfsd7a (major facilitator superfamily domain containing 7A [Source:MGI Symbol;Acc:MGI:2442629])

HSP 1 Score: 187.578 bits (475), Expect = 1.541e-52
Identity = 143/390 (36.67%), Postives = 233/390 (59.74%), Query Frame = 2
Query:  146 SSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMF--GQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYS-PFCISCGILV-ISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIML 1303
             ++ +  + +P+  + Y +RW  L  +S L+ +N +LW+SFA V+D +A+ F +S+D +N+LSL++ V++I  G+  IW +D  GLR   +   WLN S ++LR       + V    P A F  GQ + +LAQ L + SPAKLA+LWFP HQRA A  +  M NPLG+L+ ++L P  ++ +    +  GI +  + ++ LL T  ++ S PP PP+T +         F   ++  I +  +++L++ FG G+G+F+  S LLEQILC  GYS++F+G CGAL I  G++G+ + G+  D+TK FTE  +  +  T+   +AF++++Q     + +AA  +  G FG ++  V +ELA E SFPV E  S GL+ V GQ   ++ ++L
Sbjct:   15 ETSGTAGDALPSPRV-YARRWVFLLVVSLLSCSNAMLWLSFAPVADTIAQHFFLSMDQVNWLSLIYFVLSIPFGMAAIWVLDSVGLRGATILGAWLNFSGSVLR---AVPCLPVRIPSPFAFFMSGQSLCALAQTLVVSSPAKLAALWFPEHQRATANMISTMSNPLGLLIANVLSPALVKKADDIPMMLGIYIGPAALACLLATVCLWESVPPTPPSTGAAN--STSESFLRGLKLLIQNKAYVLLAVCFGGGIGVFSSFSALLEQILCASGYSNEFSGLCGALFIVFGILGALLLGLYVDRTKHFTEATKIGLCLTSMTSVAFALVSQLQGQTLALAAICSLFGLFGFSVAPVVMELAVECSFPVGEGASAGLIFVLGQAEGMLIMLL 398          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Mouse
Match: Flvcr2 (feline leukemia virus subgroup C cellular receptor 2 [Source:MGI Symbol;Acc:MGI:2384974])

HSP 1 Score: 99.7525 bits (247), Expect = 1.091e-21
Identity = 109/378 (28.84%), Postives = 194/378 (51.32%), Query Frame = 2
Query:  197 KQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIE--YSPFCISCGILVISFISALLPTFL------IYRSRPPVPPT---TFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQ-ILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVF 1294
            K+RW ++   S  +  N   WI + S+++    F+ VS   I++LS+ + +  I L LPV W ++KFGLR   +    LN   A ++  S        + +P+ M GQV+ S+AQ   +  P+++AS+WF + + + A +V   GN LGI +G L+PP  +     P  ++  I ++ +I   + TFL      +++ +P  PP+   + S         +   +     +L F++L +T+G+  G F  LSTLL + ++  F   +  AG  G  ++ +G+ G+ ISG+  DK+K + E      + T  G++ ++        +V +  +   +G F      +  E A E+++P SE +S+GLL VS Q+F +VF
Sbjct:  105 KRRWVVVLVFSCYSLCNAFQWIQYGSINNIFMNFYGVSAFAIDWLSMCYMLTYIPLLLPVAWMLEKFGLRTIAITGSALNCLGAWVKLGSLEP-----HLFPVTMVGQVICSVAQVFILGMPSRIASVWFGADEVSTACSVAVFGNQLGIAIGFLVPPVLVPNIKDPEKLAYHISIMFYIIGGVATFLFILVIIVFKEKPKHPPSRAQSLSYALATTDASYLSSIVRLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVILHFPGEEVNAGRIGLTIVIAGMFGAMISGIWLDKSKTYKETTLVVYIMTLVGMVVYTFTLNLNHLWV-VFITAGTLGFFMTGYLPLGFEFAVELTYPESEGVSSGLLNVSAQVFGIVF 476          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Mouse
Match: Flvcr1 (feline leukemia virus subgroup C cellular receptor 1 [Source:MGI Symbol;Acc:MGI:2444881])

HSP 1 Score: 68.5514 bits (166), Expect = 1.859e-12
Identity = 42/137 (30.66%), Postives = 72/137 (52.55%), Query Frame = 2
Query:  176 PNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWF 586
            P  + L  +R+ +L   S  +  N   WI ++S+S+    F+ VS   IN+LS+V+ V  + L  P  W +D  GLR+T +    LN   A ++  S  +     + + + M GQ++ S+AQ   +  P+ +AS+WF
Sbjct:   49 PPRTALSPRRFVVLLIFSLYSLVNAFQWIQYSSISNVFEDFYEVSPLHINWLSMVYMVAYVPLIFPATWLLDTRGLRLTALLGSGLNCLGAWVKCGSVQR-----HLFWVTMLGQILCSVAQVFILGLPSPVASVWF 180          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Mouse
Match: Flvcr1 (feline leukemia virus subgroup C cellular receptor 1 [Source:MGI Symbol;Acc:MGI:2444881])

HSP 1 Score: 67.3958 bits (163), Expect = 4.158e-12
Identity = 42/137 (30.66%), Postives = 72/137 (52.55%), Query Frame = 2
Query:  176 PNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWF 586
            P  + L  +R+ +L   S  +  N   WI ++S+S+    F+ VS   IN+LS+V+ V  + L  P  W +D  GLR+T +    LN   A ++  S  +     + + + M GQ++ S+AQ   +  P+ +AS+WF
Sbjct:   91 PPRTALSPRRFVVLLIFSLYSLVNAFQWIQYSSISNVFEDFYEVSPLHINWLSMVYMVAYVPLIFPATWLLDTRGLRLTALLGSGLNCLGAWVKCGSVQR-----HLFWVTMLGQILCSVAQVFILGLPSPVASVWF 222          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Mouse
Match: Flvcr1 (feline leukemia virus subgroup C cellular receptor 1 [Source:MGI Symbol;Acc:MGI:2444881])

HSP 1 Score: 68.9366 bits (167), Expect = 8.255e-12
Identity = 43/145 (29.66%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  176 PNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALA 610
            P  + L  +R+ +L   S  +  N   WI ++S+S+    F+ VS   IN+LS+V+ V  + L  P  W +D  GLR+T +    LN   A ++  S  +     + + + M GQ++ S+AQ   +  P+ +AS+WF   + + A
Sbjct:   91 PPRTALSPRRFVVLLIFSLYSLVNAFQWIQYSSISNVFEDFYEVSPLHINWLSMVYMVAYVPLIFPATWLLDTRGLRLTALLGSGLNCLGAWVKCGSVQR-----HLFWVTMLGQILCSVAQVFILGLPSPVASVWFGPKEVSTA 230          
BLAST of Solute carrier family 49 member 3 vs. UniProt/SwissProt
Match: sp|Q28FF3|S49A3_XENTR (Solute carrier family 49 member A3 OS=Xenopus tropicalis OX=8364 GN=slc49a3 PE=2 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 6.800e-63
Identity = 169/448 (37.72%), Postives = 257/448 (57.37%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMF---GQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCIS-CGILVISFISA-LLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITF------INTHE 1504
            YK+RWF+L  +  L+ TN +LWISFA V+D  A FF  SLD +NYLSLV+ +I I +G    W ID  GL+   V   WLN+  +++R  +    ++ +  Y    +   GQ + ++AQPL +F PAKLAS+WFP HQRA A  + +M NPLG+LL +++ P  +    +     GI  +  I+A +L T  I    PP PP+  +        PF   +R  +++  +++L L FG G+G+FT +S+ LEQILC  GYS+ FAG CGAL I  G IG+F+ G+  D+TK F E+V+ C   T    IAF+++  + +  V +A   + +G FG A+  V +ELA E S+PV E  STGL  +SGQI  +++++L Q L   P     P+   ++ +   ++    + M+++   GS + ++ F  KY R   E+ F      +NTHE
Sbjct:   37 YKRRWFVLGVICLLSCTNAMLWISFAPVADVTASFFKCSLDVVNYLSLVYLIIAIPVGFGASWLIDTLGLKYAIVFSSWLNMIGSIIRCGAIVPYLNPSGSYTGIYYLFTGQSLCAIAQPLVLFVPAKLASVWFPEHQRATANMIASMSNPLGVLLANIISPSVVTKEEYIAHMLGIYTVPAIAACILATAGIRAKSPPTPPSASAFN--SASEPFIAGIRQLLTNRAYVILMLCFGAGIGIFTAISSFLEQILCFRGYSNLFAGVCGALFIFFGFIGAFVCGLYVDRTKKFKEVVKTCFALTALTSIAFALVINFREQTVLVACVCSLLGLFGFAISPVGMELAVECSYPVGEGSSTGLAFISGQIQGIIYMILFQKL-TRPFATSGPSPCGMNQTEIYDWSTSMLVMAALCSFGSCIFIIFFHTKYKRLLAEVNFNGLKEELNTHE 481          
BLAST of Solute carrier family 49 member 3 vs. UniProt/SwissProt
Match: sp|Q11073|YT45_CAEEL (Uncharacterized protein B0416.5 OS=Caenorhabditis elegans OX=6239 GN=B0416.5 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 1.502e-55
Identity = 144/383 (37.60%), Postives = 224/383 (58.49%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGIL--VISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCI-VCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQ 1330
            +YKQRW +L A++ LN TN + WI +A   + +  F+  S     +LS+V+ + TI +G+  +W   ++GLR   +  GW N   A++R  S+   V  + R+PI M GQ + ++A P  MF P K+A  WFP  QRA+AT++G M NPLG+L+ +L+ P  ++     I   I   V S I+ L+ TF + RS P +PPT  + +P      F   M+ C SS  +I+L +  G G+G+F  L T++ ++LCP GYS+ F+G C AL+I  G+ G+  S +  D+TK + E ++  +     FG+I F  LT +  + V +  +    G  G+A Y + LELA+E +FPVSE  STGL+V+SGQI SV+++ + +    P Q
Sbjct:   41 VYKQRWIVLLAVALLNNTNTMSWIGYAPSGNYVNSFYGES--SAAWLSMVYMMCTIPVGMFAMWAGREWGLRTAVLIAGWANGIGAVIRVISSLDFVPQDLRFPICMTGQGIAAIAYPFIMFLPTKVAGSWFPDTQRAIATSIGVMSNPLGVLMANLISPAIVKSPEHVIWLNIFTCVPSLIAMLIATFGVNRSEPKIPPTFSASKP---QMDFVSGMKSCFSSKQYIILLIVMGGGIGMFNCLYTVMLELLCPSGYSNFFSGVCAALMIVGGVFGAAASSIFVDRTKLYEETLKIALGAAVIFGLI-FLQLTLHQGYSVILGVTCLLFGVLGLATYPIGLELASECTFPVSEATSTGLIVLSGQIQSVIYVFIMKNFARPLQ 417          
BLAST of Solute carrier family 49 member 3 vs. UniProt/SwissProt
Match: sp|Q503P5|S49A3_DANRE (Solute carrier family 49 member A3 OS=Danio rerio OX=7955 GN=slc49a3 PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 1.546e-52
Identity = 153/447 (34.23%), Postives = 246/447 (55.03%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP--FCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNEAIE 1525
            +Y++RWFIL  L  LN +N + W++FA V+   A+   VSL  +N+LSLVF +  +V     +W +D  GLR + +   WLN    +LR      +      + + M GQ + +LAQPL +F+P KLA+LWFP HQRA A  + +M N +G+LL +LL P  + YS   F +     + + ++ LL T  I+++ PP P +  S        PF + +R  + +  + +L L FG G+G+FT  STLLEQILC  GYS+ FAG CGA+ I  G+ G+F+  +  D++K F E+++ C+  T+    AF++++Q     V +       G FG ++Y V +EL+ E + P+ E  S GL+  SGQI + ++++L Q L  P     +P  SV +  ++ N+    + M+ V  + S + ++ F  +Y R   E       E   +A +
Sbjct:   33 VYRRRWFILSVLCLLNCSNAMAWLTFAPVAGQSAQLLCVSLPLVNWLSLVFVLAAVVCSFSSMWVLDTLGLRCSLIGSSWLNACGCVLRVCGVLSVTPQWAVFAVVMCGQTLCALAQPLVIFAPTKLAALWFPDHQRATANMLASMANTVGLLLANLLSPLIVSYSGDLFLLLLIYSIPAAVACLLATLGIHQAVPPTPASASSSSSA--SEPFLQGIRQLLRNRAYWILLLCFGSGIGIFTCFSTLLEQILCVKGYSNGFAGVCGAVSIVCGVAGAFLLSLYVDRSKKFMEVMKICMCLTSVSCSAFAVVSQLPAQSVLLVLVCCCFGLFGYSVYPVGMELSVETTHPLGEATSAGLIFTSGQIQAALYLLLLQALATPTH---SPT-SVCAADTSLNWTVPVLVMAGVCAISSCVFVVFFHTEYRRLRAEADSATEPEPTGDAAD 473          
BLAST of Solute carrier family 49 member 3 vs. UniProt/SwissProt
Match: sp|Q8CE47|S49A3_MOUSE (Solute carrier family 49 member A3 OS=Mus musculus OX=10090 GN=Slc49a3 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.078e-51
Identity = 143/390 (36.67%), Postives = 233/390 (59.74%), Query Frame = 2
Query:  146 SSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMF--GQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYS-PFCISCGILV-ISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIML 1303
             ++ +  + +P+  + Y +RW  L  +S L+ +N +LW+SFA V+D +A+ F +S+D +N+LSL++ V++I  G+  IW +D  GLR   +   WLN S ++LR       + V    P A F  GQ + +LAQ L + SPAKLA+LWFP HQRA A  +  M NPLG+L+ ++L P  ++ +    +  GI +  + ++ LL T  ++ S PP PP+T +         F   ++  I +  +++L++ FG G+G+F+  S LLEQILC  GYS++F+G CGAL I  G++G+ + G+  D+TK FTE  +  +  T+   +AF++++Q     + +AA  +  G FG ++  V +ELA E SFPV E  S GL+ V GQ   ++ ++L
Sbjct:   15 ETSGTAGDALPSPRV-YARRWVFLLVVSLLSCSNAMLWLSFAPVADTIAQHFFLSMDQVNWLSLIYFVLSIPFGMAAIWVLDSVGLRGATILGAWLNFSGSVLR---AVPCLPVRIPSPFAFFMSGQSLCALAQTLVVSSPAKLAALWFPEHQRATANMISTMSNPLGLLIANVLSPALVKKADDIPMMLGIYIGPAALACLLATVCLWESVPPTPPSTGAAN--STSESFLRGLKLLIQNKAYVLLAVCFGGGIGVFSSFSALLEQILCASGYSNEFSGLCGALFIVFGILGALLLGLYVDRTKHFTEATKIGLCLTSMTSVAFALVSQLQGQTLALAAICSLFGLFGFSVAPVVMELAVECSFPVGEGASAGLIFVLGQAEGMLIMLL 398          
BLAST of Solute carrier family 49 member 3 vs. UniProt/SwissProt
Match: sp|Q6UXD7|S49A3_HUMAN (Solute carrier family 49 member A3 OS=Homo sapiens OX=9606 GN=SLC49A3 PE=1 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.267e-48
Identity = 135/378 (35.71%), Postives = 215/378 (56.88%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP-FCISCGILVI-SFISALLPTFLIYRSRPPVPP-----TTFSDRPIDGHN--PFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
            Y +RW  L A+S LN +N  LW+SFA V+D +A    +S++ IN+LSLV+ V++   G+  IW +D  GLR   +   WLN + ++LR      +V     +   M GQ + +LAQ L +FSPAKLA+LWFP HQRA A  +  M NPLG+L+ ++L P  ++      +  G+  I + +  LL T  ++ S PP PP     ++ S++ +DG      W +         +++L++  G  +G+    S LLEQILC  G+S  F+G CGAL I  G++G+   G   D+TK FTE  +  +   +   + F++++Q     + +AA+ + +G FG ++  VA+ELA E SFPV E  +TG++ V GQ   ++ ++
Sbjct:   26 YARRWVFLLAISLLNCSNATLWLSFAPVADVIAEDLVLSMEQINWLSLVYLVVSTPFGVAAIWILDSVGLRAATILGAWLNFAGSVLRMVPCM-VVGTQNPFAFLMGGQSLCALAQSLVIFSPAKLAALWFPEHQRATANMLATMSNPLGVLVANVLSPVLVKKGEDIPLMLGVYTIPAGVVCLLSTICLWESVPPTPPSAGAASSTSEKFLDGLKLQLMWNKA--------YVILAVCLGGMIGISASFSALLEQILCASGHSSGFSGLCGALFITFGILGALALGPYVDRTKHFTEATKIGLCLFSLACVPFALVSQLQGQTLALAATCSLLGLFGFSVGPVAMELAVECSFPVGEGAATGMIFVLGQAEGILIML 394          
BLAST of Solute carrier family 49 member 3 vs. TrEMBL
Match: A0A4W5JP92 (MFS domain-containing protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 4.814e-70
Identity = 177/440 (40.23%), Postives = 257/440 (58.41%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISC--GILVISFISA-------LLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVF-MSSVAVVGSTMMLLGFSAKYLRQTTE 1480
            +YK+RWFILF L  LN +N ILW++FA V+D+ A+F  V+LD IN+LS+++ V+ I L     W +D  GLRIT V   WLN+  A+LRF    + +     +P+ M GQ++ +LAQPL +F+P KLA+LWFP HQRA A  + +M NPLGIL+ S+       +SP  +     I ++ FI A       LL T  I  S PP PP+  ++       PF E ++  + +  +++L L FG G+ +FT  STLLEQI+C  GY++ FAG CG L I  G++G+   G+  DKTK FTE  +  +  +    IAFS+++Q  +  + +A + +  G FG ++Y VA+EL+ E S+PV E  S GL+ +SGQI SV++I+L Q L  P        CSV  G  A   WR  V  M+ +  V +   ++ F  KY R   E
Sbjct:   31 VYKRRWFILFVLCLLNCSNSILWLTFAPVADHSAQFMGVTLDQINWLSIIYMVVAIPLSFGTTWMLDTLGLRITLVLGSWLNMLGAVLRFVGIMRSLPSAANFPVVMGGQILCALAQPLVIFTPTKLAALWFPEHQRATANMIASMSNPLGILIASI-------FSPMIVGTTNNIPLLLFIYAVPAAIICLLATVGIRDSAPPTPPSASAESSN--SEPFLEGIKLLLRNKAYMILLLCFGSGIAVFTCFSTLLEQIMCARGYTNDFAGLCGGLFIVFGIVGAGFLGLYVDKTKKFTEATKVNMSLSALACIAFSVVSQMRNQGITVAVACSLFGFFGFSIYPVAMELSVECSYPVGEATSAGLIFISGQIQSVIYILLLQGLTKPMAYSPFSTCSV--GGDAALSWRVPVLVMAGLFSVFTCCFVIFFHTKYRRLDAE 459          
BLAST of Solute carrier family 49 member 3 vs. TrEMBL
Match: A0A060W5G4 (Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00066929001 PE=4 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 4.903e-70
Identity = 170/443 (38.37%), Postives = 248/443 (55.98%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXX------------XXXXXXXXXXXXYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVF-MSSVAVVGSTMMLLGFSAKYLRQTTE 1480
            +YK+RWFILF L  LN +N ILW++FA V+D+ A+F  V+LD IN+LS+++ V+ I L     W +D  GLRIT V   WLN+  A+LRF    + +     +P+ M GQ + +LAQPL +F+P KLA+LWFP HQRA A  + +M N             +     ++    FI   P  I+C          LL T  I  S PP PP+  ++       PF E ++  + +  +++L L FG G+ +FT  STLLEQI+C  GY++ FAG CG L I  G++G+   G+  DKTK FTE+ +  +  +    IAFS+++Q  +  + +A + +  G FG ++Y VA+EL+ E S+PV E  S GL+ +SGQI SV++I+L Q L  P        CSV  G  A   WR  V  M+ +  V +   ++ F  KY R   E
Sbjct:   28 VYKRRWFILFVLCLLNCSNSILWLTFAPVADHSAQFMGVTLDQINWLSMIYMVVAIPLSFGTTWMLDTLGLRITLVLGSWLNMLGAVLRFVGIMRNLPSAANFPVVMGGQTLCALAQPLVIFTPTKLAALWFPEHQRATANMIASMSNPLGILIASIFSPMIVGTTNNIPLLLFIYAVPAAITC----------LLATVGIRDSAPPTPPSASAESSN--SEPFLEGIKLLLRNKAYMILLLCFGSGIAVFTCFSTLLEQIMCVRGYTNDFAGLCGGLFIVFGIVGAGFLGLYVDKTKKFTEVTKVNMSLSALACIAFSVVSQMRNQGIAVAVACSLFGFFGFSIYPVAMELSVECSYPVGEATSAGLIFISGQIQSVIYILLLQGLTKPMAYSPFSTCSV--GGDAALSWRVPVLVMAGLFSVFTCCFVIFFHTKYRRLDAE 456          
BLAST of Solute carrier family 49 member 3 vs. TrEMBL
Match: W5UES3 (Major facilitator superfamily domain-containing protein 7 OS=Ictalurus punctatus OX=7998 GN=mfsd7 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 5.407e-70
Identity = 174/466 (37.34%), Postives = 259/466 (55.58%), Query Frame = 2
Query:  152 NNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIE-YSPFCISCG-----ILVISFISALLPTFL----IYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVF-MSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNE 1516
            N+S +   P   + YK+RWFIL  L  LN +N +LW++FA V+D  A    V+LD +N+LS+V+ V+ I L     W +D  GLR T +   WLN++ +++R       +  N  +P+ M GQ + SLAQPL +FSP KLA+LWFP HQRA A  + +M         + L   F+  +SP  +S       +L+I  I A++  FL    I +S PP PP+  +D       PF + ++  +++  +++L + FG G+G+FT  +TLLEQILC  GYS+ FAG CGAL I SG+IG+   G+  DKTK FTE ++  +  T+    AF++++Q  +  V I A  A  G FG A Y VA+EL+ E S+PV E  S GL+ +SGQI S+V+ ML   L    ++  +P     +G  A   W   V  M+ +  + S   ++ F  +Y R   E   + TH    E
Sbjct:   18 NSSQSRTAPEFRV-YKRRWFILLVLCVLNCSNSVLWLTFAPVADQTAEHLHVTLDQVNWLSVVYMVVAIPLSFITTWMLDTLGLRPTMILGSWLNMAGSVVRVVGVLSYLPENTMFPVVMAGQTLCSLAQPLVIFSPTKLAALWFPEHQRATANMIASM--------SNPLGLLFVNIFSPMILSRTNNLFMLLLIYAIPAIVICFLATVGIQKSVPPTPPSASADT--SSSEPFLQGIKLLLTNKAYMILLVCFGSGIGIFTCFATLLEQILCVKGYSNDFAGLCGALFIVSGVIGAAFLGLFVDKTKLFTESIKISMCLTSLSCTAFAVVSQLEEQKVIIGAVCALFGLFGFASYPVAMELSVECSYPVGEATSAGLVFISGQIQSIVYTMLLPAL--TTKLAHSPLSVCAAGDDANLSWMVPVLVMAGLCCLASCTFVVIFHTQYRRLNAEADAVKTHSAQTE 470          
BLAST of Solute carrier family 49 member 3 vs. TrEMBL
Match: A0A1S3ST56 (major facilitator superfamily domain-containing protein 7-like isoform X1 OS=Salmo salar OX=8030 GN=LOC106611635 PE=4 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 6.251e-70
Identity = 177/440 (40.23%), Postives = 257/440 (58.41%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISC--GILVISFISA-------LLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVF-MSSVAVVGSTMMLLGFSAKYLRQTTE 1480
            +YK+RWFILF L  LN +N ILW++FA V+D+ A+F  V+LD IN+LS+++ V+ I L     W +D  GLRIT V   WLN+  A+LRF    + +     +P+ M GQ + +LAQPL +F+P KLA+LWFP HQRA A  + +M NPLGIL+ S+       +SP  +     I ++ FI A       LL T  I  S PP PP+  ++       PF E ++  + +  +++L L FG G+ +FT  STLLEQI+C  GY++ FAG CG L I  G++G+   G+  DKTK FTE+ +  +  +    IAFS+++Q  +  + +A + +  G FG ++Y VA+EL+ E S+PV E  S GL+ +SGQI SV++I+L Q L  P        CSV  G  A   WR  V  M+ +  V +   ++ F  KY R   E
Sbjct:   28 VYKRRWFILFVLCLLNCSNSILWLTFAPVADHSAQFMGVTLDQINWLSIIYMVVAIPLSFGTTWMLDTLGLRITLVLGSWLNMLGAVLRFVGIMRSLPSAANFPVVMGGQTLCALAQPLVIFTPTKLAALWFPEHQRATANMIASMSNPLGILIASI-------FSPMIVGTTNNIPLLLFIYAVPAAIICLLATVGIRDSAPPTPPSASAESSN--SEPFLEGIKLLLRNKAYMILLLCFGSGIAVFTCFSTLLEQIMCVRGYTNDFAGLCGGLFIVFGIVGAGFLGLYVDKTKKFTEVTKVNMSLSALACIAFSVVSQMRNQGIAVAVACSLFGFFGFSIYPVAMELSVECSYPVGEATSAGLIFISGQIQSVIYILLLQGLTKPMAYSPFSTCSV--GGDAALSWRVPVLVMAGLFSVFTCCFVIFFHTKYRRLDAE 456          
BLAST of Solute carrier family 49 member 3 vs. TrEMBL
Match: A0A2D0SDQ3 (major facilitator superfamily domain-containing protein 7 OS=Ictalurus punctatus OX=7998 GN=mfsd7 PE=4 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 1.181e-69
Identity = 174/466 (37.34%), Postives = 259/466 (55.58%), Query Frame = 2
Query:  152 NNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIE-YSPFCISCG-----ILVISFISALLPTFL----IYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVF-MSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNE 1516
            N+S +   P   + YK+RWFIL  L  LN +N +LW++FA V+D  A    V+LD +N+LS+V+ V+ I L     W +D  GLR T +   WLN++ +++R       +  N  +P+ M GQ + SLAQPL +FSP KLA+LWFP HQRA A  + +M         + L   F+  +SP  +S       +L+I  I A++  FL    I +S PP PP+  +D       PF + ++  +++  +++L + FG G+G+FT  +TLLEQILC  GYS+ FAG CGAL I SG+IG+   G+  DKTK FTE ++  +  T+    AF++++Q  +  V I A  A  G FG A Y VA+EL+ E S+PV E  S GL+ +SGQI S+V+ ML   L    ++  +P     +G  A   W   V  M+ +  + S   ++ F  +Y R   E   + TH    E
Sbjct:   18 NSSQSRTAPEFRV-YKRRWFILLVLCVLNCSNSVLWLTFAPVADQTAEHLHVTLDQVNWLSVVYMVVAIPLSFITTWMLDTLGLRPTMILGSWLNMAGSVVRVVGVLSYLPENTMFPVVMAGQTLCSLAQPLVIFSPTKLAALWFPEHQRATANMIASM--------SNPLGLLFVNIFSPMILSRTNNLFMLLLIYAIPAIVICFLATVGIQKSVPPTPPSASADT--SSSEPFLQGIKLLLTNKAYMILLVCFGSGIGIFTCFATLLEQILCVKGYSNDFAGLCGALFIVSGVIGAAFLGLFVDKTKLFTESIKISMCLTSLSCTAFAVVSQLEEQKVIIGAVFALFGLFGFASYPVAMELSVECSYPVGEATSAGLVFISGQIQSIVYTMLLPAL--TTKLAHSPLSVCAAGDDANLSWMVPVLVMAGLCCLASCTFVVIFHTQYRRLNAEADAVKTHSAQTE 470          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Cavefish
Match: SLC49A3 (solute carrier family 49 member 3 [Source:HGNC Symbol;Acc:HGNC:26177])

HSP 1 Score: 213.772 bits (543), Expect = 3.090e-63
Identity = 151/401 (37.66%), Postives = 229/401 (57.11%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP--FCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWR 1390
            Y++RWFIL     LN +N + W++FA V+D  A    VSLD +N+LSLV+ V+ I L L   W +D  GLR+T +   WLN+  +++R       V     +P+ M GQ +G++AQPL +FSP KLA+LWFP +QRA A  + +M NPLG+L  ++L P  I  +   F +     + + +   L T  I  S PP PP+  ++       PF++ ++  + +  +++L + FG G+ +FT   TLLEQILC  GY++ FAG CGAL I  G+IG+   G+  DKTK FTE  +  I  T+    AF+++TQ  D    I    A  G FG ++Y V++EL+ E S+PV E  S GL+ +SGQI S+++  + Q L    ++  +P     +G      W+
Sbjct:   27 YRRRWFILSVACLLNCSNSMQWLTFAPVADLTAEGLHVSLDQVNWLSLVYMVVAIPLSLISTWMLDTLGLRLTLILGSWLNMVGSVMRVVGVLSFVPGWALFPVVMAGQTLGAVAQPLVIFSPTKLAALWFPDNQRATANMIASMSNPLGLLFANILSPLIISKTSNLFILLLTYAIPAIVVCFLATVGIRESVPPTPPSAGAET--SSSEPFFQGIKLLMKNKAYLILLVCFGSGIAIFTCFFTLLEQILCIKGYTNDFAGVCGALFIVFGVIGAAFLGLFVDKTKKFTEATKINICLTSLACTAFAVVTQMRDQKALIGVVCALFGLFGFSIYPVSMELSVECSYPVGEATSAGLIFISGQIQSIIYTEILQAL--TKKLADSPGSMCAAGGDDNLSWK 423          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Cavefish
Match: SLC49A3 (solute carrier family 49 member 3 [Source:HGNC Symbol;Acc:HGNC:26177])

HSP 1 Score: 213.772 bits (543), Expect = 9.443e-63
Identity = 151/401 (37.66%), Postives = 229/401 (57.11%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP--FCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWR 1390
            Y++RWFIL     LN +N + W++FA V+D  A    VSLD +N+LSLV+ V+ I L L   W +D  GLR+T +   WLN+  +++R       V     +P+ M GQ +G++AQPL +FSP KLA+LWFP +QRA A  + +M NPLG+L  ++L P  I  +   F +     + + +   L T  I  S PP PP+  ++       PF++ ++  + +  +++L + FG G+ +FT   TLLEQILC  GY++ FAG CGAL I  G+IG+   G+  DKTK FTE  +  I  T+    AF+++TQ  D    I    A  G FG ++Y V++EL+ E S+PV E  S GL+ +SGQI S+++  + Q L    ++  +P     +G      W+
Sbjct:   27 YRRRWFILSVACLLNCSNSMQWLTFAPVADLTAEGLHVSLDQVNWLSLVYMVVAIPLSLISTWMLDTLGLRLTLILGSWLNMVGSVMRVVGVLSFVPGWALFPVVMAGQTLGAVAQPLVIFSPTKLAALWFPDNQRATANMIASMSNPLGLLFANILSPLIISKTSNLFILLLTYAIPAIVVCFLATVGIRESVPPTPPSAGAET--SSSEPFFQGIKLLMKNKAYLILLVCFGSGIAIFTCFFTLLEQILCIKGYTNDFAGVCGALFIVFGVIGAAFLGLFVDKTKKFTEATKINICLTSLACTAFAVVTQMRDQKALIGVVCALFGLFGFSIYPVSMELSVECSYPVGEATSAGLIFISGQIQSIIYTEILQAL--TKKLADSPGSMCAAGGDDNLSWK 423          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Cavefish
Match: SLC49A3 (solute carrier family 49 member 3 [Source:HGNC Symbol;Acc:HGNC:26177])

HSP 1 Score: 203.371 bits (516), Expect = 7.370e-60
Identity = 143/362 (39.50%), Postives = 212/362 (58.56%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP--FCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSG 1273
            Y++RWFIL     LN +N + W++FA V+D  A    VSLD +N+LSLV+ V+ I L L   W +D  GLR+T +   WLN+  +++R       V     +P+ M GQ +G++AQPL +FSP KLA+LWFP +QRA A  + +M NPLG+L  ++L P  I  +   F +     + + +   L T  I  S PP PP+  ++       PF++ ++  + +  +++L + FG G+ +FT   TLLEQILC  GY++ FAG CGAL I  G+IG+   G+  DKTK FTE  +  I  T+    AF+++TQ  D    I    A  G FG ++Y V++EL+ E S+PV E  S GL+ +SG
Sbjct:   27 YRRRWFILSVACLLNCSNSMQWLTFAPVADLTAEGLHVSLDQVNWLSLVYMVVAIPLSLISTWMLDTLGLRLTLILGSWLNMVGSVMRVVGVLSFVPGWALFPVVMAGQTLGAVAQPLVIFSPTKLAALWFPDNQRATANMIASMSNPLGLLFANILSPLIISKTSNLFILLLTYAIPAIVVCFLATVGIRESVPPTPPSAGAET--SSSEPFFQGIKLLMKNKAYLILLVCFGSGIAIFTCFFTLLEQILCIKGYTNDFAGVCGALFIVFGVIGAAFLGLFVDKTKKFTEATKINICLTSLACTAFAVVTQMRDQKALIGVVCALFGLFGFSIYPVSMELSVECSYPVGEATSAGLIFISG 386          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Cavefish
Match: flvcr2b (feline leukemia virus subgroup C receptor-related protein 2-like [Source:NCBI gene;Acc:103039762])

HSP 1 Score: 104.375 bits (259), Expect = 2.384e-23
Identity = 113/389 (29.05%), Postives = 204/389 (52.44%), Query Frame = 2
Query:  167 EVMPN-HSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFC--ISCGILVISFISALLPTFL------IYRSRPPVPPT--TFSDRPIDGHNPFWEQMRFC-ISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKF-AGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVF 1294
            E+MP   + LY QRW +L   S+ + +N ++W+ +  +S+   RF++V    I++LS+++ +  + L +P +W +D  GLR   +     N   A +R       +     +P+A FGQ V S+A    +  P +LASLWF   + + A ++G +GN LGI +G L+PP  +        ++  I V+ +I+A + T L      +++ RP +PPT    + R I   N  +     C + + PFI+L +++G+ +G F  +STLL +++      ++  AG  G  ++ +G++GS I G+  DKTK + +      V +  G++ ++        +V +  +  A+G F      +  E A E+++P SE  S+GLL  S Q+F ++F
Sbjct:   69 ELMPKTDTKLYSQRWVMLLIFSFCSTSNAMMWLQYGIISNVFMRFYSVDSMAIDWLSMIYMLTYVPLIVPGMWLMDSRGLREAVLIGAAFNCLGAWIRLGGVEPDL-----FPVAFFGQFVCSVAMVFILGVPPRLASLWFGEREVSTACSIGVLGNQLGIAIGFLVPPILVPNVEDMDELAGHIRVMFYITAGVATLLFILVVIVFQERPDIPPTQAQAAARLIPAENYSYTASILCLLRNRPFILLIISYGLNVGCFYAVSTLLNRMIIEHYPGEEVNAGRIGLTIVIAGMVGSLICGIWLDKTKTYKQTTLAVYVMSLVGMVVYAFTLNLGHLWV-VFITAGALGFFMTGYLPLGFEFAVELTYPESEGTSSGLLNCSAQVFGIIF 451          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Cavefish
Match: flvcr2b (feline leukemia virus subgroup C receptor-related protein 2-like [Source:NCBI gene;Acc:103039762])

HSP 1 Score: 98.5969 bits (244), Expect = 1.358e-21
Identity = 108/380 (28.42%), Postives = 200/380 (52.63%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFC--ISCGILVISFISALLPTFL------IYRSRPPVPPT--TFSDRPIDGHNPFWEQMRFC-ISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKF-AGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVF 1294
            LYK+RW I+   S  +  N   WI +  +++   +F+ V    I+++S+++ +  I L  PV W +DK GLR+  +    +N +   ++ +S    +     + +  FGQV+ S+AQ   +  P+++AS+WF S + + A ++G  GN LGI +G L+PP  +        ++  I V+ +I+A + T L      +++ RP +PPT    + R I   N  +     C + + PFI+L +++G+ +G F  +STLL +++      ++  AG  G  ++ +G++GS I G+  DKTK + +      V +  G++ ++        +V +  +  A+G F      +  E A E+++P SE  S+GLL  S Q+F ++F
Sbjct:   50 LYKRRWLIVCLFSSYSLCNSYQWIQYGIINNIFMKFYNVDSFTIDWMSMIYMLTYIPLIFPVTWLLDKKGLRVIALVATAMNCAGTWVKVASGRPDL-----FGVTFFGQVICSVAQVFILGMPSRIASVWFGSEEVSTACSIGVFGNQLGIAIGFLVPPILVPNVEDMDELAGHIRVMFYITAGVATLLFILVVIVFQERPDIPPTQAQAAARLIPAENYSYTASILCLLRNRPFILLIISYGLNVGCFYAVSTLLNRMIIEHYPGEEVNAGRIGLTIVIAGMVGSLICGIWLDKTKTYKQTTLAVYVMSLVGMVVYAFTLNLGHLWV-VFITAGALGFFMTGYLPLGFEFAVELTYPESEGTSSGLLNCSAQVFGIIF 423          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Sea Lamprey
Match: SLC49A3 (solute carrier family 49 member 3 [Source:HGNC Symbol;Acc:HGNC:26177])

HSP 1 Score: 223.787 bits (569), Expect = 2.515e-67
Identity = 158/466 (33.91%), Postives = 250/466 (53.65%), Query Frame = 2
Query:  125 SLAAIMHSSNNSLTEVMPNHSI--LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYR-YPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMX---XXXXXXXXXXXXXYFIEYSP-----FCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEI--VQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFM-SSVAVVGSTMMLLGFSAKYLRQTTE 1480
             L  +     +SL  V     +  +Y +RWF+L  L  LN +N ++W+SFA ++D  A FF +SL  +N+L++VF V  I  G+   W +D  GLR+T V   WLN   ++LR  S + L+    + +P+ M GQ +G+LAQP  +F+P KLA++WFP  QRA A T+ +M      L   + S    Y  +  P     +C+       + ++  L T  +    PP PP+  +  P     PFW  ++  +++ P++VL   FG G+ LFT  +TLLEQILC  GYSD F+G CGAL IG G+IG+ + G   D++K F E+  + FC+      V A     +  ++ + +A  V   G FG ++Y V +EL  E ++PV E  S+G+L +SGQ+  V++I+L QV+  P      P             W  +V + + +A++G+  M++ F  +Y R+  E
Sbjct:   10 KLLGMTEDPEDSLGSVDSGAHVYHVYARRWFVLAVLCLLNLSNALIWLSFAPIADKAATFFGISLAQVNWLAIVFLVACIPCGIVASWSMDSIGLRVTLVLGSWLNALGSVLRALSDHPLMPTALKGFPLLMTGQTLGALAQPFLLFAPTKLAAVWFPDSQRATANTLASMSNPLGILLANVLSPTIVYEADQMPMMLYLYCLP------AVLACALATCGVCSGSPPTPPSLGATHPTG--EPFWRSVKAVMTNKPYLVLFFCFGAGVALFTAFTTLLEQILCSRGYSDSFSGLCGALTIGFGIIGAGLVGFYVDRSKKFVEVAKINFCLAALAACVFAMVCGMREQEYVIAVACCV--FGMFGFSIYPVCMELGVECTYPVGEATSSGILFISGQLQGVLYIVLMQVVARPLPATAVPTAVCHGNGMTPQDWTVSVLLFAGIAMLGACCMVVAFRTEYRRRKAE 465          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010440.1 (pep scaffold:Pmarinus_7.0:GL482629:3025:14749:1 gene:ENSPMAG00000009452.1 transcript:ENSPMAT00000010440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 1.527e-16
Identity = 100/353 (28.33%), Postives = 186/353 (52.69%), Query Frame = 2
Query:  296 FFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYS--PFCISCGILVISFISALLPT------FLIYRSRPPVPPT---TFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQI-LCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTF-GVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVL 1315
            ++ VS  D+++LS+V+ +  I L  P  W +D  GLR+  +   +LN   A ++ +S        + + + +FGQ+  ++AQ   +  P+++AS+WF S + + A ++G  GN LG+ +G LLPP  +  S     +S  I V+ F +A + T       L++R  PPV P+       +       +W+ ++  +++  F++L +T+G+  G F  +STLL  + +  +   +  AG  G  ++ +G++GS + GV  D+TK F +   F + C +F G+I F+        +V +  +   +G F      +  E AAE+++P SE  S+GLL  + Q+F ++F ++   L
Sbjct:    1 YYDVSTTDVDWLSMVYMLCYIPLIFPSAWLLDTRGLRLVALLGSFLNCVGAWVKTASVRP-----HLFGVTVFGQLTCAIAQVFILGLPSRIASVWFGSGEVSTACSIGVFGNQLGVAVGFLLPPMLVPASDDKEALSYHIRVMFFGTAAIATALFVIVLLVFREEPPVAPSQAQAMRRQKRRSDYSYWQSIQRLLTNKAFVLLIITYGINTGSFYSVSTLLNPMFIHHYQGQEVNAGRVGLTIVVAGVLGSLLCGVWLDRTKKFKQ-TTFAVYCLSFTGMIIFTFTLNLGHLWV-VFVTAGLLGFFMTGYIPLGFEFAAELTYPESEGTSSGLLNAAAQLFGLIFTVVQGQL 346          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010776.1 (pep scaffold:Pmarinus_7.0:GL480222:20049:28221:1 gene:ENSPMAG00000009761.1 transcript:ENSPMAT00000010776.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 7.032e-16
Identity = 46/143 (32.17%), Postives = 76/143 (53.15%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTV 619
            L  +RW +LF  S  +  N   WI ++ VS+  AR++ VSL  +++LS+V+ ++ + L  PV W +D  GLR+  V    LN   A L+ +S       +  + I M  Q V S+ Q   +  P+++AS+WF   + + A  V
Sbjct:   22 LSSRRWLVLFVFSTYSLANAFQWIEYSIVSNIFARYYDVSLMAVDWLSMVYMLLYVPLIFPVTWMLDLKGLRLIAVVGSALNCVGAWLKLASVRP---DHAGFGITMLAQAVCSVGQVFILGMPSRIASVWFGPREVSTACAV 161          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000483.1 (pep scaffold:Pmarinus_7.0:GL476512:313253:328214:1 gene:ENSPMAG00000000432.1 transcript:ENSPMAT00000000483.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 1.329e-12
Identity = 62/223 (27.80%), Postives = 113/223 (50.67%), Query Frame = 2
Query:  146 SSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSP------FCISC---GILVISFISALLPTFLIYRSRPPVPPT 787
            +  +S T    N + LY +RW I+   S  + +N   WI ++ +++   RF+ V    +++LS+V+ +  I L  P+ W +D  GLR T +     +   A L+ +S   +      + + +  Q + +++    +  P+++A++WF   + + A  +G  GN +GI LG LLPP  + YS       + ISC   G   +S    LL T L++R +P +PP+
Sbjct:   20 AGGSSSTPPYANKTRLYCRRWVIVTIFSVYSLSNAFQWIEYSIINNIFVRFYGVDSGAVDWLSMVYMLAYIPLIFPITWLLDHHGLRTTALLATVFDALGAWLKVAS---VRPDGLGFGVTVLAQTLCAISNAFIIGMPSRVAAVWFGPQEVSTACALGVFGNQVGIALGFLLPPLIVPYSEEVSELGYNISCMFYGAAAVSTAVFLLVT-LLFREKPSLPPS 238          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Sea Lamprey
Match: slc49a4 (solute carrier family 49 member 4 [Source:ZFIN;Acc:ZDB-GENE-040912-167])

HSP 1 Score: 58.9214 bits (141), Expect = 1.404e-9
Identity = 42/145 (28.97%), Postives = 72/145 (49.66%), Query Frame = 2
Query:  194 YKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAM 628
            Y++RW +L A   L+F  G +W ++  V+++    F     D+  L +  PV  I+  L V+  +DK GLR + +A   + +    LR   T    D   R  +   GQ++  +A    M +P  L++ WFP+ QR  AT + ++
Sbjct:   39 YRRRWAVLAAFCCLSFLQGQVWNTWGPVAESARLVFGWGPGDVALLVVWGPVGFILCPLSVLL-LDKRGLRSSLLATSLVVVLGCSLRVIPT---ADSATRKWLIQVGQLLNGIAGTTTMAAPPYLSAAWFPAKQRTTATAIASL 179          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Nematostella
Match: EDO47643 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLQ2])

HSP 1 Score: 161.384 bits (407), Expect = 8.250e-45
Identity = 126/357 (35.29%), Postives = 200/357 (56.02%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGILVI-SFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGL 1258
            +Y +RWF+L  L  LNF+N ++W++FA ++D  A+F+  SL  IN+LS+++ V+ +  GL   W +D +GLR   +   WLN + A +R   +   V   YR+ + M GQ + SLAQP  + SP KLA+ WF +++RA A    ++ NPLG+L+ S + P   +     +   +  I +F+   + TF    S PP PPT  +    +   PF+  ++  + +  F++L + FG G+GLF+ LSTLL+Q++CP GY+D  AG  GA+LIG+GL+G  I+G   D TK F    +          I F++ ++       +  + A  G F  +L  V LEL  E ++P +E  S GL
Sbjct:    3 VYTRRWFMLLVLCVLNFSNAMIWLTFAPIADKSAKFYNTSLSGINWLSIIYLVVCMCFGLCASWMLDTWGLRAGVLTGAWLNGTGAGVRIIGSLHFVPSKYRFAVVMVGQGLASLAQPFILNSPTKLAATWFAANERATANMFASLANPLGVLVASAIAPIIEKKFDIVLVVEVFAIPAFLGVTMATFGFCNSLPPSPPTMSAASKSE---PFFSGLKQVLKNKTFLILMVAFGGGIGLFSCLSTLLQQVICPHGYTDTQAGVAGAVLIGTGLVGGAITGSYVDATKKFEATAKVSYGFAAIACIFFALASRENHHVAEVMITSAVFGFFAFSLMPVCLELGVECTYPAAEATSAGL 356          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Nematostella
Match: EDO49337 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHF0])

HSP 1 Score: 107.457 bits (267), Expect = 3.607e-25
Identity = 102/389 (26.22%), Postives = 193/389 (49.61%), Query Frame = 2
Query:  182 HSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFC--ISCGI--------LVISFISALLPTFLIYRSRPPVPPTT----FSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCP-FGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIML 1303
             + LYK+RW +LF    L+ TN   WI FA++SD +  F+ VS   +N LS+VF  + I+  +P  W +D++GL++        N+  A L++  +    +  + + +A  GQ V ++AQ   +  P ++A++WF  ++R++AT +G   + +G+ +     P  +  SP    +S G+        ++ S I A +   + +   PPVPP+       D+       + E      S+  ++ L + +G+  G    ++TLL ++    F   +   G  G + + +GL  + ++G+  D+T A+ +   F +  +   +IAFSI  ++      +   +A +G    +   +  E AAE+++PV E  S GLL  + Q F + FI++
Sbjct:   11 QTELYKRRWIMLFVFCLLSLTNSGQWIMFAAISDVIVPFYHVSAFGVNCLSMVFMAVYILFIVPASWILDRYGLKVNAFIAAGFNVLGAWLKYCGS---AENGFNWVVA--GQTVTAVAQCFILGVPPRIAAVWFGQNERSVATALGVFASQVGVAIYFATVPLIVPRSPDSSRVSKGLEMLYGGVAILCSLIGAAM--LIAFEDAPPVPPSKSQAVLKDKGRCCRITYKESFTRLFSNASYVFLLVAYGIYAGAQYTVATLLNEMATKRFPNQEVLIGLLGFVFVIAGLPATVLAGIWLDRTLAYKQGTIFLMGTSFLSMIAFSITLEFAQSVYGLFLVLAVLGFCSTSFLPLGFEFAAELTYPVPEGTSAGLLNAAAQCFGIFFIVV 392          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Nematostella
Match: EDO47735 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLQ9])

HSP 1 Score: 62.003 bits (149), Expect = 2.527e-10
Identity = 41/146 (28.08%), Postives = 70/146 (47.95%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAM 628
            +YK+RW+ILF  S +   N I+W S+  +       F      I  L+   P+  +V  +P+ W +D+ GLR + V   +     + LR       +D + +  +   GQ V  L  P+AM +   +++ WFP  QR  AT + ++
Sbjct:    2 VYKRRWYILFIFSIVATLNNIIWNSWGPIQGTSKVVFGWDDTIITLLADWGPISYVVAVVPMSWLMDEKGLRTSVVLAAFFEFIGSGLRCIP----LDASSQSLLIHIGQFVTGLGGPVAMAAAPLVSAAWFPPSQRTTATAISSL 143          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Nematostella
Match: EDO40262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7M7])

HSP 1 Score: 61.6178 bits (148), Expect = 3.036e-10
Identity = 42/148 (28.38%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFG--QVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAM 628
            ++++R++ILF  S ++F     W ++  ++      F  S  +I  L+ + P+  +V  L   W +D  GLR + +      +S+A +   +  + V  +  Y I   G  Q++  LA P+   +P  L++ WFPSHQR  AT V A+
Sbjct:    2 VFRRRFYILFLFSIISFAQYCAWNTYGPIATTAKTVFDWSNTEIAVLASMDPITYLVTMLFFSWMMDVKGLRKSML------VSTAFMFVGTGLRCVTPDSTYAIWTMGGGQLLNGLAGPVTQAAPPLLSAAWFPSHQRTTATAVAAL 143          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Nematostella
Match: EDO48766 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI77])

HSP 1 Score: 60.8474 bits (146), Expect = 6.030e-10
Identity = 45/181 (24.86%), Postives = 89/181 (49.17%), Query Frame = 2
Query:   95 SPANKSICKYSLAAIMHSSNNSLTEVMPNHSI--LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLV---DVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVG 622
            S ++    KY    ++++S +S+T V  +  +  +YK+RW+ILF  S+       +W  +  + ++    F     D+  +S+  P   ++  +P  W + + GLR T +      L+S  +      ++V   D + R  +   GQ++   +  + +  PA L+++WFP H+RA ATT+ 
Sbjct:   12 SESDSEETKY----LINTSTSSITPVSADKLLCKVYKRRWYILFIYSFQVTLQNAVWNFWGPIQESCKIVFGWEKFDVLLISVWGPASAVIALVPGTWVLARKGLRPTIL------LTSFFICIGKALQIVPFTDQDVRTAVVNIGQMIAMTSSFMTVCVPAVLSAVWFPPHERATATTLA 182          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Medaka
Match: SLC49A3 (solute carrier family 49 member 3 [Source:NCBI gene;Acc:101171677])

HSP 1 Score: 206.838 bits (525), Expect = 4.270e-60
Identity = 164/443 (37.02%), Postives = 247/443 (55.76%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYS------------PFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVF-MSSVAVVGSTMMLLGFSAKYLRQTTE 1480
            +YK+RW +L  L  LN +N  +W++FA V+D  A++  VSLD IN+LSLV+ V+ I L     W +D  GLRIT +   WLN+  A+LR       V  + R+ + M GQ + +LAQPL +F+P K+A+LWFP HQRA A  + +M NPLGILL +++ P   + S            P CI C           L T  I  S+PP PP+  ++       PF + ++  + +  ++VL L FG G+ +FT  STLLEQ+LC  GY++ FAG CGAL I  G++G+   G+  DKTK F E  +  +  T    +AFS+++        +AA  +  G FG ++Y VA+EL+ E S+PV E  S GL+ VSGQ+ SV++I++ Q L    ++  +P  +      A   WR  +  M+ +    S + ++ F ++Y R   E
Sbjct:   33 VYKRRWLVLLVLCLLNCSNATIWLTFAPVADQSAQYLKVSLDAINWLSLVYMVVAIPLSFGTTWMLDTLGLRITLILGSWLNMLGAMLRLVGQPHAVSDDMRFLVVMLGQTLCALAQPLIIFTPTKVAALWFPDHQRATANMIASMSNPLGILLANVISPLIAKSSAEIPVLMLAYGAPTCIIC----------FLATLGIRTSQPPTPPSASAESSG--SEPFVQGLKLLLKNKAYLVLLLCFGSGIAVFTCFSTLLEQVLCVQGYTNDFAGLCGALFIVFGIVGAGALGLYVDKTKKFIEATKINMGLTALACVAFSVVSLMPRQKFAVAAVCSLFGLFGFSIYPVAMELSVECSYPVGEATSAGLVFVSGQVQSVLYIIVLQALTT--RLADSPQSTC---GDAAFSWRVPLMVMAGLCSFFSCIFIVFFHSRYRRLEAE 458          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Medaka
Match: ENSORLT00000011405.2 (feline leukemia virus subgroup C receptor-related protein 2 [Source:NCBI gene;Acc:101168758])

HSP 1 Score: 102.834 bits (255), Expect = 4.350e-23
Identity = 113/386 (29.27%), Postives = 202/386 (52.33%), Query Frame = 2
Query:  176 PNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFC--ISCGILVISFISALLPTFL------IYRSRPPVPPT----TFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQ-ILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVF 1294
            P  + LY++RWFI+   S  +  N   WI +  +++   +F+ V    I+++S+++ +  I L  PV W +DK GLR+  +A   LN +   ++ +S    +     +P+   GQ   SLAQ   +  PA+ AS+WF S + + A ++G  GN LG  +G LLPP  +        ++  I V+ +I+A + TFL      +++ RPP+PPT    T    P + ++     +R  + + PF++L LT+G+ +G +  + TLL + I+  +   +  AG  G  +I SG++GS I G+  D+TK + +      + +  G+I ++        +V +  +  ++G F      +  E A E+++P SE  S+GLL  S Q+F ++F
Sbjct:   33 PLPTRLYRRRWFIVLLFSSYSLCNSYQWIQYGIINNIFMKFYGVETFTIDWMSMIYMLTYIPLIFPVTWLLDKKGLRVIALAATALNCAGTWIKVASVRPDL-----FPVTFLGQFCCSLAQVFILGMPARTASVWFGSDEVSTACSIGVFGNQLGCAIGFLLPPILVPNVDDLDELAHHIRVMFYITAGVATFLFILVVFVFQERPPLPPTLAQATARCIPAEEYSYVASILRL-LRNRPFVLLILTYGLNVGCYYAVGTLLNRMIISHYPNEEVNAGRIGLTIIVSGMVGSLICGLWLDRTKTYKQTTLAVYLMSLVGMIVYTATLDQGHLWV-VFITAGSLGFFMTGYLPLGFEFAVELTYPESEGTSSGLLNCSAQVFGIIF 411          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Medaka
Match: ENSORLT00000011401.2 (feline leukemia virus subgroup C receptor-related protein 2 [Source:NCBI gene;Acc:101168758])

HSP 1 Score: 102.834 bits (255), Expect = 6.612e-23
Identity = 113/386 (29.27%), Postives = 202/386 (52.33%), Query Frame = 2
Query:  176 PNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFC--ISCGILVISFISALLPTFL------IYRSRPPVPPT----TFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQ-ILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVF 1294
            P  + LY++RWFI+   S  +  N   WI +  +++   +F+ V    I+++S+++ +  I L  PV W +DK GLR+  +A   LN +   ++ +S    +     +P+   GQ   SLAQ   +  PA+ AS+WF S + + A ++G  GN LG  +G LLPP  +        ++  I V+ +I+A + TFL      +++ RPP+PPT    T    P + ++     +R  + + PF++L LT+G+ +G +  + TLL + I+  +   +  AG  G  +I SG++GS I G+  D+TK + +      + +  G+I ++        +V +  +  ++G F      +  E A E+++P SE  S+GLL  S Q+F ++F
Sbjct:   33 PLPTRLYRRRWFIVLLFSSYSLCNSYQWIQYGIINNIFMKFYGVETFTIDWMSMIYMLTYIPLIFPVTWLLDKKGLRVIALAATALNCAGTWIKVASVRPDL-----FPVTFLGQFCCSLAQVFILGMPARTASVWFGSDEVSTACSIGVFGNQLGCAIGFLLPPILVPNVDDLDELAHHIRVMFYITAGVATFLFILVVFVFQERPPLPPTLAQATARCIPAEEYSYVASILRL-LRNRPFVLLILTYGLNVGCYYAVGTLLNRMIISHYPNEEVNAGRIGLTIIVSGMVGSLICGLWLDRTKTYKQTTLAVYLMSLVGMIVYTATLDQGHLWV-VFITAGSLGFFMTGYLPLGFEFAVELTYPESEGTSSGLLNCSAQVFGIIF 411          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Medaka
Match: ENSORLT00000036178.1 (feline leukemia virus subgroup C receptor-related protein 2 [Source:NCBI gene;Acc:101168758])

HSP 1 Score: 102.449 bits (254), Expect = 7.654e-23
Identity = 113/388 (29.12%), Postives = 203/388 (52.32%), Query Frame = 2
Query:  176 PNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFC--ISCGILVISFISALLPTFL------IYRSRPPVPPT----TFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQ-ILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIM 1300
            P  + LY++RWFI+   S  +  N   WI +  +++   +F+ V    I+++S+++ +  I L  PV W +DK GLR+  +A   LN +   ++ +S    +     +P+   GQ   SLAQ   +  PA+ AS+WF S + + A ++G  GN LG  +G LLPP  +        ++  I V+ +I+A + TFL      +++ RPP+PPT    T    P + ++     +R  + + PF++L LT+G+ +G +  + TLL + I+  +   +  AG  G  +I SG++GS I G+  D+TK + +      + +  G+I ++        +V +  +  ++G F      +  E A E+++P SE  S+GLL  S Q+F ++F +
Sbjct:   33 PLPTRLYRRRWFIVLLFSSYSLCNSYQWIQYGIINNIFMKFYGVETFTIDWMSMIYMLTYIPLIFPVTWLLDKKGLRVIALAATALNCAGTWIKVASVRPDL-----FPVTFLGQFCCSLAQVFILGMPARTASVWFGSDEVSTACSIGVFGNQLGCAIGFLLPPILVPNVDDLDELAHHIRVMFYITAGVATFLFILVVFVFQERPPLPPTLAQATARCIPAEEYSYVASILRL-LRNRPFVLLILTYGLNVGCYYAVGTLLNRMIISHYPNEEVNAGRIGLTIIVSGMVGSLICGLWLDRTKTYKQTTLAVYLMSLVGMIVYTATLDQGHLWV-VFITAGSLGFFMTGYLPLGFEFAVELTYPESEGTSSGLLNCSAQVFGIIFTI 413          
BLAST of Solute carrier family 49 member 3 vs. Ensembl Medaka
Match: flvcr2a (feline leukemia virus subgroup C cellular receptor family member 2 [Source:NCBI gene;Acc:101165432])

HSP 1 Score: 87.8113 bits (216), Expect = 3.719e-18
Identity = 96/380 (25.26%), Postives = 182/380 (47.89%), Query Frame = 2
Query:  191 LYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIE--YSPFCISCGILVISFISALLPTF------LIYRSRPPVPP--TTFSDRPI--DGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVF 1294
            L  +RW ILF  ++ + +N   WI +  +++   +F+ V    +++LS+V+ ++ I    PV W +D  GLR+T +    LN +   ++ +S    +     + + M GQ+  S+AQ   +  PA++A +WF + + + A ++G  GN +GI +G LLPP  +        ++  I V+ +ISA + TF      +++  RP  PP  +    R I  D ++      R  ++    +++          +   + L   I+  +   +  AG  G  ++ +G+ GS I G+  DKTK +        + +  G++ ++        +V +  +   +G F      +  E A E+++P SE  S+GLL  S QIF ++F
Sbjct:   40 LESRRWLILFLFTFYSLSNAYQWIQYGIINNIFMKFYGVDGFSVDWLSMVYMLVYIPFIFPVTWLLDVKGLRVTALVANALNCAGTWIKVASARSDM-----FWVTMLGQLFSSVAQVFILGLPARIAGVWFGADEVSTACSIGVFGNQMGIAIGFLLPPILVPNVNDMNELTHNIRVMFYISAGVATFIFILVAIVFEERPENPPSLSQAQARSICADKYSYTASICRLLVNKPFMLLVISYGLNVGCFYAVSTLLNRMIIEHYPGEEVNAGRIGLTIVTAGMGGSLICGIWLDKTKTYKLTTLVVYILSLVGMLVYAFTLNLGHLWV-VFVTAGVLGFFMTGYLPLGFEFAVELTYPESEGTSSGLLNCSAQIFGIIF 413          
BLAST of Solute carrier family 49 member 3 vs. Planmine SMEST
Match: SMESG000032659.1 (SMESG000032659.1)

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 467/467 (100.00%), Postives = 467/467 (100.00%), Query Frame = 2
Query:  140 MHSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNEAIEQSISR 1540
            MHSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMGNPLGILLGSLLPPYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVLSLTFGMGLGLFTGLSTLLEQILCPFGYSDKFAGFCGALLIGSGLIGSFISGVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNEAIEQSISR
Sbjct:    1 MHSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMGNPLGILLGSLLPPYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVLSLTFGMGLGLFTGLSTLLEQILCPFGYSDKFAGFCGALLIGSGLIGSFISGVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNEAIEQSISR 467          
BLAST of Solute carrier family 49 member 3 vs. Planmine SMEST
Match: SMESG000032659.1 (SMESG000032659.1)

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 456/456 (100.00%), Postives = 456/456 (100.00%), Query Frame = 2
Query:  173 MPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNEAIEQSISR 1540
            MPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMGNPLGILLGSLLPPYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVLSLTFGMGLGLFTGLSTLLEQILCPFGYSDKFAGFCGALLIGSGLIGSFISGVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNEAIEQSISR
Sbjct:    1 MPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMGNPLGILLGSLLPPYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVLSLTFGMGLGLFTGLSTLLEQILCPFGYSDKFAGFCGALLIGSGLIGSFISGVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNEAIEQSISR 456          
BLAST of Solute carrier family 49 member 3 vs. Planmine SMEST
Match: SMESG000032659.1 (SMESG000032659.1)

HSP 1 Score: 791.571 bits (2043), Expect = 0.000e+0
Identity = 451/467 (96.57%), Postives = 451/467 (96.57%), Query Frame = 2
Query:  140 MHSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNEAIEQSISR 1540
            MHSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMGNPLGILLGSLLPPYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVLSLTFGMGLGLFTGLSTLLEQILCPFGYSDKFAGFCGALLIGSGLIGSFISGVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLL                VLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNEAIEQSISR
Sbjct:    1 MHSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMGNPLGILLGSLLPPYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVLSLTFGMGLGLFTGLSTLLEQILCPFGYSDKFAGFCGALLIGSGLIGSFISGVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLL----------------VLWAPPQIMVNPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITFINTHEHFNEAIEQSISR 451          
BLAST of Solute carrier family 49 member 3 vs. Planmine SMEST
Match: SMESG000032659.1 (SMESG000032659.1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 319/319 (100.00%), Postives = 319/319 (100.00%), Query Frame = 2
Query:  140 MHSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFG 1096
            MHSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMGNPLGILLGSLLPPYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVLSLTFGMGLGLFTGLSTLLEQILCPFGYSDKFAGFCGALLIGSGLIGSFISGVVADKTKAFTEIVQFCIVCTTFG
Sbjct:    1 MHSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMGNPLGILLGSLLPPYFIEYSPFCISCGILVISFISALLPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVLSLTFGMGLGLFTGLSTLLEQILCPFGYSDKFAGFCGALLIGSGLIGSFISGVVADKTKAFTEIVQFCIVCTTFG 319          

HSP 2 Score: 78.5666 bits (192), Expect = 1.386e-15
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 3
Query: 1152 HPSPLLEHLVSHYIQSRWNWLPKYHFLSAKISAQAY 1259
            HPSPLLEHLVSHYIQSRWNWLPKYHFLSAKISAQAY
Sbjct:  320 HPSPLLEHLVSHYIQSRWNWLPKYHFLSAKISAQAY 355          
BLAST of Solute carrier family 49 member 3 vs. Planmine SMEST
Match: SMESG000009493.1 (SMESG000009493.1)

HSP 1 Score: 234.572 bits (597), Expect = 2.784e-71
Identity = 160/445 (35.96%), Postives = 259/445 (58.20%), Query Frame = 2
Query:  206 WFILFALSWLNFTNGILWISFASVSDNMARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNLSSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFPSHQRALATTVGAMXXXXXXXXXXXXXXYFIEYSPFCISCGILVISFISALLPT-----------FLIYRSRPPV--------PPTTFSDRPIDGHNPFWEQMRFCISSLPFIVXXXXXXXXXXXXXXXXXXXEQILCPFGYSDKFAGFCXXXXXXXXXXXXXXXXVVADKTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIALYSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMVN-PNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTE 1480
            W +  +LS +N +NG +WI++A++SD  ++F++ SL DIN++SL+F VI  V G+P+IW ID+FG+++T V    LN   A++R  S+  +V +NYRY + + G V G+++QPL +FS  KLAS WF S +RA A T+ +MG                  +P     G+L  S +SAL+ T           +LI  S   V         P   +   +DG + F++Q++ C+++  F++L++ FG+ + +FT  STL++QILCPFGYSD F+G CG+L +G G  G  +   +  KT A    V+  I+ T  G+I FSI +     +  +A SV  +G FG  +Y   LELAAE +FP  E ++TGLL+   Q+ S+V I ++QV+  P + + +   CSV   +  K+YW  N  ++ + V+ +++++L F+ +Y R+  E
Sbjct:   10 WMLATSLSLVNMSNGWIWITYATISDFASQFYSTSLADINWISLLFGVIISVAGIPLIWFIDRFGIKLTLVIAAVLNFLCAVVRSISSLSIVPINYRYAVLVLGSVFGAISQPLGLFSSTKLASTWFSSRKRANANTLASMG------------------NPL----GVLTASLLSALIVTKKEDVTQLNNFYLILPSMTLVIVIISVYLAPNKHNISLLDGLS-FYQQLKLCVTNYRFVILNMAFGISIAVFTTYSTLIQQILCPFGYSDTFSGLCGSLFLGVGFPGVILCSYLVHKTGALVGTVKMFIMFTAIGMIGFSITSSLAGEHALVAISVCWMGFFGFGVYPFCLELAAETAFPAGEVVTTGLLLFISQVISMVMIPVAQVIAIPSKHLSSIAACSV---NDIKDYWMANSIIAVIGVINASILMLIFNTEYKRKMKE 428          
The following BLAST results are available for this feature:
BLAST of Solute carrier family 49 member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC49A32.388e-5035.58solute carrier family 49 member 3 [Source:HGNC Sym... [more]
SLC49A32.638e-4935.71solute carrier family 49 member 3 [Source:HGNC Sym... [more]
SLC49A31.640e-3834.34solute carrier family 49 member 3 [Source:HGNC Sym... [more]
SLC49A32.174e-2034.51solute carrier family 49 member 3 [Source:HGNC Sym... [more]
FLVCR25.102e-1927.25feline leukemia virus subgroup C cellular receptor... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0416.51.181e-5637.60pep chromosome:WBcel235:X:9268626:9270853:-1 gene:... [more]
C05G5.11.228e-4833.03pep chromosome:WBcel235:X:14734443:14740088:-1 gen... [more]
B0416.51.047e-4233.94pep chromosome:WBcel235:X:9268634:9270855:-1 gene:... [more]
C42C1.85.729e-2831.02pep chromosome:WBcel235:IV:12291046:12293287:1 gen... [more]
C42C1.85.729e-2831.02pep chromosome:WBcel235:IV:12291046:12293317:1 gen... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG13582.684e-1729.18gene:FBgn0033196 transcript:FBtr0303287[more]
CG13582.684e-1729.18gene:FBgn0033196 transcript:FBtr0088948[more]
CG13582.684e-1729.18gene:FBgn0033196 transcript:FBtr0088950[more]
CG13582.684e-1729.18gene:FBgn0033196 transcript:FBtr0088949[more]
back to top
BLAST of Solute carrier family 49 member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR855367.13.351e-1925.53feline leukemia virus subgroup C cellular receptor... [more]
flvcr2b4.942e-1925.53feline leukemia virus subgroup C cellular receptor... [more]
flvcr2b6.122e-1925.53feline leukemia virus subgroup C cellular receptor... [more]
flvcr19.088e-1425.90feline leukemia virus subgroup C cellular receptor... [more]
slc49a45.241e-1331.61solute carrier family 49 member 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdm151.284e-6337.72PR domain 15 [Source:Xenbase;Acc:XB-GENE-1013930][more]
prdm156.700e-6137.56PR domain 15 [Source:Xenbase;Acc:XB-GENE-1013930][more]
prdm159.759e-6137.56PR domain 15 [Source:Xenbase;Acc:XB-GENE-1013930][more]
ndufs51.158e-2126.93NADH:ubiquinone oxidoreductase subunit S5 [Source:... [more]
ndufs51.222e-2126.93NADH:ubiquinone oxidoreductase subunit S5 [Source:... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfsd7a1.541e-5236.67major facilitator superfamily domain containing 7A... [more]
Flvcr21.091e-2128.84feline leukemia virus subgroup C cellular receptor... [more]
Flvcr11.859e-1230.66feline leukemia virus subgroup C cellular receptor... [more]
Flvcr14.158e-1230.66feline leukemia virus subgroup C cellular receptor... [more]
Flvcr18.255e-1229.66feline leukemia virus subgroup C cellular receptor... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28FF3|S49A3_XENTR6.800e-6337.72Solute carrier family 49 member A3 OS=Xenopus trop... [more]
sp|Q11073|YT45_CAEEL1.502e-5537.60Uncharacterized protein B0416.5 OS=Caenorhabditis ... [more]
sp|Q503P5|S49A3_DANRE1.546e-5234.23Solute carrier family 49 member A3 OS=Danio rerio ... [more]
sp|Q8CE47|S49A3_MOUSE1.078e-5136.67Solute carrier family 49 member A3 OS=Mus musculus... [more]
sp|Q6UXD7|S49A3_HUMAN1.267e-4835.71Solute carrier family 49 member A3 OS=Homo sapiens... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W5JP924.814e-7040.23MFS domain-containing protein OS=Hucho hucho OX=62... [more]
A0A060W5G44.903e-7038.37Uncharacterized protein OS=Oncorhynchus mykiss OX=... [more]
W5UES35.407e-7037.34Major facilitator superfamily domain-containing pr... [more]
A0A1S3ST566.251e-7040.23major facilitator superfamily domain-containing pr... [more]
A0A2D0SDQ31.181e-6937.34major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC49A33.090e-6337.66solute carrier family 49 member 3 [Source:HGNC Sym... [more]
SLC49A39.443e-6337.66solute carrier family 49 member 3 [Source:HGNC Sym... [more]
SLC49A37.370e-6039.50solute carrier family 49 member 3 [Source:HGNC Sym... [more]
flvcr2b2.384e-2329.05feline leukemia virus subgroup C receptor-related ... [more]
flvcr2b1.358e-2128.42feline leukemia virus subgroup C receptor-related ... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC49A32.515e-6733.91solute carrier family 49 member 3 [Source:HGNC Sym... [more]
ENSPMAT00000010440.11.527e-1628.33pep scaffold:Pmarinus_7.0:GL482629:3025:14749:1 ge... [more]
ENSPMAT00000010776.17.032e-1632.17pep scaffold:Pmarinus_7.0:GL480222:20049:28221:1 g... [more]
ENSPMAT00000000483.11.329e-1227.80pep scaffold:Pmarinus_7.0:GL476512:313253:328214:1... [more]
slc49a41.404e-928.97solute carrier family 49 member 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Solute carrier family 49 member 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476438.250e-4535.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493373.607e-2526.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477352.527e-1028.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402623.036e-1028.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487666.030e-1024.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC49A34.270e-6037.02solute carrier family 49 member 3 [Source:NCBI gen... [more]
ENSORLT00000011405.24.350e-2329.27feline leukemia virus subgroup C receptor-related ... [more]
ENSORLT00000011401.26.612e-2329.27feline leukemia virus subgroup C receptor-related ... [more]
ENSORLT00000036178.17.654e-2329.12feline leukemia virus subgroup C receptor-related ... [more]
flvcr2a3.719e-1825.26feline leukemia virus subgroup C cellular receptor... [more]
back to top
BLAST of Solute carrier family 49 member 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032659.10.000e+0100.00SMESG000032659.1[more]
SMESG000032659.10.000e+0100.00SMESG000032659.1[more]
SMESG000032659.10.000e+096.57SMESG000032659.1[more]
SMESG000032659.11.386e-15100.00SMESG000032659.1[more]
SMESG000009493.12.784e-7135.96SMESG000009493.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027213 ID=SMED30027213|Name=Solute carrier family 49 member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1603bp
CTTTGACATTAGTAATTTTGAAATAAAATTCCAATTTATTGATCTGTATT
TATCAATTGAATTGTGATAATATTGCGGAATTATTGAATAAATTTCTCCT
GCTAACAAATCTATCTGCAAATATTCTCTTGCTGCTATAATGCATTCCTC
AAACAATTCTCTCACGGAGGTCATGCCTAATCATTCGATATTATACAAGC
AGCGCTGGTTCATTCTATTTGCGCTTTCCTGGCTCAACTTCACCAATGGC
ATCCTGTGGATCAGTTTCGCCAGTGTTTCTGATAATATGGCGCGCTTCTT
TGCAGTCTCTCTCGATGACATCAACTATCTAAGCTTGGTGTTTCCAGTGA
TTACGATCGTGCTCGGTCTACCGGTTATTTGGGGCATCGACAAATTCGGA
TTGCGTATTACCTGTGTGGCTTGCGGCTGGCTAAACCTGAGTTCTGCGCT
ATTGCGATTTTCAAGCACCTATAAATTAGTCGACGTCAATTATCGGTATC
CAATCGCAATGTTTGGTCAAGTTGTTGGCAGTCTTGCACAGCCATTGGCA
ATGTTCAGTCCAGCCAAACTTGCGTCTTTATGGTTCCCATCCCATCAACG
GGCCTTGGCAACAACGGTCGGTGCGATGGGCAATCCGCTGGGCATTCTAT
TAGGCAGCTTATTACCGCCATACTTCATCGAATATTCCCCTTTCTGTATA
AGTTGTGGCATTCTTGTTATTTCTTTCATCAGTGCACTTTTGCCCACTTT
CCTCATTTATCGATCTCGCCCGCCTGTTCCGCCAACCACTTTCTCTGACC
GCCCAATAGATGGCCACAACCCGTTCTGGGAGCAGATGCGATTCTGCATC
TCTAGCTTGCCTTTCATTGTCCTTTCACTGACCTTCGGAATGGGCCTGGG
ATTATTTACCGGCCTGTCAACGCTACTGGAGCAGATTCTTTGTCCGTTTG
GATATTCTGATAAATTTGCCGGTTTCTGTGGAGCACTTCTCATCGGGTCT
GGATTAATTGGCTCATTCATTTCTGGCGTGGTTGCTGATAAAACAAAGGC
GTTCACAGAAATTGTTCAGTTTTGCATTGTCTGCACAACATTTGGAGTAA
TCGCGTTTTCTATTTTGACCCAGTATGTAGATTTCTATGTTCCCATTGCA
GCATCCGTCGCCGCTATTGGAGCATTTGGTATCGCACTATATTCAGTCGC
GTTGGAATTGGCTGCCGAAATATCATTTCCTGTCAGCGAAAATATCAGCA
CAGGCCTACTAGTTGTTTCCGGTCAGATTTTTAGTGTCGTCTTCATAATG
CTATCACAGGTGTTATGGGCTCCTCCTCAAATCATGGTGAATCCAAACTG
TTCAGTCATTAGTGGATCCTCGGCGAAAAATTATTGGAGGTTTAATGTCT
TCATGAGTTCTGTCGCTGTTGTTGGGTCTACAATGATGTTGTTAGGATTT
TCTGCAAAATATCTTCGACAGACCACCGAGATAACTTTTATCAATACTCA
TGAGCATTTCAATGAGGCTATCGAACAATCTATATCAAGATAAAAAATTT
TATTCAAAAAAATTATAATTTATGAATTTTTTGGTGAAAATATTATTCGT
GCT
back to top

protein sequence of SMED30027213-orf-1

>SMED30027213-orf-1 ID=SMED30027213-orf-1|Name=SMED30027213-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=468bp
MHSSNNSLTEVMPNHSILYKQRWFILFALSWLNFTNGILWISFASVSDNM
ARFFAVSLDDINYLSLVFPVITIVLGLPVIWGIDKFGLRITCVACGWLNL
SSALLRFSSTYKLVDVNYRYPIAMFGQVVGSLAQPLAMFSPAKLASLWFP
SHQRALATTVGAMGNPLGILLGSLLPPYFIEYSPFCISCGILVISFISAL
LPTFLIYRSRPPVPPTTFSDRPIDGHNPFWEQMRFCISSLPFIVLSLTFG
MGLGLFTGLSTLLEQILCPFGYSDKFAGFCGALLIGSGLIGSFISGVVAD
KTKAFTEIVQFCIVCTTFGVIAFSILTQYVDFYVPIAASVAAIGAFGIAL
YSVALELAAEISFPVSENISTGLLVVSGQIFSVVFIMLSQVLWAPPQIMV
NPNCSVISGSSAKNYWRFNVFMSSVAVVGSTMMLLGFSAKYLRQTTEITF
INTHEHFNEAIEQSISR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 26..358
e-value: 6.3E-16
score: 58.2
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 233..445
e-value: 3.0E-5
score: 25.4
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 16..213
e-value: 1.0E-12
score: 49.8
NoneNo IPR availablePANTHERPTHR10924MAJOR FACILITATOR SUPERFAMILY PROTEIN-RELATEDcoord: 18..447
NoneNo IPR availablePANTHERPTHR10924:SF6SOLUTE CARRIER FAMILY 49 MEMBER A3coord: 18..447
NoneNo IPR availableCDDcd17399MFS_MFSD7coord: 21..437
e-value: 2.44403E-124
score: 366.593
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 415..437
NoneNo IPR availableTMHMMTMhelixcoord: 308..326
NoneNo IPR availableTMHMMTMhelixcoord: 158..180
NoneNo IPR availableTMHMMTMhelixcoord: 24..46
NoneNo IPR availableTMHMMTMhelixcoord: 333..355
NoneNo IPR availableTMHMMTMhelixcoord: 116..138
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
NoneNo IPR availableTMHMMTMhelixcoord: 375..394
NoneNo IPR availableTMHMMTMhelixcoord: 185..207
NoneNo IPR availableTMHMMTMhelixcoord: 276..298
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 17..436