SMED30027210

Overview
NameSMED30027210
Smed IDSMED30027210
Length (bp)1678
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027210 (SMED30027210) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027210 (SMED30027210) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027210 (SMED30027210) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027210 (SMED30027210) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027210

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30027210SMESG000042947.1 SMESG000027707.1 SmedASXL_019539SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027210 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.006751:29903..31679 +8306
Homology
BLAST of SMED30027210 vs. Ensembl Human
Match: ZNF79 (zinc finger protein 79 [Source:HGNC Symbol;Acc:HGNC:13153])

HSP 1 Score: 112.464 bits (280), Expect = 1.601e-26
Identity = 62/138 (44.93%), Postives = 82/138 (59.42%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C+ C  +FS      +H+R H   +PYRC  C  +F+ S +L  HQ THT EKPY+CS C  AF  S +L  HQ+ HT  KP++CNEC   F +S  L RHH+ +H   KPY CN C   F  S  L +HQ++H
Sbjct:  197 KPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHI-IHTGEKPYECNECGKAFNQSSSLSQHQRIH 333          

HSP 2 Score: 103.99 bits (258), Expect = 1.666e-23
Identity = 60/144 (41.67%), Postives = 84/144 (58.33%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHL 1108
            I    KP+ C  C  +FS+  +L  H+R+H   +PY+C+ C  +F+ S +L  HQ THT EKPY+C+ C   F +S  L RH  IHT  KP++CNEC  +F  S  L +H  ++H  VKPY C+ C   F  S    RHQ++H 
Sbjct:  220 IHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQ-RIHTGVKPYECSECGKAFRCSSAFVRHQRLHA 362          

HSP 3 Score: 102.449 bits (254), Expect = 5.346e-23
Identity = 61/162 (37.65%), Postives = 96/162 (59.26%), Query Frame = 2
Query:  632 KLSSLCNSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  S C+S ++ +K+ +   KP+ C+ C  +FS+   L +H+R H   +PY+C+ C  +F+ + +L +HQ THT EKPY+CS C  AF D   L +HQ+IHT  KP++C++C  +F  S +L  H  + H   KPY C+ C   F       +HQ++H  +K
Sbjct:   66 KAFSYCSSLSQHQKSHTG-EKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQ-RTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEK 225          

HSP 4 Score: 96.2857 bits (238), Expect = 5.265e-21
Identity = 47/115 (40.87%), Postives = 68/115 (59.13%), Query Frame = 2
Query:  773 TRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             +PY C  C  +F+    L +HQ +HT EKPY+CS C  AF  S  L +HQ+IHT  KP++C+EC  +F  + +L +H  + H   KPY C+ C   F D   L +HQ++H  +K
Sbjct:   56 AKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQ-RTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEK 169          

HSP 5 Score: 95.9005 bits (237), Expect = 7.225e-21
Identity = 57/152 (37.50%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            I    KP+ C+ C  +F    +L  H+R+H   +PY+C+ C  +F+      +HQ  HT EKPY+C+ C  AF  S +L  HQ+ HT  KP++C+EC  +F  S +L  H  + H   KPY CN C   F +S  L RH  +H  +K  + N
Sbjct:  164 IHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQ-KTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECN 314          

HSP 6 Score: 94.3597 bits (233), Expect = 2.486e-20
Identity = 57/142 (40.14%), Postives = 78/142 (54.93%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C+ C  +FS    L +H+R H   +PY C+ C  +F  S +L  HQ THT EKPY+CS C  AF       +HQ+IHT  KP++C  C  +F  S +L  H  + H   KPY C+ C   F  S +L  HQ+ H  +K
Sbjct:  141 KPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQ-RTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEK 281          

HSP 7 Score: 60.4622 bits (145), Expect = 3.531e-9
Identity = 37/91 (40.66%), Postives = 46/91 (50.55%), Query Frame = 2
Query:  665 IEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
            I +      KP+ CN C   FS    L RH   H   +PY C  C  +FN S  L +HQ  HT  KPY+CS C  AF+ S    RHQ++H 
Sbjct:  272 IHQKTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQRIHTGVKPYECSECGKAFRCSSAFVRHQRLHA 362          

HSP 8 Score: 55.0694 bits (131), Expect = 2.043e-7
Identity = 38/127 (29.92%), Postives = 57/127 (44.88%), Query Frame = 2
Query:  806 SFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLK-----------------------RHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            SFN    L   Q      +P +C   T +FK+S  LK                       +HQ+ HT  KP++C+EC  +F  S  L +H  ++H   KPY C+ C   F  + +L +HQ+ H  +K
Sbjct:   16 SFNLRPVLSPQQRVPVEARPRKCETHTESFKNSEILKPHRAKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQ-RIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEK 141          
BLAST of SMED30027210 vs. Ensembl Human
Match: ZNF79 (zinc finger protein 79 [Source:HGNC Symbol;Acc:HGNC:13153])

HSP 1 Score: 114.39 bits (285), Expect = 1.782e-26
Identity = 62/138 (44.93%), Postives = 82/138 (59.42%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C+ C  +FS      +H+R H   +PYRC  C  +F+ S +L  HQ THT EKPY+CS C  AF  S +L  HQ+ HT  KP++CNEC   F +S  L RHH+ +H   KPY CN C   F  S  L +HQ++H
Sbjct:  331 KPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHI-IHTGEKPYECNECGKAFNQSSSLSQHQRIH 467          

HSP 2 Score: 105.916 bits (263), Expect = 1.374e-23
Identity = 60/143 (41.96%), Postives = 84/143 (58.74%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C  C  +FS+  +L  H+R+H   +PY+C+ C  +F+ S +L  HQ THT EKPY+C+ C   F +S  L RH  IHT  KP++CNEC  +F  S  L +H  ++H  VKPY C+ C   F  S    RHQ++H
Sbjct:  354 IHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQ-RIHTGVKPYECSECGKAFRCSSAFVRHQRLH 495          

HSP 3 Score: 103.99 bits (258), Expect = 5.016e-23
Identity = 61/162 (37.65%), Postives = 96/162 (59.26%), Query Frame = 2
Query:  632 KLSSLCNSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  S C+S ++ +K+ +   KP+ C+ C  +FS+   L +H+R H   +PY+C+ C  +F+ + +L +HQ THT EKPY+CS C  AF D   L +HQ+IHT  KP++C++C  +F  S +L  H  + H   KPY C+ C   F       +HQ++H  +K
Sbjct:  200 KAFSYCSSLSQHQKSHTG-EKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQ-RTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEK 359          

HSP 4 Score: 98.5969 bits (244), Expect = 3.493e-21
Identity = 47/115 (40.87%), Postives = 68/115 (59.13%), Query Frame = 2
Query:  773 TRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             +PY C  C  +F+    L +HQ +HT EKPY+CS C  AF  S  L +HQ+IHT  KP++C+EC  +F  + +L +H  + H   KPY C+ C   F D   L +HQ++H  +K
Sbjct:  190 AKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQ-RTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEK 303          

HSP 5 Score: 97.8265 bits (242), Expect = 5.636e-21
Identity = 57/152 (37.50%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            I    KP+ C+ C  +F    +L  H+R+H   +PY+C+ C  +F+      +HQ  HT EKPY+C+ C  AF  S +L  HQ+ HT  KP++C+EC  +F  S +L  H  + H   KPY CN C   F +S  L RH  +H  +K  + N
Sbjct:  298 IHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQ-KTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECN 448          

HSP 6 Score: 96.2857 bits (238), Expect = 1.693e-20
Identity = 57/142 (40.14%), Postives = 78/142 (54.93%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C+ C  +FS    L +H+R H   +PY C+ C  +F  S +L  HQ THT EKPY+CS C  AF       +HQ+IHT  KP++C  C  +F  S +L  H  + H   KPY C+ C   F  S +L  HQ+ H  +K
Sbjct:  275 KPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQ-RTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEK 415          

HSP 7 Score: 60.8474 bits (146), Expect = 3.480e-9
Identity = 37/91 (40.66%), Postives = 46/91 (50.55%), Query Frame = 2
Query:  665 IEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
            I +      KP+ CN C   FS    L RH   H   +PY C  C  +FN S  L +HQ  HT  KPY+CS C  AF+ S    RHQ++H 
Sbjct:  406 IHQKTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQRIHTGVKPYECSECGKAFRCSSAFVRHQRLHA 496          

HSP 8 Score: 57.7658 bits (138), Expect = 3.451e-8
Identity = 38/127 (29.92%), Postives = 57/127 (44.88%), Query Frame = 2
Query:  806 SFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLK-----------------------RHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            SFN    L   Q      +P +C   T +FK+S  LK                       +HQ+ HT  KP++C+EC  +F  S  L +H  ++H   KPY C+ C   F  + +L +HQ+ H  +K
Sbjct:  150 SFNLRPVLSPQQRVPVEARPRKCETHTESFKNSEILKPHRAKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQ-RIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEK 275          
BLAST of SMED30027210 vs. Ensembl Human
Match: ZNF79 (zinc finger protein 79 [Source:HGNC Symbol;Acc:HGNC:13153])

HSP 1 Score: 114.005 bits (284), Expect = 2.473e-26
Identity = 62/138 (44.93%), Postives = 82/138 (59.42%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C+ C  +FS      +H+R H   +PYRC  C  +F+ S +L  HQ THT EKPY+CS C  AF  S +L  HQ+ HT  KP++CNEC   F +S  L RHH+ +H   KPY CN C   F  S  L +HQ++H
Sbjct:  307 KPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHI-IHTGEKPYECNECGKAFNQSSSLSQHQRIH 443          

HSP 2 Score: 105.145 bits (261), Expect = 1.929e-23
Identity = 60/143 (41.96%), Postives = 84/143 (58.74%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C  C  +FS+  +L  H+R+H   +PY+C+ C  +F+ S +L  HQ THT EKPY+C+ C   F +S  L RH  IHT  KP++CNEC  +F  S  L +H  ++H  VKPY C+ C   F  S    RHQ++H
Sbjct:  330 IHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQ-RIHTGVKPYECSECGKAFRCSSAFVRHQRLH 471          

HSP 3 Score: 103.605 bits (257), Expect = 6.582e-23
Identity = 61/162 (37.65%), Postives = 96/162 (59.26%), Query Frame = 2
Query:  632 KLSSLCNSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  S C+S ++ +K+ +   KP+ C+ C  +FS+   L +H+R H   +PY+C+ C  +F+ + +L +HQ THT EKPY+CS C  AF D   L +HQ+IHT  KP++C++C  +F  S +L  H  + H   KPY C+ C   F       +HQ++H  +K
Sbjct:  176 KAFSYCSSLSQHQKSHTG-EKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQ-RTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEK 335          

HSP 4 Score: 97.8265 bits (242), Expect = 5.301e-21
Identity = 47/115 (40.87%), Postives = 68/115 (59.13%), Query Frame = 2
Query:  773 TRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             +PY C  C  +F+    L +HQ +HT EKPY+CS C  AF  S  L +HQ+IHT  KP++C+EC  +F  + +L +H  + H   KPY C+ C   F D   L +HQ++H  +K
Sbjct:  166 AKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQ-RTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEK 279          

HSP 5 Score: 97.0561 bits (240), Expect = 7.971e-21
Identity = 57/152 (37.50%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            I    KP+ C+ C  +F    +L  H+R+H   +PY+C+ C  +F+      +HQ  HT EKPY+C+ C  AF  S +L  HQ+ HT  KP++C+EC  +F  S +L  H  + H   KPY CN C   F +S  L RH  +H  +K  + N
Sbjct:  274 IHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQ-KTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECN 424          

HSP 6 Score: 95.9005 bits (237), Expect = 2.362e-20
Identity = 57/142 (40.14%), Postives = 78/142 (54.93%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C+ C  +FS    L +H+R H   +PY C+ C  +F  S +L  HQ THT EKPY+CS C  AF       +HQ+IHT  KP++C  C  +F  S +L  H  + H   KPY C+ C   F  S +L  HQ+ H  +K
Sbjct:  251 KPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQ-RTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEK 391          

HSP 7 Score: 60.8474 bits (146), Expect = 3.693e-9
Identity = 37/91 (40.66%), Postives = 46/91 (50.55%), Query Frame = 2
Query:  665 IEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
            I +      KP+ CN C   FS    L RH   H   +PY C  C  +FN S  L +HQ  HT  KPY+CS C  AF+ S    RHQ++H 
Sbjct:  382 IHQKTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQRIHTGVKPYECSECGKAFRCSSAFVRHQRLHA 472          

HSP 8 Score: 56.9954 bits (136), Expect = 5.999e-8
Identity = 38/127 (29.92%), Postives = 57/127 (44.88%), Query Frame = 2
Query:  806 SFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLK-----------------------RHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            SFN    L   Q      +P +C   T +FK+S  LK                       +HQ+ HT  KP++C+EC  +F  S  L +H  ++H   KPY C+ C   F  + +L +HQ+ H  +K
Sbjct:  126 SFNLRPVLSPQQRVPVEARPRKCETHTESFKNSEILKPHRAKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQ-RIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEK 251          
BLAST of SMED30027210 vs. Ensembl Human
Match: ZNF79 (zinc finger protein 79 [Source:HGNC Symbol;Acc:HGNC:13153])

HSP 1 Score: 114.005 bits (284), Expect = 2.473e-26
Identity = 62/138 (44.93%), Postives = 82/138 (59.42%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C+ C  +FS      +H+R H   +PYRC  C  +F+ S +L  HQ THT EKPY+CS C  AF  S +L  HQ+ HT  KP++CNEC   F +S  L RHH+ +H   KPY CN C   F  S  L +HQ++H
Sbjct:  307 KPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHI-IHTGEKPYECNECGKAFNQSSSLSQHQRIH 443          

HSP 2 Score: 105.145 bits (261), Expect = 1.929e-23
Identity = 60/143 (41.96%), Postives = 84/143 (58.74%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C  C  +FS+  +L  H+R+H   +PY+C+ C  +F+ S +L  HQ THT EKPY+C+ C   F +S  L RH  IHT  KP++CNEC  +F  S  L +H  ++H  VKPY C+ C   F  S    RHQ++H
Sbjct:  330 IHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQ-RIHTGVKPYECSECGKAFRCSSAFVRHQRLH 471          

HSP 3 Score: 103.605 bits (257), Expect = 6.582e-23
Identity = 61/162 (37.65%), Postives = 96/162 (59.26%), Query Frame = 2
Query:  632 KLSSLCNSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  S C+S ++ +K+ +   KP+ C+ C  +FS+   L +H+R H   +PY+C+ C  +F+ + +L +HQ THT EKPY+CS C  AF D   L +HQ+IHT  KP++C++C  +F  S +L  H  + H   KPY C+ C   F       +HQ++H  +K
Sbjct:  176 KAFSYCSSLSQHQKSHTG-EKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQ-RTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEK 335          

HSP 4 Score: 97.8265 bits (242), Expect = 5.301e-21
Identity = 47/115 (40.87%), Postives = 68/115 (59.13%), Query Frame = 2
Query:  773 TRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             +PY C  C  +F+    L +HQ +HT EKPY+CS C  AF  S  L +HQ+IHT  KP++C+EC  +F  + +L +H  + H   KPY C+ C   F D   L +HQ++H  +K
Sbjct:  166 AKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQ-RTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEK 279          

HSP 5 Score: 97.0561 bits (240), Expect = 7.971e-21
Identity = 57/152 (37.50%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            I    KP+ C+ C  +F    +L  H+R+H   +PY+C+ C  +F+      +HQ  HT EKPY+C+ C  AF  S +L  HQ+ HT  KP++C+EC  +F  S +L  H  + H   KPY CN C   F +S  L RH  +H  +K  + N
Sbjct:  274 IHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQ-KTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECN 424          

HSP 6 Score: 95.9005 bits (237), Expect = 2.362e-20
Identity = 57/142 (40.14%), Postives = 78/142 (54.93%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C+ C  +FS    L +H+R H   +PY C+ C  +F  S +L  HQ THT EKPY+CS C  AF       +HQ+IHT  KP++C  C  +F  S +L  H  + H   KPY C+ C   F  S +L  HQ+ H  +K
Sbjct:  251 KPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQ-RTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEK 391          

HSP 7 Score: 60.8474 bits (146), Expect = 3.693e-9
Identity = 37/91 (40.66%), Postives = 46/91 (50.55%), Query Frame = 2
Query:  665 IEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
            I +      KP+ CN C   FS    L RH   H   +PY C  C  +FN S  L +HQ  HT  KPY+CS C  AF+ S    RHQ++H 
Sbjct:  382 IHQKTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQRIHTGVKPYECSECGKAFRCSSAFVRHQRLHA 472          

HSP 8 Score: 56.9954 bits (136), Expect = 5.999e-8
Identity = 38/127 (29.92%), Postives = 57/127 (44.88%), Query Frame = 2
Query:  806 SFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLK-----------------------RHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            SFN    L   Q      +P +C   T +FK+S  LK                       +HQ+ HT  KP++C+EC  +F  S  L +H  ++H   KPY C+ C   F  + +L +HQ+ H  +K
Sbjct:  126 SFNLRPVLSPQQRVPVEARPRKCETHTESFKNSEILKPHRAKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQ-RIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEK 251          
BLAST of SMED30027210 vs. Ensembl Human
Match: ZNF454 (zinc finger protein 454 [Source:HGNC Symbol;Acc:HGNC:21200])

HSP 1 Score: 114.005 bits (284), Expect = 3.523e-26
Identity = 61/147 (41.50%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CN C  +F  +  L  H+R H   +PY+C  C  +F D+    RH+  HT EKPY+C LC  AF+D   L +HQ+IHT  KP+ CN C+ +F D   L +H  ++H + KPY C  C   F  S HL +HQ++H  +K
Sbjct:  349 IHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRIHTGEKPYTCNICEKAFSDHSALTQHK-RIHTREKPYKCKICEKAFIRSTHLTQHQRIHTGEK 494          

HSP 2 Score: 112.079 bits (279), Expect = 1.252e-25
Identity = 61/156 (39.10%), Postives = 89/156 (57.05%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            NS+    + I    KP+ CN C  +F  +    RH + H   +PYRC LC  +F D   L +HQ  HT EKPY C++C  AF D   L +H++IHT+ KP++C  C+ +F  S HL +H  ++H   KPY CN C   F  + +L +HQ+ H+ +K
Sbjct:  368 NSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRIHTGEKPYTCNICEKAFSDHSALTQHKRIHTREKPYKCKICEKAFIRSTHLTQHQ-RIHTGEKPYKCNKCGKAFNQTANLIQHQRHHIGEK 522          

HSP 3 Score: 108.612 bits (270), Expect = 1.896e-24
Identity = 59/147 (40.14%), Postives = 83/147 (56.46%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CN+C  +F    HL +H+  H   +PY+C  C  +FN S    +HQ  HT EKP++C+ C  AF+ +  L  HQ+IHT  KP++CNEC  +F D+    RH  ++H   KPY C  C   F D   L +HQ++H  +K
Sbjct:  293 IHTGEKPFKCNICEKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHR-KIHTGEKPYRCGLCEKAFRDQSALAQHQRIHTGEK 438          

HSP 4 Score: 108.227 bits (269), Expect = 2.539e-24
Identity = 61/147 (41.50%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CNLC  +F R+ HL  H R H   +P++C +C  +F    HL +HQ  H+ EKPY+C+ C  AF  S    +HQ+IHT  KPF+CNEC  +F  +  L  H  ++H   KPY CN C   F D+    RH+++H  +K
Sbjct:  265 IHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEKPFKCNICEKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQ-RIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEK 410          

HSP 5 Score: 100.523 bits (249), Expect = 8.785e-22
Identity = 50/117 (42.74%), Postives = 65/117 (55.56%), Query Frame = 2
Query:  767 LNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +  + Y C  C  +F+ S HL  HQ  HT EKPY+C  C  AF  S  L  HQ+IHT  KPF+CN C  +F  + HL  HH ++H   KP+ CN C   F    HL +HQ +H  +K
Sbjct:  211 IKEKRYECRECGKAFHQSTHLIHHQRIHTGEKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECNLCGKAFIRNIHLAHHH-RIHTGEKPFKCNICEKAFVCRAHLTKHQNIHSGEK 326          

HSP 6 Score: 98.9821 bits (245), Expect = 2.832e-21
Identity = 54/147 (36.73%), Postives = 79/147 (53.74%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C  C  +FS    L  H++ H   +P+ C LC  +F  + HL  H   HT EKP++C++C  AF    HL +HQ IH+  KP++CNEC  +F  S    +H  ++H   KP+ CN C   F  +  L  HQ++H  +K
Sbjct:  237 IHTGEKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEKPFKCNICEKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQ-RIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEK 382          

HSP 7 Score: 79.337 bits (194), Expect = 5.375e-15
Identity = 44/122 (36.07%), Postives = 61/122 (50.00%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTN----------EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            + C+ C   F+ S  L +HQ  H            EK Y+C  C  AF  S HL  HQ+IHT  KP++C EC  +F  S  L  +H ++H   KP+ CN C   F  + HL  H ++H  +K
Sbjct:  178 FECSECGKVFSKSSTLNKHQKIHNEKNANQKIHIKEKRYECRECGKAFHQSTHLIHHQRIHTGEKPYECKECGKAFSVSSSLT-YHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEK 298          

HSP 8 Score: 65.855 bits (159), Expect = 1.002e-10
Identity = 42/131 (32.06%), Postives = 61/131 (46.56%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRH----------QQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            NT    C    S+ + S H  + Q    ++  ++CS C   F  S  L +H          Q+IH K K ++C EC  +F+ S HL  HH ++H   KPY C  C   F  S  L  HQ++H  +K  + N
Sbjct:  146 NTPSQECDESGSTMSSSLHSDQSQGFQPSKNAFECSECGKVFSKSSTLNKHQKIHNEKNANQKIHIKEKRYECRECGKAFHQSTHLI-HHQRIHTGEKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECN 275          

HSP 9 Score: 50.8322 bits (120), Expect = 5.369e-6
Identity = 32/106 (30.19%), Postives = 45/106 (42.45%), Query Frame = 2
Query:  827 LKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHH---------LQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            L+R   TH N    +C    S    S H  + Q        F+C+EC   F  S  L +H           ++H+K K Y C  C   F+ S HL  HQ++H  +K
Sbjct:  137 LQRVVLTHPNTPSQECDESGSTMSSSLHSDQSQGFQPSKNAFECSECGKVFSKSSTLNKHQKIHNEKNANQKIHIKEKRYECRECGKAFHQSTHLIHHQRIHTGEK 242          
BLAST of SMED30027210 vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 90.5077 bits (223), Expect = 1.682e-20
Identity = 42/110 (38.18%), Postives = 63/110 (57.27%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +P+RC  C  +F+ + +L  H+  HT EKP+ C +C   F  S  L  H++ HT  +P+ C +C+ +F DS  L +H L+ H   KPY C+ C  KF  S +L RH + H
Sbjct:  105 KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKH-LRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 213          

HSP 2 Score: 73.9442 bits (180), Expect = 9.542e-15
Identity = 43/108 (39.81%), Postives = 60/108 (55.56%), Query Frame = 2
Query:  683 NVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH 1006
            +  KPF C  C  +FS+  +L  H+R H   +P+ C +C   F+ S  L  H+ THT E+PY C+ C  AF DS  L +H + HT  KP+ C+ C   F  S +L RH
Sbjct:  102 STPKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRH 209          

HSP 3 Score: 64.3142 bits (155), Expect = 1.650e-11
Identity = 38/88 (43.18%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIH 934
            K I    KPF+C +C+  FS+   L  H R+H   RPY C  C  +F DS  L +H  THT  KPY CS+C   F  S +L RH + H
Sbjct:  126 KRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 213          
BLAST of SMED30027210 vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 89.7373 bits (221), Expect = 9.082e-20
Identity = 42/110 (38.18%), Postives = 63/110 (57.27%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +P+RC  C  +F+ + +L  H+  HT EKP+ C +C   F  S  L  H++ HT  +P+ C +C+ +F DS  L +H L+ H   KPY C+ C  KF  S +L RH + H
Sbjct:  164 KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKH-LRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 272          

HSP 2 Score: 73.559 bits (179), Expect = 3.294e-14
Identity = 43/105 (40.95%), Postives = 59/105 (56.19%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH 1006
            KPF C  C  +FS+  +L  H+R H   +P+ C +C   F+ S  L  H+ THT E+PY C+ C  AF DS  L +H + HT  KP+ C+ C   F  S +L RH
Sbjct:  164 KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRH 268          

HSP 3 Score: 63.929 bits (154), Expect = 5.243e-11
Identity = 38/88 (43.18%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIH 934
            K I    KPF+C +C+  FS+   L  H R+H   RPY C  C  +F DS  L +H  THT  KPY CS+C   F  S +L RH + H
Sbjct:  185 KRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 272          
BLAST of SMED30027210 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 91.6633 bits (226), Expect = 3.916e-19
Identity = 38/108 (35.19%), Postives = 60/108 (55.56%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRH 1093
              RP++C +CT  F    HL++H   HT E+P++C +C   F  + +LK H ++H   KP+ C+ C + F    HL R H ++H   +PYSC +C  K+     L+ H
Sbjct:  532 GERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHL-RLHKRLHANERPYSCGTCGKKYISPSGLRTH 638          

HSP 2 Score: 91.2781 bits (225), Expect = 5.277e-19
Identity = 45/131 (34.35%), Postives = 73/131 (55.73%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGF 1174
            Y C  C  +F    +LK H  THT E+P++C +CT  F    HL++H  +HT  +P +C+ C   F  + +LK  HL++H   KPY+C+ C +KF    HL+ H+++H  ++    +C T     +S +G 
Sbjct:  508 YACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKT-HLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPY--SCGTCGKKYISPSGL 635          
BLAST of SMED30027210 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 91.6633 bits (226), Expect = 4.227e-19
Identity = 38/108 (35.19%), Postives = 60/108 (55.56%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRH 1093
              RP++C +CT  F    HL++H   HT E+P++C +C   F  + +LK H ++H   KP+ C+ C + F    HL R H ++H   +PYSC +C  K+     L+ H
Sbjct:  532 GERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHL-RLHKRLHANERPYSCGTCGKKYISPSGLRTH 638          

HSP 2 Score: 91.2781 bits (225), Expect = 5.746e-19
Identity = 41/112 (36.61%), Postives = 66/112 (58.93%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            Y C  C  +F    +LK H  THT E+P++C +CT  F    HL++H  +HT  +P +C+ C   F  + +LK  HL++H   KPY+C+ C +KF    HL+ H+++H  ++
Sbjct:  508 YACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKT-HLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANER 618          
BLAST of SMED30027210 vs. Ensembl Celegans
Match: fezf-1 (FEZ Family zinc finger protein [Source:UniProtKB/TrEMBL;Acc:O62425])

HSP 1 Score: 79.7221 bits (195), Expect = 9.192e-17
Identity = 52/145 (35.86%), Postives = 73/145 (50.34%), Query Frame = 2
Query:  683 NVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            N  K F C +C   F+ H++L RH   H   RP+ C +C  +F  +  L RH+  HT+ KP++C  C   F  S  L  H +IH   KPF C  C   F+ + + K H L  H   K +SC+ CS  F+ S++L  H   H   K
Sbjct:   47 NSRKKFPCEICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRL-THEDTKKFSCSICSRAFHQSYNLAFHMFTHEEHK 190          

HSP 2 Score: 76.2554 bits (186), Expect = 1.259e-15
Identity = 48/151 (31.79%), Postives = 79/151 (52.32%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQ 1129
            +    +PF+C +C  +F +   L RH+  H +++P++C  C   FN S  L  H   H   KP+ C +C   F  + + K H+  H   K F C+ C  +F+ S++L   H+  H + KP++C+ CS  F  ++ LK+    HLRK  + Q
Sbjct:   73 VHTGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLA-FHMFTHEEHKPFTCHVCSKGFCRNFDLKK----HLRKMHMTQ 218          

HSP 3 Score: 65.855 bits (159), Expect = 5.514e-12
Identity = 41/118 (34.75%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHV 1024
            K I   SKP  C  C   F+R   L  H R H   +P+ C +C   F+ + + K H+ TH + K + CS+C+ AF  S++L  H   H + KPF C+ C   F  ++ LK+H  ++H+
Sbjct:   99 KIIHTDSKPHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFHMFTHEEHKPFTCHVCSKGFCRNFDLKKHLRKMHM 216          
BLAST of SMED30027210 vs. Ensembl Fly
Match: Clamp (gene:FBgn0032979 transcript:FBtr0085964)

HSP 1 Score: 108.227 bits (269), Expect = 1.486e-24
Identity = 57/147 (38.78%), Postives = 87/147 (59.18%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLR 1111
            K + +  K + C++C  +F++  +L+ H R H   +PY+C  C   F+ S HLK H+ TH+ E+PY C +C   F     L  H++IHT  KP++C  C S+F  + HLK +H +VH   KPY C  CS+ F D + LKRH+ +H +
Sbjct:  379 KKLHSGEKNYKCSICGLAFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSGERPYVCGVCDKGFARHATLWNHRRIHTGEKPYKCEICGSAFSQAAHLK-NHAKVHSGEKPYKCEICSAAFADRFALKRHRGIHQK 524          

HSP 2 Score: 76.6406 bits (187), Expect = 2.372e-14
Identity = 40/91 (43.96%), Postives = 59/91 (64.84%), Query Frame = 2
Query:  668 EKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTK 940
            E+T S   +P++C +C   F+RH  L  H R H   +PY+C +C S+F+ + HLK H   H+ EKPY+C +C++AF D + LKRH+ IH K
Sbjct:  435 ERTHSG-ERPYVCGVCDKGFARHATLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRHRGIHQK 524          

HSP 3 Score: 61.2326 bits (147), Expect = 1.567e-9
Identity = 29/87 (33.33%), Postives = 49/87 (56.32%), Query Frame = 2
Query:  845 THTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            T    KP+ C++C   F     L  H+++H+  K ++C+ C  +F  + +LK +H ++H   KPY C +C  +F  S HLK H++ H
Sbjct:  353 TENPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKCSICGLAFAKAVYLK-NHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTH 438          
BLAST of SMED30027210 vs. Ensembl Fly
Match: Clamp (gene:FBgn0032979 transcript:FBtr0100407)

HSP 1 Score: 108.227 bits (269), Expect = 1.773e-24
Identity = 57/147 (38.78%), Postives = 87/147 (59.18%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLR 1111
            K + +  K + C++C  +F++  +L+ H R H   +PY+C  C   F+ S HLK H+ TH+ E+PY C +C   F     L  H++IHT  KP++C  C S+F  + HLK +H +VH   KPY C  CS+ F D + LKRH+ +H +
Sbjct:  384 KKLHSGEKNYKCSICGLAFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSGERPYVCGVCDKGFARHATLWNHRRIHTGEKPYKCEICGSAFSQAAHLK-NHAKVHSGEKPYKCEICSAAFADRFALKRHRGIHQK 529          

HSP 2 Score: 76.2554 bits (186), Expect = 2.685e-14
Identity = 40/91 (43.96%), Postives = 59/91 (64.84%), Query Frame = 2
Query:  668 EKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTK 940
            E+T S   +P++C +C   F+RH  L  H R H   +PY+C +C S+F+ + HLK H   H+ EKPY+C +C++AF D + LKRH+ IH K
Sbjct:  440 ERTHSG-ERPYVCGVCDKGFARHATLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRHRGIHQK 529          
BLAST of SMED30027210 vs. Ensembl Fly
Match: gl (gene:FBgn0004618 transcript:FBtr0083584)

HSP 1 Score: 103.605 bits (257), Expect = 6.105e-23
Identity = 57/146 (39.04%), Postives = 83/146 (56.85%), Query Frame = 2
Query:  668 EKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            E +     KP LC LC  +++R   L+ H R+H   RPYRC  C  SF+ + +L  H  THT +KP++C +C   F  S  +  H + H+  +P++C+ CK SF DS  L +H L++H   KPY C  C  +F  S +L RH +VH
Sbjct:  427 EGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKH-LRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH 571          

HSP 2 Score: 83.1889 bits (204), Expect = 1.840e-16
Identity = 41/117 (35.04%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            +P  C LC  ++     LK H  TH+ E+PY+C  C  +F  + +L  H + HT  KPF+C  C   F  S  +   H++ H   +PY C+SC   F DS  L +H ++H  +K  Q
Sbjct:  435 KPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTT-HMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQ 550          
BLAST of SMED30027210 vs. Ensembl Fly
Match: gl (gene:FBgn0004618 transcript:FBtr0330042)

HSP 1 Score: 103.605 bits (257), Expect = 6.703e-23
Identity = 57/146 (39.04%), Postives = 83/146 (56.85%), Query Frame = 2
Query:  668 EKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            E +     KP LC LC  +++R   L+ H R+H   RPYRC  C  SF+ + +L  H  THT +KP++C +C   F  S  +  H + H+  +P++C+ CK SF DS  L +H L++H   KPY C  C  +F  S +L RH +VH
Sbjct:  427 EGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKH-LRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH 571          

HSP 2 Score: 83.1889 bits (204), Expect = 1.897e-16
Identity = 41/117 (35.04%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            +P  C LC  ++     LK H  TH+ E+PY+C  C  +F  + +L  H + HT  KPF+C  C   F  S  +   H++ H   +PY C+SC   F DS  L +H ++H  +K  Q
Sbjct:  435 KPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTT-HMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQ 550          
BLAST of SMED30027210 vs. Ensembl Fly
Match: CG17385 (gene:FBgn0033934 transcript:FBtr0087517)

HSP 1 Score: 93.5893 bits (231), Expect = 5.671e-21
Identity = 43/117 (36.75%), Postives = 67/117 (57.26%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKV 1120
            + RP+ C +C+ +F  + +L+RH   H+ E+P+ C+ C  +F    ++KRH+  HT  KPF+C  C   F    +LK+H L  H+  KPY CN C   F    + KRH Q H+++ V
Sbjct:   70 DVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNLKKHKLG-HLNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGV 185          

HSP 2 Score: 88.1965 bits (217), Expect = 5.081e-19
Identity = 45/121 (37.19%), Postives = 66/121 (54.55%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            N   Y C LC  SF +S +L RH   H + +P+ C++C+ AF  + +L+RH  +H+  +PF CN C  SF    ++KRH +  H   KP+ C  C   F    +LK+H+  HL  K  Q N
Sbjct:   42 NKTTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKM-THTGEKPFRCQRCGRYFSQLVNLKKHKLGHLNAKPYQCN 161          

HSP 3 Score: 87.4261 bits (215), Expect = 7.203e-19
Identity = 53/130 (40.77%), Postives = 75/130 (57.69%), Query Frame = 2
Query:  641 SLCNSTN-KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVK 1027
            S CNS N      + N  +PF+CN+CS +F++  +L+RH   H   RP+ C  C  SF    ++KRH+ THT EKP++C  C   F    +LK+H+  H   KP+QCN C+  F    + KR HLQ H+K
Sbjct:   54 SFCNSGNLDRHMKVHNDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFKR-HLQSHIK 182          

HSP 4 Score: 73.559 bits (179), Expect = 3.995e-14
Identity = 37/114 (32.46%), Postives = 63/114 (55.26%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWH--LKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            + C  C  +F       L R +  + N+  Y+C LC  +F +S +L RH ++H  ++PF CN C  +F  + +L+RH+  VH   +P++CN C+  F    ++KRH+  H  +K
Sbjct:   16 FSCKRCDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICSKAFAQAVNLQRHYA-VHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEK 128          
BLAST of SMED30027210 vs. Ensembl Zebrafish
Match: znf740a (zinc finger protein 740a [Source:ZFIN;Acc:ZDB-GENE-030131-5064])

HSP 1 Score: 110.538 bits (275), Expect = 1.797e-28
Identity = 47/112 (41.96%), Postives = 68/112 (60.71%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
              +PY C++C   F   +HL+RH  THT  KPY C++C   F   +HL+RH   HT +KP+ C+ C   F+  +HL+RH L  H  VKPY+C+ C  +F+  +HL+RH   H
Sbjct:    3 GVKPYACSMCDMRFFHRYHLQRHSLTHTGVKPYACTMCDMRFFQRYHLQRHSLTHTGVKPYACSMCDMRFFQRYHLQRHSL-THTGVKPYACSMCDMRFFQRYHLERHSLTH 113          

HSP 2 Score: 90.5077 bits (223), Expect = 1.968e-21
Identity = 46/107 (42.99%), Postives = 65/107 (60.75%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHL 1012
            KP+ C++C   F   +HL+RH  +H   +PY CT+C   F   +HL+RH  THT  KPY CS+C   F   +HL+RH   HT +KP+ C+ C   F+  +HL+RH L
Sbjct:    5 KPYACSMCDMRFFHRYHLQRHSLTHTGVKPYACTMCDMRFFQRYHLQRHSLTHTGVKPYACSMCDMRFFQRYHLQRHSLTHTGVKPYACSMCDMRFFQRYHLERHSL 111          

HSP 3 Score: 83.9593 bits (206), Expect = 3.903e-19
Identity = 36/85 (42.35%), Postives = 51/85 (60.00%), Query Frame = 2
Query:  851 TNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +  KPY CS+C   F   +HL+RH   HT +KP+ C  C   F+  +HL+RH L  H  VKPY+C+ C  +F+  +HL+RH   H
Sbjct:    2 SGVKPYACSMCDMRFFHRYHLQRHSLTHTGVKPYACTMCDMRFFQRYHLQRHSL-THTGVKPYACSMCDMRFFQRYHLQRHSLTH 85          

HSP 4 Score: 64.3142 bits (155), Expect = 3.481e-12
Identity = 35/82 (42.68%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
            KP+ C +C   F + +HL+RH  +H   +PY C++C   F   +HL+RH  THT  KPY CS+C   F   +HL+RH   HT
Sbjct:   33 KPYACTMCDMRFFQRYHLQRHSLTHTGVKPYACSMCDMRFFQRYHLQRHSLTHTGVKPYACSMCDMRFFQRYHLERHSLTHT 114          
BLAST of SMED30027210 vs. Ensembl Zebrafish
Match: si:dkeyp-44d3.1 (si:dkeyp-44d3.1 [Source:ZFIN;Acc:ZDB-GENE-120709-22])

HSP 1 Score: 113.235 bits (282), Expect = 3.203e-28
Identity = 60/140 (42.86%), Postives = 81/140 (57.86%), Query Frame = 2
Query:  698 FLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            F C  C  SF+    L+ H   H   +P+ CT C  SFN S HL +H  THT EKP+ C+ C  +F  S +L +H +IHT  KPF C +C  SF  S HL  HH+++H  VKP++C  C   F  S HL +H ++H R+K
Sbjct:   66 FTCTQCGKSFATKSKLKIHMMIHTGEKPFTCTQCGKSFNQSSHLNKHMMTHTGEKPFTCTQCGKSFSLSSNLNKHMRIHTGEKPFSCPQCGRSFSCSSHL-NHHMRIHTGVKPFTCTQCGKSFSQSSHLNKHMRIHTREK 204          

HSP 2 Score: 60.077 bits (144), Expect = 7.164e-10
Identity = 37/86 (43.02%), Postives = 48/86 (55.81%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKP 949
            KPF C  C  SFS   +L +H R H   +P+ C  C  SF+ S HL  H   HT  KP+ C+ C  +F  S HL +H +IHT+ KP
Sbjct:  120 KPFTCTQCGKSFSLSSNLNKHMRIHTGEKPFSCPQCGRSFSCSSHLNHHMRIHTGVKPFTCTQCGKSFSQSSHLNKHMRIHTREKP 205          
BLAST of SMED30027210 vs. Ensembl Zebrafish
Match: znf740a (zinc finger protein 740a [Source:ZFIN;Acc:ZDB-GENE-030131-5064])

HSP 1 Score: 116.316 bits (290), Expect = 3.677e-28
Identity = 60/150 (40.00%), Postives = 89/150 (59.33%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            +S V K F+C+ C  +F   +HL+RH   H   +P+ C +C   F   +HL+RH  THT  KPY CS+C   F   +HL+RH   HT +KP+ C+ C   F+  +HL+RH L  H   KP++C+ C  +F   +HL+RH++VH  +K  Q
Sbjct:  139 LSKVQKNFICDHCYGAFRSGYHLKRHILIHTGEKPFACAVCDMRFIQRYHLERHSLTHTGVKPYACSMCDMRFFQRYHLQRHSLTHTGVKPYACSMCDMRFFQRYHLERHSL-THTGEKPFACDMCDMRFIQRYHLERHKRVHSGEKPYQ 287          

HSP 2 Score: 105.531 bits (262), Expect = 2.270e-24
Identity = 58/142 (40.85%), Postives = 78/142 (54.93%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQV 1102
            I    KPF C +C   F + +HL RH  +H   +PY C++C   F   +HL+RH  THT  KPY CS+C   F   +HL+RH   HT  KPF C+ C   F   +HL+RH  +VH   KPY C  C   F  +  L RH+++
Sbjct:  167 IHTGEKPFACAVCDMRFIQRYHLERHSLTHTGVKPYACSMCDMRFFQRYHLQRHSLTHTGVKPYACSMCDMRFFQRYHLERHSLTHTGEKPFACDMCDMRFIQRYHLERHK-RVHSGEKPYQCERCQQNFSRTDRLLRHRRL 307          
BLAST of SMED30027210 vs. Ensembl Zebrafish
Match: CZQB01141835.1 (zinc finger protein 883-like [Source:NCBI gene;Acc:110439853])

HSP 1 Score: 114.005 bits (284), Expect = 3.016e-27
Identity = 66/143 (46.15%), Postives = 85/143 (59.44%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I +  +P+ C  C  SFS   HLR H+R H   RP+RCTLC  SF  S  LKRH  THT E+PYQC  C  +F +S HLK H++IHT  KP++C+ C  SF     LK H   +H   +P+ C  C   F+ S  LKRHQ++H
Sbjct:  216 IHSGERPYKCLQCEKSFSDSGHLRGHQRIHTGERPHRCTLCQKSFFRSGDLKRHHRTHTGERPYQCFQCGKSFSESGHLKEHRRIHTGEKPYRCSHCDKSFSRLERLKGHQ-SIHTGERPFHCAHCGKNFFRSGELKRHQRIH 357          

HSP 2 Score: 113.235 bits (282), Expect = 6.064e-27
Identity = 64/155 (41.29%), Postives = 89/155 (57.42%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            K  + I +  +PF C  C  +F     L+RHER H   RPY C  C  SF+DS HLK+H+  H+ E+PYQC  C   F  S  LKRH +IH+  +P++C +C+ SF DS HL R H ++H   +P+ C  C   F+ S  LKRH + H  ++  Q
Sbjct:  127 KRHQRIHSGERPFPCFQCGKNFPTSGDLKRHERIHTGERPYACLQCGKSFSDSGHLKQHERMHSGERPYQCPQCAKRFYRSGDLKRHLRIHSGERPYKCLQCEKSFSDSGHL-RGHQRIHTGERPHRCTLCQKSFFRSGDLKRHHRTHTGERPYQ 280          

HSP 3 Score: 112.849 bits (281), Expect = 9.686e-27
Identity = 65/152 (42.76%), Postives = 88/152 (57.89%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    +P+ C  C  SFS   HL++HER H   RPY+C  C   F  S  LKRH   H+ E+PY+C  C  +F DS HL+ HQ+IHT  +P +C  C+ SF+ S  LKRHH + H   +PY C  C   F +S HLK H+++H  +K
Sbjct:  155 KRHERIHTGERPYACLQCGKSFSDSGHLKQHERMHSGERPYQCPQCAKRFYRSGDLKRHLRIHSGERPYKCLQCEKSFSDSGHLRGHQRIHTGERPHRCTLCQKSFFRSGDLKRHH-RTHTGERPYQCFQCGKSFSESGHLKEHRRIHTGEK 305          

HSP 4 Score: 110.538 bits (275), Expect = 4.671e-26
Identity = 62/152 (40.79%), Postives = 88/152 (57.89%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + + +  +P+ C  C+  F R   L+RH R H   RPY+C  C  SF+DS HL+ HQ  HT E+P++C+LC  +F  S  LKRH + HT  +P+QC +C  SF +S HLK  H ++H   KPY C+ C   F     LK HQ +H  ++
Sbjct:  183 KQHERMHSGERPYQCPQCAKRFYRSGDLKRHLRIHSGERPYKCLQCEKSFSDSGHLRGHQRIHTGERPHRCTLCQKSFFRSGDLKRHHRTHTGERPYQCFQCGKSFSESGHLKE-HRRIHTGEKPYRCSHCDKSFSRLERLKGHQSIHTGER 333          

HSP 5 Score: 96.6709 bits (239), Expect = 2.494e-21
Identity = 50/112 (44.64%), Postives = 67/112 (59.82%), Query Frame = 2
Query:  776 RPYRCTLCTSSF--NDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            RPY C  C   F  ND   +KRHQ  H+ E+P+ C  C   F  S  LKRH++IHT  +P+ C +C  SF DS HLK+H  ++H   +PY C  C+ +FY S  LKRH ++H
Sbjct:  110 RPYHCQDCGKYFRIND---IKRHQRIHSGERPFPCFQCGKNFPTSGDLKRHERIHTGERPYACLQCGKSFSDSGHLKQHE-RMHSGERPYQCPQCAKRFYRSGDLKRHLRIH 217          

HSP 6 Score: 58.9214 bits (141), Expect = 7.604e-9
Identity = 37/83 (44.58%), Postives = 48/83 (57.83%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
             +P+ C  C  SFS   HL+ H R H   +PYRC+ C  SF+    LK HQ  HT E+P+ C+ C   F  S  LKRHQ+IH+
Sbjct:  276 ERPYQCFQCGKSFSESGHLKEHRRIHTGEKPYRCSHCDKSFSRLERLKGHQSIHTGERPFHCAHCGKNFFRSGELKRHQRIHS 358          
BLAST of SMED30027210 vs. Ensembl Zebrafish
Match: znf1001 (zinc finger protein 1001 [Source:ZFIN;Acc:ZDB-GENE-080213-7])

HSP 1 Score: 111.309 bits (277), Expect = 7.338e-27
Identity = 61/152 (40.13%), Postives = 91/152 (59.87%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KI K I    KP++C+LC+  FS+  H++ H R H   +PY+C+ C   F     L++H+ THT EKPY+CS C   F D  +L++H +IHT  KP++C+ C   F DS  L R H +VH   KPY C+ C  +F    +L++H ++H  +K
Sbjct:  110 KIHKRIHTGEKPYICSLCNKRFSQLAHMKTHARIHTGEKPYKCSYCEKRFRRLGQLRQHERTHTGEKPYKCSHCDKRFSDGGNLRQHVRIHTGEKPYKCSHCDKRFSDSG-LLRQHERVHTGEKPYICSYCDKRFSGGGNLRQHVRIHTGEK 260          

HSP 2 Score: 88.1965 bits (217), Expect = 8.234e-19
Identity = 53/148 (35.81%), Postives = 79/148 (53.38%), Query Frame = 2
Query:  674 TISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            ++    K + C++C  SF     LR H++ H     Y+C  C  +F  +  LK H+  HT EKPY CSLC   F    H+K H +IHT  KP++C+ C+  F     L R H + H   KPY C+ C  +F D  +L++H ++H  +K
Sbjct:   58 SVHTKEKLYPCSVCEKSFRHQRSLRNHQKIHTGVGEYKCFECEKTFCTAESLKIHKRIHTGEKPYICSLCNKRFSQLAHMKTHARIHTGEKPYKCSYCEKRFRRLGQL-RQHERTHTGEKPYKCSHCDKRFSDGGNLRQHVRIHTGEK 204          

HSP 3 Score: 73.1738 bits (178), Expect = 9.123e-14
Identity = 45/115 (39.13%), Postives = 66/115 (57.39%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVK 1033
             KP+ C+ C   FS   +LR+H R H   +PY+C+ C   F+DS  L++H+  HT EKPY CS C   F    +L++H +IHT  KP++C+ C   F     LK H  ++H + K
Sbjct:  175 EKPYKCSHCDKRFSDGGNLRQHVRIHTGEKPYKCSHCDKRFSDSGLLRQHERVHTGEKPYICSYCDKRFSGGGNLRQHVRIHTGEKPYKCSYCDKRFRQLGGLKIHE-RIHTREK 288          

HSP 4 Score: 71.2478 bits (173), Expect = 3.517e-13
Identity = 44/144 (30.56%), Postives = 66/144 (45.83%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDS----------------------------WHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
              +P+ CT C  SF  S                              LK H   HT EK Y CS+C  +F+    L+ HQ+IHT +  ++C EC+ +F  +  LK  H ++H   KPY C+ C+ +F    H+K H ++H  +K
Sbjct:    6 GEKPFTCTQCGKSFRASSTLNNHMLIHTGEKTHKCDQCGKTFLRDSELKNHLSVHTKEKLYPCSVCEKSFRHQRSLRNHQKIHTGVGEYKCFECEKTFCTAESLKI-HKRIHTGEKPYICSLCNKRFSQLAHMKTHARIHTGEK 148          

HSP 5 Score: 63.929 bits (154), Expect = 9.497e-11
Identity = 34/86 (39.53%), Postives = 47/86 (54.65%), Query Frame = 2
Query:  848 HTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            HT EKP+ C+ C  +F+ S  L  H  IHT  K  +C++C  +F     LK +HL VH K K Y C+ C   F     L+ HQ++H
Sbjct:    4 HTGEKPFTCTQCGKSFRASSTLNNHMLIHTGEKTHKCDQCGKTFLRDSELK-NHLSVHTKEKLYPCSVCEKSFRHQRSLRNHQKIH 88          
BLAST of SMED30027210 vs. Ensembl Xenopus
Match: cd63 (CD63 molecule [Source:Xenbase;Acc:XB-GENE-1015227])

HSP 1 Score: 113.62 bits (283), Expect = 7.900e-26
Identity = 68/163 (41.72%), Postives = 88/163 (53.99%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCA 1138
            NS  K  +T     KPF C+ C   FS+   L RH+R+H    P+ C+ C   F + +HL RHQ THT EKPY CS C   F + +H  RHQ+IHT  KPF C+EC   F +   LKRH +  H   KP+SC++C   F     L RHQ+ H  +K     C 
Sbjct:  586 NSDLKRHQTTHTGEKPFSCSECGRCFSKQSDLARHQRTHTGENPFSCSNCGKCFLNHFHLARHQRTHTGEKPYSCSECGKCFSNEYHRDRHQRIHTGEKPFSCSECGKCFSNKSDLKRHQI-THTGEKPFSCSACGKCFSKRSDLDRHQRTHTGEKPFSCECG 747          

HSP 2 Score: 106.686 bits (265), Expect = 1.344e-23
Identity = 59/142 (41.55%), Postives = 81/142 (57.04%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KPF C+ C   FS    L+RH+ +H   +P+ C+ C   F+++  LKRHQ THT EKP+ CS C   F     L RHQ+ HT   PF C+ C   F + +HL RH  + H   KPYSC+ C   F + +H  RHQ++H  +K
Sbjct:  544 KPFSCSECGKCFSNKSDLKRHQITHTEEKPFSCSECGKCFSNNSDLKRHQTTHTGEKPFSCSECGRCFSKQSDLARHQRTHTGENPFSCSNCGKCFLNHFHLARHQ-RTHTGEKPYSCSECGKCFSNEYHRDRHQRIHTGEK 684          

HSP 3 Score: 104.76 bits (260), Expect = 6.195e-23
Identity = 51/114 (44.74%), Postives = 66/114 (57.89%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +P+ C+ C   F +  HL RHQ THT EKPY CS C   F +  HL RHQ+ HT  KPF C+EC   F +   LKRH +  H   KP+SC+ C   F +  +L RH+ +H  KK
Sbjct:  376 KPFSCSECGKCFLNHSHLARHQRTHTGEKPYSCSECGKCFLNHSHLARHQRTHTGEKPFSCSECGKCFANQSDLKRHQI-THTGEKPFSCSECGKCFVNESNLDRHKIIHTGKK 488          

HSP 4 Score: 101.679 bits (252), Expect = 6.100e-22
Identity = 62/145 (42.76%), Postives = 76/145 (52.41%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            K I    KPF C+ C   FS+   L  H R H    P+ C+ C   F +  HL RHQ THT EKP+ CS C   F +   LKRHQ  HT+ KPF C+EC   F ++  LKRH    H   KP+SC+ C   F     L RHQ+ H
Sbjct:  481 KIIHTGKKPFSCSECGKCFSKRSDLDCHHRIHTGENPFSCSECGKYFLNHSHLARHQRTHTGEKPFSCSECGKCFSNKSDLKRHQITHTEEKPFSCSECGKCFSNNSDLKRHQT-THTGEKPFSCSECGRCFSKQSDLARHQRTH 624          

HSP 5 Score: 100.138 bits (248), Expect = 1.658e-21
Identity = 60/142 (42.25%), Postives = 80/142 (56.34%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C+ C   F  H HL RH+R+H   +P+ C+ C   F +   LKRHQ THT EKP+ CS C   F +  +L RH+ IHT  KPF C+EC   F     L  HH ++H    P+SC+ C   F +  HL RHQ+ H  +K
Sbjct:  404 KPYSCSECGKCFLNHSHLARHQRTHTGEKPFSCSECGKCFANQSDLKRHQITHTGEKPFSCSECGKCFVNESNLDRHKIIHTGKKPFSCSECGKCFSKRSDLDCHH-RIHTGENPFSCSECGKYFLNHSHLARHQRTHTGEK 544          

HSP 6 Score: 92.0485 bits (227), Expect = 7.718e-19
Identity = 54/142 (38.03%), Postives = 75/142 (52.82%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KPF C+ C   F+    L+RH+ +H   +P+ C+ C   F +  +L RH+  HT +KP+ CS C   F     L  H +IHT   PF C+EC   F +  HL RH  + H   KP+SC+ C   F +   LKRHQ  H  +K
Sbjct:  432 KPFSCSECGKCFANQSDLKRHQITHTGEKPFSCSECGKCFVNESNLDRHKIIHTGKKPFSCSECGKCFSKRSDLDCHHRIHTGENPFSCSECGKYFLNHSHLARHQ-RTHTGEKPFSCSECGKCFSNKSDLKRHQITHTEEK 572          

HSP 7 Score: 90.5077 bits (223), Expect = 2.100e-18
Identity = 46/103 (44.66%), Postives = 59/103 (57.28%), Query Frame = 2
Query:  809 FNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            F+   +LK HQ THT EKP+ CS C   F +  HL RHQ+ HT  KP+ C+EC   F +  HL RH  + H   KP+SC+ C   F +   LKRHQ  H  +K
Sbjct:  359 FSVRSNLKHHQITHTREKPFSCSECGKCFLNHSHLARHQRTHTGEKPYSCSECGKCFLNHSHLARHQ-RTHTGEKPFSCSECGKCFANQSDLKRHQITHTGEK 460          

HSP 8 Score: 68.9366 bits (167), Expect = 1.240e-11
Identity = 38/95 (40.00%), Postives = 51/95 (53.68%), Query Frame = 2
Query:  833 RHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +H  TH ++K +  S     F    +LK HQ  HT+ KPF C+EC   F +  HL RH  + H   KPYSC+ C   F +  HL RHQ+ H  +K
Sbjct:  339 KHCRTHKSKKTFSSSNYGKCFSVRSNLKHHQITHTREKPFSCSECGKCFLNHSHLARHQ-RTHTGEKPYSCSECGKCFLNHSHLARHQRTHTGEK 432          

HSP 9 Score: 60.077 bits (144), Expect = 7.011e-9
Identity = 38/92 (41.30%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPF 952
            I    KPF C+ C   FS    L+RH+ +H   +P+ C+ C   F+    L RHQ THT EKP+ C  C   F +  +L RHQ+ HT  KPF
Sbjct:  679 IHTGEKPFSCSECGKCFSNKSDLKRHQITHTGEKPFSCSACGKCFSKRSDLDRHQRTHTGEKPFSCE-CGKCFTNRSNLDRHQRTHTGEKPF 769          
BLAST of SMED30027210 vs. Ensembl Xenopus
Match: ENSXETT00000047530.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460383.1:224335:284112:1 gene:ENSXETG00000018931.1 transcript:ENSXETT00000047530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.849 bits (281), Expect = 1.284e-25
Identity = 63/147 (42.86%), Postives = 86/147 (58.50%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C+ C   FS+   L RH+R+H   +P+ C+ C   F + +H  RHQ  HT EKP+ CS C   FK+  +L RHQ+IHT  KPF C+EC   F     L RHH ++H   KP+SC+ C   FY+ +H  RHQ++H  +K
Sbjct:  496 IHTGEKPFSCSECGKCFSKQSDLVRHQRTHTGEKPFSCSECGKCFYNEYHRDRHQRIHTGEKPFSCSECGKCFKNRSNLDRHQRIHTGEKPFSCSECGKCFSKRCDLARHH-RIHTGEKPFSCSECGKCFYNEYHRDRHQRIHTGEK 641          

HSP 2 Score: 107.842 bits (268), Expect = 6.622e-24
Identity = 60/142 (42.25%), Postives = 79/142 (55.63%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KPF C+ C   FS    L+ H+ +H   +P+ C  C   F + +HL RHQ THT EKP+ CS C   F + +H  RHQ+IHT  KPF C+EC   F    HL RH    H   KP+SC+ C   F +  HL RH++ H  +K
Sbjct:  271 KPFSCSECGKCFSNKSDLKGHQITHTGEKPFSCLECGKCFLNHFHLARHQRTHTGEKPFSCSECGKCFSNQYHRDRHQKIHTGEKPFSCSECGKCFLHHSHLARHQT-THTGEKPFSCSECGKCFLNHSHLARHERTHTGEK 411          

HSP 3 Score: 103.605 bits (257), Expect = 1.206e-22
Identity = 59/147 (40.14%), Postives = 79/147 (53.74%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C+ C   F    +L RH+R H   +P+ C+ C   F+    L RH   HT EKP+ CS C   F + +H  RHQ+IHT  KPF C+EC   F +  +L RH  ++H   KP+SC+ C   F   WHLK H + H  +K
Sbjct:  552 IHTGEKPFSCSECGKCFKNRSNLDRHQRIHTGEKPFSCSECGKCFSKRCDLARHHRIHTGEKPFSCSECGKCFYNEYHRDRHQRIHTGEKPFSCSECGKCFKNRSNLDRHQ-RIHTGEKPFSCSECGKCFSTQWHLKTHHRTHTEEK 697          

HSP 4 Score: 101.293 bits (251), Expect = 7.781e-22
Identity = 59/142 (41.55%), Postives = 82/142 (57.75%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KPF C+ C   F  H HL RH+R+H   +P+ C+ C   F+  ++  RHQ  HT EKP+ CS C   F     L RHQ+ HT  KPF C+EC   FY+ +H  RH  ++H   KP+SC+ C   F +  +L RHQ++H  +K
Sbjct:  445 KPFSCSECGKCFLSHSHLARHQRTHTGEKPFSCSECGKCFSIEYYRDRHQRIHTGEKPFSCSECGKCFSKQSDLVRHQRTHTGEKPFSCSECGKCFYNEYHRDRHQ-RIHTGEKPFSCSECGKCFKNRSNLDRHQRIHTGEK 585          

HSP 5 Score: 100.138 bits (248), Expect = 1.790e-21
Identity = 63/152 (41.45%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KI        KPF C  C   FS+   L RH+R+H   +P+ C+ C   F++   LKRHQ THT EKP+ CS C   F +   LK HQ  HT  KPF C EC   F + +HL RH  + H   KP+SC+ C   F + +H  RHQ++H  +K
Sbjct:  206 KIHHRNHTGEKPFSCK-CGKCFSKRSDLARHQRTHTGEKPFSCSECGKCFSNKSDLKRHQITHTGEKPFSCSECGKCFSNKSDLKGHQITHTGEKPFSCLECGKCFLNHFHLARHQ-RTHTGEKPFSCSECGKCFSNQYHRDRHQKIHTGEK 355          

HSP 6 Score: 98.9821 bits (245), Expect = 4.536e-21
Identity = 62/147 (42.18%), Postives = 79/147 (53.74%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVK-----VKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KPF C+ C   FS  +H  RH++ H   +P+ C+ C   F    HL RHQ THT EKP+ CS C   F +  HL RH++ HT  KPF C+EC   F +   LKRH L    K      KP+SC+ C   F    HL RHQ+ H  +K
Sbjct:  327 KPFSCSECGKCFSNQYHRDRHQKIHTGEKPFSCSECGKCFLHHSHLARHQTTHTGEKPFSCSECGKCFLNHSHLARHERTHTGEKPFSCSECGKCFANQSDLKRHQLTHTGKKSFSWEKPFSCSECGKCFLSHSHLARHQRTHTGEK 473          

HSP 7 Score: 93.5893 bits (231), Expect = 1.836e-19
Identity = 54/121 (44.63%), Postives = 69/121 (57.02%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPY 1039
            I    KPF C+ C   FS+   L RH R H   +P+ C+ C   F + +H  RHQ  HT EKP+ CS C   FK+  +L RHQ+IHT  KPF C+EC   F   WHLK HH + H + KP+
Sbjct:  580 IHTGEKPFSCSECGKCFSKRCDLARHHRIHTGEKPFSCSECGKCFYNEYHRDRHQRIHTGEKPFSCSECGKCFKNRSNLDRHQRIHTGEKPFSCSECGKCFSTQWHLKTHH-RTHTEEKPF 699          

HSP 8 Score: 93.2041 bits (230), Expect = 2.456e-19
Identity = 63/155 (40.65%), Postives = 81/155 (52.26%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTN------EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +T     KPF C+ C   F  H HL RHER+H   +P+ C+ C   F +   LKRHQ THT       EKP+ CS C   F    HL RHQ+ HT  KPF C+EC   F   ++  RH  ++H   KP+SC+ C   F     L RHQ+ H  +K
Sbjct:  376 QTTHTGEKPFSCSECGKCFLNHSHLARHERTHTGEKPFSCSECGKCFANQSDLKRHQLTHTGKKSFSWEKPFSCSECGKCFLSHSHLARHQRTHTGEKPFSCSECGKCFSIEYYRDRHQ-RIHTGEKPFSCSECGKCFSKQSDLVRHQRTHTGEK 529          

HSP 9 Score: 84.7297 bits (208), Expect = 1.202e-16
Identity = 48/114 (42.11%), Postives = 61/114 (53.51%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +P+  + C   F +  HL  HQ THT EKP+ CS C   F    +L RHQ+ HT  KPF C+EC   F   +HLK HH + H   KP+SC  C   F     L RHQ+ H  +K
Sbjct:  132 KPFSSSNCGKCFLNHSHLACHQRTHTGEKPFSCSECGKCFAKQSNLARHQRTHTGEKPFSCSECGKCFSSKYHLKIHH-RNHTGEKPFSCK-CGKCFSKRSDLARHQRTHTGEK 243          

HSP 10 Score: 71.2478 bits (173), Expect = 2.437e-12
Identity = 39/102 (38.24%), Postives = 53/102 (51.96%), Query Frame = 2
Query:  833 RHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCA 1138
            +HQ TH ++KP+  S C   F +  HL  HQ+ HT  KPF C+EC   F    +L RH  + H   KP+SC+ C   F   +HLK H + H  +K     C 
Sbjct:  123 KHQRTHKSKKPFSSSNCGKCFLNHSHLACHQRTHTGEKPFSCSECGKCFAKQSNLARHQ-RTHTGEKPFSCSECGKCFSSKYHLKIHHRNHTGEKPFSCKCG 223          
BLAST of SMED30027210 vs. Ensembl Xenopus
Match: ENSXETT00000022840.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:1281142:1283479:1 gene:ENSXETG00000016699.1 transcript:ENSXETT00000022840.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 1.724e-25
Identity = 61/152 (40.13%), Postives = 82/152 (53.95%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    KP+ C  C  SF+    L +H  +H   +PY CT C   F     LK HQYTHT EKP++C+ C   F   + +KRHQ IHT +KPFQC EC  SF   +HL  HHL  H  +K + C  C  +F     L++H ++H  +K
Sbjct:  553 KAHQRIHTGEKPYTCAECGKSFTAQESLNQHSHTHTGIKPYACTECEKRFRKKADLKYHQYTHTGEKPFECTECGKCFPKKFAMKRHQFIHTGLKPFQCTECGKSFDTKYHLTAHHL-THTGIKAFVCTECGKQFVAKRSLRQHLKIHTGEK 703          

HSP 2 Score: 92.0485 bits (227), Expect = 6.066e-19
Identity = 54/150 (36.00%), Postives = 73/150 (48.67%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            +    KPF C  C+ +F     L  H+ +H   +P++C  C  SF+    LK HQ  HT EKPY C+ C  +F     L +H   HT IKP+ C EC+  F     LK +H   H   KP+ C  C   F   + +KRHQ +H   K  Q
Sbjct:  502 VHTGEKPFACTECNKTFRSVQGLHEHKLTHTGVKPFQCNECGKSFSAKGVLKAHQRIHTGEKPYTCAECGKSFTAQESLNQHSHTHTGIKPYACTECEKRFRKKADLK-YHQYTHTGEKPFECTECGKCFPKKFAMKRHQFIHTGLKPFQ 650          

HSP 3 Score: 90.8929 bits (224), Expect = 1.569e-18
Identity = 59/150 (39.33%), Postives = 79/150 (52.67%), Query Frame = 2
Query:  668 EKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            EKT + V K F+C  C   F+  +HLR+H+R H   +P+ C+ C  S+    +LK H   HT EKP+ C+ C   F+    L  H+  HT +KPFQC EC  SF    HLK H  + H   +PY+C  C   F     L RH   H+ KK
Sbjct:  276 EKTHTGV-KDFVCTECGKQFAHQNHLRQHQRIHTGEKPFVCSECGKSYTQKINLKIHLRIHTGEKPFACTECNKIFRSDRWLHAHKLTHTGVKPFQCKECDQSFLIKGHLKVHQ-RTHTGERPYTCPECGKSFITHLSLSRHYDSHIGKK 423          

HSP 4 Score: 88.9669 bits (219), Expect = 6.630e-18
Identity = 54/152 (35.53%), Postives = 72/152 (47.37%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KI   I    KPF C  C+  F     L  H+ +H   +P++C  C  SF    HLK HQ THT E+PY C  C  +F     L RH   H   KP+ C EC   F    +LK H  + H  +K + C  C  +F     L++HQ +H  +K
Sbjct:  329 KIHLRIHTGEKPFACTECNKIFRSDRWLHAHKLTHTGVKPFQCKECDQSFLIKGHLKVHQRTHTGERPYTCPECGKSFITHLSLSRHYDSHIGKKPYACTECGKCFLMKINLKSHE-KTHTGIKDFVCTECGKRFIQKHSLRQHQLIHTGEK 479          

HSP 5 Score: 88.5817 bits (218), Expect = 7.973e-18
Identity = 55/146 (37.67%), Postives = 74/146 (50.68%), Query Frame = 2
Query:  668 EKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            EKT + + K F+C  C   F + H LR+H+  H   +P+ C+ C  S+     LK H   HT EKP+ C+ C   F+    L  H+  HT +KPFQCNEC  SF     LK H  ++H   KPY+C  C   F     L +H   H
Sbjct:  444 EKTHTGI-KDFVCTECGKRFIQKHSLRQHQLIHTGEKPFACSECGKSYRLKIGLKAHLRVHTGEKPFACTECNKTFRSVQGLHEHKLTHTGVKPFQCNECGKSFSAKGVLKAHQ-RIHTGEKPYTCAECGKSFTAQESLNQHSHTH 587          

HSP 6 Score: 87.4261 bits (215), Expect = 1.986e-17
Identity = 54/155 (34.84%), Postives = 76/155 (49.03%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            ++ +      KP++C  C   FS    L  H   H   +P+ CT C   F    HLK H+ THT  K + C+ C   F    HL++HQ+IHT  KPF C+EC  S+    +LK  HL++H   KP++C  C+  F     L  H+  H   K  Q
Sbjct:  217 RVHERTHTGEKPYVCTQCGKGFSWKESLNTHSVIHSTEKPFTCTECGKCFRMKQHLKSHEKTHTGVKDFVCTECGKQFAHQNHLRQHQRIHTGEKPFVCSECGKSYTQKINLKI-HLRIHTGEKPFACTECNKIFRSDRWLHAHKLTHTGVKPFQ 370          

HSP 7 Score: 87.0409 bits (214), Expect = 2.517e-17
Identity = 45/114 (39.47%), Postives = 59/114 (51.75%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +P  CT C  SF    +L+ H+ THT EKPY C+ C   F     L  H  IH+  KPF C EC   F    HLK H  + H  VK + C  C  +F    HL++HQ++H  +K
Sbjct:  199 KPLTCTECGKSFKRKSYLRVHERTHTGEKPYVCTQCGKGFSWKESLNTHSVIHSTEKPFTCTECGKCFRMKQHLKSHE-KTHTGVKDFVCTECGKQFAHQNHLRQHQRIHTGEK 311          

HSP 8 Score: 83.9593 bits (206), Expect = 2.728e-16
Identity = 58/157 (36.94%), Postives = 77/157 (49.04%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            K+ +      +P+ C  C  SF  H  L RH  SH+  +PY CT C   F    +LK H+ THT  K + C+ C   F     L++HQ IHT  KPF C+EC  S+     LK  HL+VH   KP++C  C+  F     L  H+  H   K  Q N
Sbjct:  385 KVHQRTHTGERPYTCPECGKSFITHLSLSRHYDSHIGKKPYACTECGKCFLMKINLKSHEKTHTGIKDFVCTECGKRFIQKHSLRQHQLIHTGEKPFACSECGKSYRLKIGLKA-HLRVHTGEKPFACTECNKTFRSVQGLHEHKLTHTGVKPFQCN 540          

HSP 9 Score: 60.077 bits (144), Expect = 6.498e-9
Identity = 31/93 (33.33%), Postives = 46/93 (49.46%), Query Frame = 2
Query:  827 LKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
             +RHQ      KP  C+ C  +FK   +L+ H++ HT  KP+ C +C   F     L  H + +H   KP++C  C   F    HLK H++ H
Sbjct:  188 FQRHQGASAKGKPLTCTECGKSFKRKSYLRVHERTHTGEKPYVCTQCGKGFSWKESLNTHSV-IHSTEKPFTCTECGKCFRMKQHLKSHEKTH 279          

HSP 10 Score: 50.0618 bits (118), Expect = 8.737e-6
Identity = 39/142 (27.46%), Postives = 52/142 (36.62%), Query Frame = 2
Query:  779 PYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIH-----------------------------TKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            P+ C  C   F  + +L  HQ  HT E+P+ C+ C   F     L+ H++ H                              K KP  C EC  SF    +L R H + H   KPY C  C   F     L  H  +H  +K
Sbjct:  116 PFVCVKCKRRFGSNGNLLIHQRIHT-ERPFSCTDCGKCFSHRTILREHRRAHMGKGPFPHSTGGNKIPSGKGNFQRHQGASAKGKPLTCTECGKSFKRKSYL-RVHERTHTGEKPYVCTQCGKGFSWKESLNTHSVIHSTEK 255          
BLAST of SMED30027210 vs. Ensembl Xenopus
Match: nosip (nitric oxide synthase interacting protein [Source:Xenbase;Acc:XB-GENE-945889])

HSP 1 Score: 107.457 bits (267), Expect = 4.892e-25
Identity = 60/147 (40.82%), Postives = 76/147 (51.70%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C  C   FS    L  H++ H   +P+ CT C   F+DS  L RHQ  HT EKP+QC+ C     D     RH +IHT  KPF C EC   F DS +L  HH ++H   KP+SC  C  +F     L  HQ++H  +K
Sbjct:  112 IHTGEKPFSCTECGKEFSHRSSLHSHQKVHTGEKPFSCTECGKEFSDSSSLHRHQKIHTGEKPFQCTECGKKISDRSSFHRHLKIHTGEKPFSCTECGKEFSDSSNLHSHH-KIHTGEKPFSCTECGKEFAYKSRLHSHQKIHTGEK 257          

HSP 2 Score: 97.0561 bits (240), Expect = 1.468e-21
Identity = 54/148 (36.49%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKV 1120
            I    KPF C  C    S      RH + H   +P+ CT C   F+DS +L  H   HT EKP+ C+ C   F     L  HQ+IHT  K F C EC   F+D   L   HL++H   KP+SC  C  +F    HL  H ++H  + +
Sbjct:  168 IHTGEKPFQCTECGKKISDRSSFHRHLKIHTGEKPFSCTECGKEFSDSSNLHSHHKIHTGEKPFSCTECGKEFAYKSRLHSHQKIHTGEKSFSCTECGKEFFDRSSLNS-HLKIHTGEKPFSCTECGKEFAHKSHLHSHLKIHTGRNL 314          

HSP 3 Score: 94.3597 bits (233), Expect = 1.414e-20
Identity = 45/114 (39.47%), Postives = 58/114 (50.88%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +P+ CT C   F+   HL  HQ  HT EKP+ C+ C   F     L  HQ++HT  KPF C EC   F DS  L RH  ++H   KP+ C  C  K  D     RH ++H  +K
Sbjct:   89 KPFTCTECGKEFSQKSHLHSHQKIHTGEKPFSCTECGKEFSHRSSLHSHQKVHTGEKPFSCTECGKEFSDSSSLHRHQ-KIHTGEKPFQCTECGKKISDRSSFHRHLKIHTGEK 201          

HSP 4 Score: 81.2629 bits (199), Expect = 3.379e-16
Identity = 45/110 (40.91%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  797 CTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            CT S  D  H    Q   T +KP+ C+ C   F    HL  HQ+IHT  KPF C EC   F     L  H  +VH   KP+SC  C  +F DS  L RHQ++H  +K  Q
Sbjct:   72 CTESAKDPSH----QQLLTGDKPFTCTECGKEFSQKSHLHSHQKIHTGEKPFSCTECGKEFSHRSSLHSHQ-KVHTGEKPFSCTECGKEFSDSSSLHRHQKIHTGEKPFQ 176          
BLAST of SMED30027210 vs. Ensembl Xenopus
Match: synrg (synergin, gamma [Source:Xenbase;Acc:XB-GENE-993541])

HSP 1 Score: 111.309 bits (277), Expect = 5.399e-25
Identity = 60/147 (40.82%), Postives = 80/147 (54.42%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C  C   FS    L RH++ H   +P+ CT C   F+D   L RHQ  HT EKP+ C+ C   F    HL +HQ+IHT  KPF C EC+  F+D + L   HL++H   KP+SC  C  +F    +L RH ++H  +K
Sbjct:  364 IHTGEKPFFCTECGKEFSDRSSLHRHQKIHTGEKPFHCTECGKEFSDRSSLHRHQKIHTGEKPFSCTECGKEFSQESHLHKHQKIHTGEKPFSCTECRKEFFDRYSLHS-HLRIHTGEKPFSCTECGKEFSGRSNLHRHLKIHTGEK 509          

HSP 2 Score: 105.531 bits (262), Expect = 4.284e-23
Identity = 60/147 (40.82%), Postives = 76/147 (51.70%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C  C   FS+   L  H R H   +P+ CT C   F+   HL RHQ  HT EKP+ C+ C   F D  +L  H +IHT  KPF C EC   F D  +L   HL++H   KP+ C  C  +F    HL RHQ++H  +K
Sbjct:  196 IHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEKPFSCTECGKEFSDRSNLHSHLKIHTGEKPFSCTECGKEFSDRSNLHL-HLKIHTGEKPFHCTECGKEFSRQSHLDRHQKIHTGEK 341          

HSP 3 Score: 104.375 bits (259), Expect = 9.181e-23
Identity = 59/147 (40.14%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C  C   FS   +L  H + H   +P+ CT C   F+D  +L  H   HT EKP+ C+ C   F    HL RHQ+IHT  KPF C EC   F D W     HL++H   KP+ C  C  +F D   L RHQ++H  +K
Sbjct:  252 IHTGEKPFSCTECGKEFSDRSNLHSHLKIHTGEKPFSCTECGKEFSDRSNLHLHLKIHTGEKPFHCTECGKEFSRQSHLDRHQKIHTGEKPFHCTECGKEFSD-WTSHHSHLKIHTGEKPFFCTECGKEFSDRSSLHRHQKIHTGEK 397          

HSP 4 Score: 99.7525 bits (247), Expect = 2.939e-21
Identity = 61/147 (41.50%), Postives = 77/147 (52.38%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C  C   FSR  HL RH++ H   +P+ CT C   F+D      H   HT EKP+ C+ C   F D   L RHQ+IHT  KPF C EC   F D   L R H ++H   KP+SC  C  +F    HL +HQ++H  +K
Sbjct:  308 IHTGEKPFHCTECGKEFSRQSHLDRHQKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKPFFCTECGKEFSDRSSLHRHQKIHTGEKPFHCTECGKEFSDRSSLHR-HQKIHTGEKPFSCTECGKEFSQESHLHKHQKIHTGEK 453          

HSP 5 Score: 96.6709 bits (239), Expect = 2.985e-20
Identity = 57/147 (38.78%), Postives = 74/147 (50.34%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C  C   FS+   L  H++ H   +P+ CT C   F+    L  HQ  HT EKP+ C  C   F D   L  H +IHT  KPF C EC   F D  +L   HL++H   KP+SC  C  +F    HL+ HQ++H  +K
Sbjct:  560 IHTGEKPFSCTECGKEFSQKSSLHSHQKIHTGEKPFSCTECGKEFSQKSSLHSHQKNHTGEKPFSCIECGKEFFDRSSLHSHLKIHTGEKPFSCTECGKEFSDRSNLNS-HLKIHTGEKPFSCTECGKEFSRKSHLQSHQKIHTGEK 705          

HSP 6 Score: 92.8189 bits (229), Expect = 4.633e-19
Identity = 55/147 (37.41%), Postives = 73/147 (49.66%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C  C   FS   +L  H + H   +P+ CT C   F+   HL+ HQ  HT EK + C+ C         L+ HQ+IHT  K F C EC   F D   L R HL++H   KP+SC  C  +F    +L  HQ++H  +K
Sbjct:  644 IHTGEKPFSCTECGKEFSDRSNLNSHLKIHTGEKPFSCTECGKEFSRKSHLQSHQKIHTGEKSFSCTECGKKLSRKSSLQSHQKIHTGEKSFSCTECGKEFSDRSSLHR-HLKIHTGEKPFSCTECGQEFSRKSNLHSHQKIHTGEK 789          

HSP 7 Score: 90.5077 bits (223), Expect = 2.539e-18
Identity = 53/147 (36.05%), Postives = 70/147 (47.62%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C  C   F+    L  H++ H   +P+ CT C   F+    L  H   HT EKP+ C+ C   F     L  H +IHT  KPF C EC   F    HL R H ++H   KP+SC  C  +F D  +L  H ++H  +K
Sbjct:  140 IHTGEKPFSCTECGKEFAYKSRLHSHQKIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQESHLHR-HQKIHTGEKPFSCTECGKEFSDRSNLHSHLKIHTGEK 285          

HSP 8 Score: 88.9669 bits (219), Expect = 7.198e-18
Identity = 55/147 (37.41%), Postives = 74/147 (50.34%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C  C   FS+  HL +H++ H   +P+ CT C   F D + L  H   HT EKP+ C+ C   F    +L RH +IHT  KPF C EC   F    +L R HL++H   KP+ C  C  +F D      H ++H  +K
Sbjct:  420 IHTGEKPFSCTECGKEFSQESHLHKHQKIHTGEKPFSCTECRKEFFDRYSLHSHLRIHTGEKPFSCTECGKEFSGRSNLHRHLKIHTGEKPFSCTECGKEFSGRSNLHR-HLKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEK 565          

HSP 9 Score: 88.1965 bits (217), Expect = 1.351e-17
Identity = 55/147 (37.41%), Postives = 70/147 (47.62%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    K F C  C    SR   L+ H++ H   + + CT C   F+D   L RH   HT EKP+ C+ C   F    +L  HQ+IHT  KPF C EC   F     L  H  ++H   K +SC  C  KF    HL RH Q+H  +K
Sbjct:  700 IHTGEKSFSCTECGKKLSRKSSLQSHQKIHTGEKSFSCTECGKEFSDRSSLHRHLKIHTGEKPFSCTECGQEFSRKSNLHSHQKIHTGEKPFSCTECGKKFSRKSSLHSH-QKIHTGEKSFSCTECGKKFSRKSHLHRHLQIHTGEK 845          

HSP 10 Score: 82.8037 bits (203), Expect = 6.929e-16
Identity = 54/147 (36.73%), Postives = 69/147 (46.94%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF C  C   FS   +L RH + H   +P+ CT C   F+D      H   HT EKP+ C+ C   F     L  HQ+IHT  KPF C EC   F     L   H + H   KP+SC  C  +F+D   L  H ++H  +K
Sbjct:  504 IHTGEKPFSCTECGKEFSGRSNLHRHLKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKPFSCTECGKEFSQKSSLHSHQKIHTGEKPFSCTECGKEFSQKSSLHS-HQKNHTGEKPFSCIECGKEFFDRSSLHSHLKIHTGEK 649          

HSP 11 Score: 82.4185 bits (202), Expect = 7.693e-16
Identity = 51/127 (40.16%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCS 1057
            I    K F C  C   FS    L RH + H   +P+ CT C   F+   +L  HQ  HT EKP+ C+ C   F     L  HQ+IHT  K F C EC   F    HL R HLQ+H   KP+SC  C 
Sbjct:  728 IHTGEKSFSCTECGKEFSDRSSLHRHLKIHTGEKPFSCTECGQEFSRKSNLHSHQKIHTGEKPFSCTECGKKFSRKSSLHSHQKIHTGEKSFSCTECGKKFSRKSHLHR-HLQIHTGEKPFSCTECG 853          

HSP 12 Score: 80.8777 bits (198), Expect = 2.559e-15
Identity = 56/169 (33.14%), Postives = 69/169 (40.83%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH---------------------------HLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KPF C  C   FS    L  H R     +P+  T C   F D  +L  H   HT EKP+ C+ C   F     L  HQ+IHT  KPF C EC   F     L  H                           HL++H   KP+SC  C  +F    HL RHQ++H  +K
Sbjct:   89 KPFTCTECGKEFSDRSSLHSHHRIQTWEKPFSYTECGKEFFDRSNLNSHLKIHTGEKPFSCTECGKEFAYKSRLHSHQKIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEK 257          

HSP 13 Score: 65.855 bits (159), Expect = 1.345e-10
Identity = 40/107 (37.38%), Postives = 52/107 (48.60%), Query Frame = 2
Query:  797 CTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            CT S  D      HQ   T EKP+ C+ C   F D   L  H +I T  KPF   EC   F+D  +L   HL++H   KP+SC  C  +F     L  HQ++H  +K
Sbjct:   72 CTESAKDP----SHQQLLTGEKPFTCTECGKEFSDRSSLHSHHRIQTWEKPFSYTECGKEFFDRSNLNS-HLKIHTGEKPFSCTECGKEFAYKSRLHSHQKIHTGEK 173          
BLAST of SMED30027210 vs. Ensembl Mouse
Match: Gm14444 (predicted gene 14444 [Source:MGI Symbol;Acc:MGI:3652325])

HSP 1 Score: 114.39 bits (285), Expect = 7.053e-27
Identity = 61/152 (40.13%), Postives = 88/152 (57.89%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +I K      KP+ CN C  +F+    L++H+R+H   +PY+C  C  +F+ S HL+ H+ THT EKPY+C  C  AF  S HL  H++ HT+ KP++C +C  +F  S HL+  H + H   KPY C  C   F  S HL+ H+Q H  +K
Sbjct:  119 QIHKQTHTGEKPYECNQCGKAFAGSGDLQKHKRTHTGEKPYKCNQCGKAFSQSSHLRIHKRTHTGEKPYECKQCGKAFAHSSHLHIHERTHTREKPYECKQCGKAFSQSSHLQI-HKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGEK 269          

HSP 2 Score: 107.842 bits (268), Expect = 1.134e-24
Identity = 60/152 (39.47%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +I K      KP+ C  C  +F+   HL  HER+H   +PY C  C  +F+ S HL+ H+ THT EKPY+C  C  AF  S HL+ H+Q HT  KP++C +C   F  S  L++ H Q H   KPY C  C   F     L++H++ H  +K
Sbjct:  175 RIHKRTHTGEKPYECKQCGKAFAHSSHLHIHERTHTREKPYECKQCGKAFSQSSHLQIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGEKPYECKQCGKGFAGSGDLQK-HKQTHTGEKPYECKQCGKAFSRKSDLQKHKRTHTGEK 325          

HSP 3 Score: 95.9005 bits (237), Expect = 9.903e-21
Identity = 59/167 (35.33%), Postives = 87/167 (52.10%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVS 1162
            +I K      KP+ C  C  +F++  HLR H+++H   +PY C  C   F  S  L++H+ THT EKPY+C  C  AF     L++H++ HT  KP++C +C  +F  S  L+  H + H   KPY C  C   F  S  L+ H++ H  +   + N    P FE S
Sbjct:  231 QIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGEKPYECKQCGKGFAGSGDLQKHKQTHTGEKPYECKQCGKAFSRKSDLQKHKRTHTGEKPYECKQCGKAFAQSSTLQI-HKRTHTGEKPYECKQCGKAFAGSSGLQCHKRSHTGETPYECNQGGKP-FEGS 395          

HSP 4 Score: 92.8189 bits (229), Expect = 9.103e-20
Identity = 45/110 (40.91%), Postives = 63/110 (57.27%), Query Frame = 2
Query:  788 CTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            C  C  +F     ++ H+ THT EKPY+C+ C  AF  S  L++H++ HT  KP++CN+C  +F  S HL R H + H   KPY C  C   F  S HL  H++ H R+K
Sbjct:  105 CNQCGKAFKRRSDIQIHKQTHTGEKPYECNQCGKAFAGSGDLQKHKRTHTGEKPYKCNQCGKAFSQSSHL-RIHKRTHTGEKPYECKQCGKAFAHSSHLHIHERTHTREK 213          

HSP 5 Score: 85.5001 bits (210), Expect = 2.932e-17
Identity = 49/142 (34.51%), Postives = 74/142 (52.11%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLK 1087
            +I K      KP+ C  C   F+    L++H+++H   +PY C  C  +F+    L++H+ THT EKPY+C  C  AF  S  L+ H++ HT  KP++C +C  +F  S  L+ H  + H    PY CN     F  S  L+
Sbjct:  259 RIHKQTHTGEKPYECKQCGKGFAGSGDLQKHKQTHTGEKPYECKQCGKAFSRKSDLQKHKRTHTGEKPYECKQCGKAFAQSSTLQIHKRTHTGEKPYECKQCGKAFAGSSGLQCH-KRSHTGETPYECNQGGKPFEGSSGLE 399          

HSP 6 Score: 81.2629 bits (199), Expect = 5.981e-16
Identity = 41/107 (38.32%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  797 CTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            C  +F      +RHQ  HT EK + C+ C  AFK    ++ H+Q HT  KP++CN+C  +F  S  L++ H + H   KPY CN C   F  S HL+ H++ H  +K
Sbjct:   80 CGKAFAYESGSQRHQIKHTGEKHHDCNQCGKAFKRRSDIQIHKQTHTGEKPYECNQCGKAFAGSGDLQK-HKRTHTGEKPYKCNQCGKAFSQSSHLRIHKRTHTGEK 185          

HSP 7 Score: 76.2554 bits (186), Expect = 2.839e-14
Identity = 49/132 (37.12%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKF 1066
            K      KP+ C  C  +FSR   L++H+R+H   +PY C  C  +F  S  L+ H+ THT EKPY+C  C  AF  S  L+ H++ HT   P++CN+    F  S  L+ ++ +     KPY CN C   F
Sbjct:  290 KQTHTGEKPYECKQCGKAFSRKSDLQKHKRTHTGEKPYECKQCGKAFAQSSTLQIHKRTHTGEKPYECKQCGKAFAGSSGLQCHKRSHTGETPYECNQGGKPFEGSSGLE-YNNRTQTAEKPYECNQCGKVF 420          

HSP 8 Score: 51.2174 bits (121), Expect = 2.387e-6
Identity = 33/103 (32.04%), Postives = 49/103 (47.57%), Query Frame = 2
Query:  809 FNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            F +S    RH+ + + E+  +   C  AF      +RHQ  HT  K   CN+C  +F     ++ H  Q H   KPY CN C   F  S  L++H++ H  +K
Sbjct:   56 FQNSRSHGRHERSCSAEQLSEFIHCGKAFAYESGSQRHQIKHTGEKHHDCNQCGKAFKRRSDIQIH-KQTHTGEKPYECNQCGKAFAGSGDLQKHKRTHTGEK 157          
BLAST of SMED30027210 vs. Ensembl Mouse
Match: Gm7145 (predicted gene 7145 [Source:MGI Symbol;Acc:MGI:3648947])

HSP 1 Score: 112.849 bits (281), Expect = 9.748e-27
Identity = 69/162 (42.59%), Postives = 89/162 (54.94%), Query Frame = 2
Query:  632 KLSSLCNSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KLS L     K+ + +    KP+ CN C  SF     ++ H R H   +PY+C  C  SF  S HLK HQ  HT +KPY+C+ C  +F     LK HQ+IHT  KP++CN+C  SF  S HLK HH ++H   KPY CN C   F     LK HQ++H   K
Sbjct:  120 KLSRL-----KVHQRLHTGDKPYKCNECGKSFKHLSSVKIHHRLHTGYKPYKCNECGKSFTKSSHLKVHQRLHTGDKPYKCNECGKSFTRYSDLKVHQRIHTGYKPYKCNDCGKSFTKSSHLKVHH-RLHTGDKPYKCNECGKSFTQFSDLKVHQRIHTGDK 275          

HSP 2 Score: 95.1301 bits (235), Expect = 1.051e-20
Identity = 61/152 (40.13%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K+ + I    KP+ CN C  SF++  HL+ H R H   +PY+C  C  SF     LK HQ  HT +KP +C+ C  +F     LK HQ++HT  KP++CN+C  SF      K HH ++H   KPY CN C   F    +LK HQ++H   K
Sbjct:  209 KVHQRIHTGYKPYKCNDCGKSFTKSSHLKVHHRLHTGDKPYKCNECGKSFTQFSDLKVHQRIHTGDKPCKCNDCGKSFTKFSSLKVHQRLHTGDKPYKCNKCGKSFKHLSSAKIHH-RLHTGDKPYKCNECGKSFTQVSYLKVHQRIHTGDK 359          

HSP 3 Score: 93.5893 bits (231), Expect = 2.841e-20
Identity = 61/152 (40.13%), Postives = 82/152 (53.95%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K+ + +    KP+ CN C  SF+R+  L+ H+R H   +PY+C  C  SF  S HLK H   HT +KPY+C+ C  +F     LK HQ+IHT  KP +CN+C  SF     LK H  ++H   KPY CN C   F      K H ++H   K
Sbjct:  181 KVHQRLHTGDKPYKCNECGKSFTRYSDLKVHQRIHTGYKPYKCNDCGKSFTKSSHLKVHHRLHTGDKPYKCNECGKSFTQFSDLKVHQRIHTGDKPCKCNDCGKSFTKFSSLKVHQ-RLHTGDKPYKCNKCGKSFKHLSSAKIHHRLHTGDK 331          

HSP 4 Score: 93.2041 bits (230), Expect = 3.718e-20
Identity = 48/108 (44.44%), Postives = 62/108 (57.41%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            Y+C  C  SF     LK HQ  HT +KPY+C+ C  +FK    +K H ++HT  KP++CNEC  SF  S HLK H  ++H   KPY CN C   F     LK HQ++H
Sbjct:  109 YKCIECGKSFTKLSRLKVHQRLHTGDKPYKCNECGKSFKHLSSVKIHHRLHTGYKPYKCNECGKSFTKSSHLKVHQ-RLHTGDKPYKCNECGKSFTRYSDLKVHQRIH 215          

HSP 5 Score: 73.9442 bits (180), Expect = 1.095e-13
Identity = 48/125 (38.40%), Postives = 68/125 (54.40%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKP 1036
            K+   +    KP+ CN C  SF++   L+ H+R H   +P +C  C  SF     LK HQ  HT +KPY+C+ C  +FK     K H ++HT  KP++CNEC  SF    +LK H  ++H   KP
Sbjct:  237 KVHHRLHTGDKPYKCNECGKSFTQFSDLKVHQRIHTGDKPCKCNDCGKSFTKFSSLKVHQRLHTGDKPYKCNKCGKSFKHLSSAKIHHRLHTGDKPYKCNECGKSFTQVSYLKVHQ-RIHTGDKP 360          

HSP 6 Score: 70.8626 bits (172), Expect = 9.429e-13
Identity = 37/84 (44.05%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  866 YQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            Y+C  C  +F     LK HQ++HT  KP++CNEC  SF     +K HH ++H   KPY CN C   F  S HLK HQ++H   K
Sbjct:  109 YKCIECGKSFTKLSRLKVHQRLHTGDKPYKCNECGKSFKHLSSVKIHH-RLHTGYKPYKCNECGKSFTKSSHLKVHQRLHTGDK 191          
BLAST of SMED30027210 vs. Ensembl Mouse
Match: Gm14406 (predicted gene 14406 [Source:MGI Symbol;Acc:MGI:3649838])

HSP 1 Score: 113.62 bits (283), Expect = 1.058e-26
Identity = 61/152 (40.13%), Postives = 88/152 (57.89%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +I K      KP+ CN C  +F+    L++H+R+H   +PY+C  C  +F+ S HL+ H+ THT EKPY+C  C  AF  S HL  H++ HT+ KP++C +C  +F  S HL+  H + H   KPY C  C   F  S HL+ H+Q H  +K
Sbjct:  119 QIHKQTHTGEKPYECNQCGKAFAGSGDLQKHKRTHTGEKPYKCNQCGKAFSQSSHLQIHKRTHTGEKPYECKQCGKAFAHSSHLHIHERTHTREKPYECKQCGKAFSQSSHLQI-HKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGEK 269          

HSP 2 Score: 107.071 bits (266), Expect = 1.693e-24
Identity = 60/152 (39.47%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +I K      KP+ C  C  +F+   HL  HER+H   +PY C  C  +F+ S HL+ H+ THT EKPY+C  C  AF  S HL+ H+Q HT  KP++C +C   F  S  L++ H Q H   KPY C  C   F     L++H++ H  +K
Sbjct:  175 QIHKRTHTGEKPYECKQCGKAFAHSSHLHIHERTHTREKPYECKQCGKAFSQSSHLQIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGEKPYECKQCGKGFAGSGDLQK-HKQTHTGEKPYECKQCGKAFSRKSDLQKHKRTHTGEK 325          

HSP 3 Score: 95.9005 bits (237), Expect = 1.075e-20
Identity = 59/167 (35.33%), Postives = 87/167 (52.10%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVS 1162
            +I K      KP+ C  C  +F++  HLR H+++H   +PY C  C   F  S  L++H+ THT EKPY+C  C  AF     L++H++ HT  KP++C +C  +F  S  L+  H + H   KPY C  C   F  S  L+ H++ H  +   + N    P FE S
Sbjct:  231 QIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGEKPYECKQCGKGFAGSGDLQKHKQTHTGEKPYECKQCGKAFSRKSDLQKHKRTHTGEKPYECKQCGKAFAQSSTLQI-HKRTHTGEKPYECKQCGKAFAGSSGLQCHKRSHTGETPYECNQGGKP-FEGS 395          

HSP 4 Score: 91.6633 bits (226), Expect = 2.866e-19
Identity = 44/110 (40.00%), Postives = 63/110 (57.27%), Query Frame = 2
Query:  788 CTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            C  C  +F     ++ H+ THT EKPY+C+ C  AF  S  L++H++ HT  KP++CN+C  +F  S HL+  H + H   KPY C  C   F  S HL  H++ H R+K
Sbjct:  105 CNQCGKAFKRRSDIQIHKQTHTGEKPYECNQCGKAFAGSGDLQKHKRTHTGEKPYKCNQCGKAFSQSSHLQI-HKRTHTGEKPYECKQCGKAFAHSSHLHIHERTHTREK 213          

HSP 5 Score: 85.1149 bits (209), Expect = 3.123e-17
Identity = 49/142 (34.51%), Postives = 74/142 (52.11%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLK 1087
            +I K      KP+ C  C   F+    L++H+++H   +PY C  C  +F+    L++H+ THT EKPY+C  C  AF  S  L+ H++ HT  KP++C +C  +F  S  L+ H  + H    PY CN     F  S  L+
Sbjct:  259 RIHKQTHTGEKPYECKQCGKGFAGSGDLQKHKQTHTGEKPYECKQCGKAFSRKSDLQKHKRTHTGEKPYECKQCGKAFAQSSTLQIHKRTHTGEKPYECKQCGKAFAGSSGLQCH-KRSHTGETPYECNQGGKPFEGSSGLE 399          

HSP 6 Score: 80.8777 bits (198), Expect = 8.413e-16
Identity = 41/107 (38.32%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  797 CTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            C  +F      +RHQ  HT EK + C+ C  AFK    ++ H+Q HT  KP++CN+C  +F  S  L++ H + H   KPY CN C   F  S HL+ H++ H  +K
Sbjct:   80 CGKAFAYESGSQRHQIKHTGEKHHDCNQCGKAFKRRSDIQIHKQTHTGEKPYECNQCGKAFAGSGDLQK-HKRTHTGEKPYKCNQCGKAFSQSSHLQIHKRTHTGEK 185          

HSP 7 Score: 75.8702 bits (185), Expect = 3.050e-14
Identity = 49/132 (37.12%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKF 1066
            K      KP+ C  C  +FSR   L++H+R+H   +PY C  C  +F  S  L+ H+ THT EKPY+C  C  AF  S  L+ H++ HT   P++CN+    F  S  L+ ++ +     KPY CN C   F
Sbjct:  290 KQTHTGEKPYECKQCGKAFSRKSDLQKHKRTHTGEKPYECKQCGKAFAQSSTLQIHKRTHTGEKPYECKQCGKAFAGSSGLQCHKRSHTGETPYECNQGGKPFEGSSGLE-YNNRTQTAEKPYECNQCGKVF 420          

HSP 8 Score: 51.2174 bits (121), Expect = 2.472e-6
Identity = 33/103 (32.04%), Postives = 49/103 (47.57%), Query Frame = 2
Query:  809 FNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            F +S    RH+ + + E+  +   C  AF      +RHQ  HT  K   CN+C  +F     ++ H  Q H   KPY CN C   F  S  L++H++ H  +K
Sbjct:   56 FQNSRSHGRHERSCSAEQLSEFIHCGKAFAYESGSQRHQIKHTGEKHHDCNQCGKAFKRRSDIQIH-KQTHTGEKPYECNQCGKAFAGSGDLQKHKRTHTGEK 157          
BLAST of SMED30027210 vs. Ensembl Mouse
Match: Zfp454 (zinc finger protein 454 [Source:MGI Symbol;Acc:MGI:2679253])

HSP 1 Score: 114.005 bits (284), Expect = 2.515e-26
Identity = 60/147 (40.82%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CN C  +F  +  L  H+R H   +PY+C  C  +F D+    RH+  HT EKPY+C LC  AF+D   L +HQ+ HT  KP+ CN C+ +F D   L +H  ++H + KPY C +C   F  S HL +HQ++H  +K
Sbjct:  363 IHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYQCIECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRTHTGEKPYTCNICEKAFSDHSALTQHK-RIHTREKPYKCKTCGKAFIRSTHLIQHQRIHTGEK 508          

HSP 2 Score: 111.694 bits (278), Expect = 1.500e-25
Identity = 61/156 (39.10%), Postives = 87/156 (55.77%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            NS+    + I    KP+ C  C  +F  +    RH + H   +PYRC LC  +F D   L +HQ THT EKPY C++C  AF D   L +H++IHT+ KP++C  C  +F  S HL +H  ++H   KPY CN+C   F  + +L +HQ+ H   K
Sbjct:  382 NSSLTEHQRIHTGEKPYQCIECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRTHTGEKPYTCNICEKAFSDHSALTQHKRIHTREKPYKCKTCGKAFIRSTHLIQHQ-RIHTGEKPYKCNTCGKAFNQTANLAQHQRHHTGGK 536          

HSP 3 Score: 106.686 bits (265), Expect = 5.374e-24
Identity = 59/143 (41.26%), Postives = 80/143 (55.94%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             KPF CNLC  +F    HL +H+  H   +PY+C  C  +FN S    +HQ  HT EKP++C+ C  AF+ +  L  HQ+IHT  KP+QC EC  +F D+    RH  ++H   KPY C  C   F D   L +HQ+ H  +K
Sbjct:  311 EKPFQCNLCDKAFVCRAHLTKHQHIHSGKKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYQCIECGKAFRDNSSFARHR-KIHTGEKPYRCGLCEKAFRDQSALAQHQRTHTGEK 452          

HSP 4 Score: 105.145 bits (261), Expect = 2.130e-23
Identity = 59/147 (40.14%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CN+C  +F R+ HL  H R H   +P++C LC  +F    HL +HQ+ H+ +KPY+C+ C  AF  S    +HQ+IHT  KPF+CNEC  +F  +  L  H  ++H   KPY C  C   F D+    RH+++H  +K
Sbjct:  279 IHTGEKPFECNVCGKAFIRNIHLSHHHRMHTGEKPFQCNLCDKAFVCRAHLTKHQHIHSGKKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQ-RIHTGEKPYQCIECGKAFRDNSSFARHRKIHTGEK 424          

HSP 5 Score: 104.375 bits (259), Expect = 3.503e-23
Identity = 52/117 (44.44%), Postives = 66/117 (56.41%), Query Frame = 2
Query:  767 LNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +  + Y+C  C  +F+ S HL  HQ  HT EKPYQC  C  AF  S  L  HQ+IHT  KPF+CN C  +F  + HL  HH ++H   KP+ CN C   F    HL +HQ +H  KK
Sbjct:  225 MKEKRYKCRECGKAFHQSTHLIHHQRVHTGEKPYQCKDCGKAFSVSSSLSYHQKIHTGEKPFECNVCGKAFIRNIHLSHHH-RMHTGEKPFQCNLCDKAFVCRAHLTKHQHIHSGKK 340          

HSP 6 Score: 100.523 bits (249), Expect = 5.837e-22
Identity = 55/150 (36.67%), Postives = 80/150 (53.33%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            +    KP+ C  C  +FS    L  H++ H   +P+ C +C  +F  + HL  H   HT EKP+QC+LC  AF    HL +HQ IH+  KP++CNEC  +F  S    +H  ++H   KP+ CN C   F  +  L  HQ++H  +K  Q
Sbjct:  251 VHTGEKPYQCKDCGKAFSVSSSLSYHQKIHTGEKPFECNVCGKAFIRNIHLSHHHRMHTGEKPFQCNLCDKAFVCRAHLTKHQHIHSGKKPYKCNECGKAFNQSTSFLQHQ-RIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYQ 399          

HSP 7 Score: 96.6709 bits (239), Expect = 1.137e-20
Identity = 48/121 (39.67%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
              +PY+C  C  +F+ S  L  HQ  HT EKP++C++C  AF  + HL  H ++HT  KPFQCN C  +F    HL +H   +H   KPY CN C   F  S    +HQ++H  +K  + N
Sbjct:  254 GEKPYQCKDCGKAFSVSSSLSYHQKIHTGEKPFECNVCGKAFIRNIHLSHHHRMHTGEKPFQCNLCDKAFVCRAHLTKHQ-HIHSGKKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECN 373          

HSP 8 Score: 84.7297 bits (208), Expect = 6.654e-17
Identity = 47/128 (36.72%), Postives = 66/128 (51.56%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTN-----------EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            + C+ C  +F+ S  LK+HQ  HT            EK Y+C  C  AF  S HL  HQ++HT  KP+QC +C  +F  S  L  +H ++H   KP+ CN C   F  + HL  H ++H  +K  Q N
Sbjct:  191 FECSECGKAFSKSSTLKKHQKLHTEKLNPSQKSPMKEKRYKCRECGKAFHQSTHLIHHQRVHTGEKPYQCKDCGKAFSVSSSLS-YHQKIHTGEKPFECNVCGKAFIRNIHLSHHHRMHTGEKPFQCN 317          

HSP 9 Score: 66.6254 bits (161), Expect = 3.631e-11
Identity = 39/109 (35.78%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  839 QYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT-----------KIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            Q +  ++  ++CS C  AF  S  LK+HQ++HT           K K ++C EC  +F+ S HL  HH +VH   KPY C  C   F  S  L  HQ++H  +K  + N
Sbjct:  182 QRSQASKTAFECSECGKAFSKSSTLKKHQKLHTEKLNPSQKSPMKEKRYKCRECGKAFHQSTHLI-HHQRVHTGEKPYQCKDCGKAFSVSSSLSYHQKIHTGEKPFECN 289          
BLAST of SMED30027210 vs. Ensembl Mouse
Match: Zfp454 (zinc finger protein 454 [Source:MGI Symbol;Acc:MGI:2679253])

HSP 1 Score: 114.005 bits (284), Expect = 2.515e-26
Identity = 60/147 (40.82%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CN C  +F  +  L  H+R H   +PY+C  C  +F D+    RH+  HT EKPY+C LC  AF+D   L +HQ+ HT  KP+ CN C+ +F D   L +H  ++H + KPY C +C   F  S HL +HQ++H  +K
Sbjct:  363 IHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYQCIECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRTHTGEKPYTCNICEKAFSDHSALTQHK-RIHTREKPYKCKTCGKAFIRSTHLIQHQRIHTGEK 508          

HSP 2 Score: 111.694 bits (278), Expect = 1.500e-25
Identity = 61/156 (39.10%), Postives = 87/156 (55.77%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            NS+    + I    KP+ C  C  +F  +    RH + H   +PYRC LC  +F D   L +HQ THT EKPY C++C  AF D   L +H++IHT+ KP++C  C  +F  S HL +H  ++H   KPY CN+C   F  + +L +HQ+ H   K
Sbjct:  382 NSSLTEHQRIHTGEKPYQCIECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRTHTGEKPYTCNICEKAFSDHSALTQHKRIHTREKPYKCKTCGKAFIRSTHLIQHQ-RIHTGEKPYKCNTCGKAFNQTANLAQHQRHHTGGK 536          

HSP 3 Score: 106.686 bits (265), Expect = 5.374e-24
Identity = 59/143 (41.26%), Postives = 80/143 (55.94%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             KPF CNLC  +F    HL +H+  H   +PY+C  C  +FN S    +HQ  HT EKP++C+ C  AF+ +  L  HQ+IHT  KP+QC EC  +F D+    RH  ++H   KPY C  C   F D   L +HQ+ H  +K
Sbjct:  311 EKPFQCNLCDKAFVCRAHLTKHQHIHSGKKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYQCIECGKAFRDNSSFARHR-KIHTGEKPYRCGLCEKAFRDQSALAQHQRTHTGEK 452          

HSP 4 Score: 105.145 bits (261), Expect = 2.130e-23
Identity = 59/147 (40.14%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CN+C  +F R+ HL  H R H   +P++C LC  +F    HL +HQ+ H+ +KPY+C+ C  AF  S    +HQ+IHT  KPF+CNEC  +F  +  L  H  ++H   KPY C  C   F D+    RH+++H  +K
Sbjct:  279 IHTGEKPFECNVCGKAFIRNIHLSHHHRMHTGEKPFQCNLCDKAFVCRAHLTKHQHIHSGKKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQ-RIHTGEKPYQCIECGKAFRDNSSFARHRKIHTGEK 424          

HSP 5 Score: 104.375 bits (259), Expect = 3.503e-23
Identity = 52/117 (44.44%), Postives = 66/117 (56.41%), Query Frame = 2
Query:  767 LNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +  + Y+C  C  +F+ S HL  HQ  HT EKPYQC  C  AF  S  L  HQ+IHT  KPF+CN C  +F  + HL  HH ++H   KP+ CN C   F    HL +HQ +H  KK
Sbjct:  225 MKEKRYKCRECGKAFHQSTHLIHHQRVHTGEKPYQCKDCGKAFSVSSSLSYHQKIHTGEKPFECNVCGKAFIRNIHLSHHH-RMHTGEKPFQCNLCDKAFVCRAHLTKHQHIHSGKK 340          

HSP 6 Score: 100.523 bits (249), Expect = 5.837e-22
Identity = 55/150 (36.67%), Postives = 80/150 (53.33%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            +    KP+ C  C  +FS    L  H++ H   +P+ C +C  +F  + HL  H   HT EKP+QC+LC  AF    HL +HQ IH+  KP++CNEC  +F  S    +H  ++H   KP+ CN C   F  +  L  HQ++H  +K  Q
Sbjct:  251 VHTGEKPYQCKDCGKAFSVSSSLSYHQKIHTGEKPFECNVCGKAFIRNIHLSHHHRMHTGEKPFQCNLCDKAFVCRAHLTKHQHIHSGKKPYKCNECGKAFNQSTSFLQHQ-RIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYQ 399          

HSP 7 Score: 96.6709 bits (239), Expect = 1.137e-20
Identity = 48/121 (39.67%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
              +PY+C  C  +F+ S  L  HQ  HT EKP++C++C  AF  + HL  H ++HT  KPFQCN C  +F    HL +H   +H   KPY CN C   F  S    +HQ++H  +K  + N
Sbjct:  254 GEKPYQCKDCGKAFSVSSSLSYHQKIHTGEKPFECNVCGKAFIRNIHLSHHHRMHTGEKPFQCNLCDKAFVCRAHLTKHQ-HIHSGKKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECN 373          

HSP 8 Score: 84.7297 bits (208), Expect = 6.654e-17
Identity = 47/128 (36.72%), Postives = 66/128 (51.56%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTN-----------EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            + C+ C  +F+ S  LK+HQ  HT            EK Y+C  C  AF  S HL  HQ++HT  KP+QC +C  +F  S  L  +H ++H   KP+ CN C   F  + HL  H ++H  +K  Q N
Sbjct:  191 FECSECGKAFSKSSTLKKHQKLHTEKLNPSQKSPMKEKRYKCRECGKAFHQSTHLIHHQRVHTGEKPYQCKDCGKAFSVSSSLS-YHQKIHTGEKPFECNVCGKAFIRNIHLSHHHRMHTGEKPFQCN 317          

HSP 9 Score: 66.6254 bits (161), Expect = 3.631e-11
Identity = 39/109 (35.78%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  839 QYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT-----------KIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            Q +  ++  ++CS C  AF  S  LK+HQ++HT           K K ++C EC  +F+ S HL  HH +VH   KPY C  C   F  S  L  HQ++H  +K  + N
Sbjct:  182 QRSQASKTAFECSECGKAFSKSSTLKKHQKLHTEKLNPSQKSPMKEKRYKCRECGKAFHQSTHLI-HHQRVHTGEKPYQCKDCGKAFSVSSSLSYHQKIHTGEKPFECN 289          
BLAST of SMED30027210 vs. UniProt/SwissProt
Match: sp|Q08DG8|ZN135_BOVIN (Zinc finger protein 135 OS=Bos taurus OX=9913 GN=ZNF135 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.876e-26
Identity = 65/149 (43.62%), Postives = 87/149 (58.39%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            + I    KP+ CN C  +FS    L +HER+H   +PY C+ C  +F  S HL +HQ THT EKPY+CS C  AF  S  L +HQ+IHT  KP++CNEC  +F     L +H  ++H   KPY CN C   F  S  L  HQ++H ++K
Sbjct:  428 RRIHTGEKPYGCNECGKAFSHSSSLSQHERTHTGEKPYACSQCGKAFRQSTHLTQHQRTHTGEKPYECSDCGKAFSHSSSLTKHQRIHTGEKPYECNECGKAFSQLAPLIQHQ-RIHTGEKPYECNQCGRAFSQSSLLIEHQRIHTKEK 575          

HSP 2 Score: 105.916 bits (263), Expect = 1.180e-22
Identity = 58/147 (39.46%), Postives = 83/147 (56.46%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    +P+ C+ C  +FS+   L  H R H   +PY C  C  +F+ S  L +H+ THT EKPY CS C  AF+ S HL +HQ+ HT  KP++C++C  +F  S  L +H  ++H   KPY CN C   F     L +HQ++H  +K
Sbjct:  402 IHTGERPYECSECGRAFSQSTLLTEHRRIHTGEKPYGCNECGKAFSHSSSLSQHERTHTGEKPYACSQCGKAFRQSTHLTQHQRTHTGEKPYECSDCGKAFSHSSSLTKHQ-RIHTGEKPYECNECGKAFSQLAPLIQHQRIHTGEK 547          

HSP 3 Score: 101.293 bits (251), Expect = 4.121e-21
Identity = 56/147 (38.10%), Postives = 81/147 (55.10%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C  C  +F++   L +H+R H   RPY C+ C  +F+ S  L  H+  HT EKPY C+ C  AF  S  L +H++ HT  KP+ C++C  +F  S HL +H  + H   KPY C+ C   F  S  L +HQ++H  +K
Sbjct:  374 IHTGEKPYECQACGKAFTQITPLIQHQRIHTGERPYECSECGRAFSQSTLLTEHRRIHTGEKPYGCNECGKAFSHSSSLSQHERTHTGEKPYACSQCGKAFRQSTHLTQHQ-RTHTGEKPYECSDCGKAFSHSSSLTKHQRIHTGEK 519          

HSP 4 Score: 100.523 bits (249), Expect = 6.146e-21
Identity = 56/143 (39.16%), Postives = 80/143 (55.94%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             KP+ C+ C  +F +  HL +H R H   +PY+C  C  +F+ S  L +HQ  HT EKPY+C  C  AF     L +HQ+IHT  +P++C+EC  +F  S  L  H  ++H   KPY CN C   F  S  L +H++ H  +K
Sbjct:  322 EKPYTCSQCGKAFRQSIHLTQHLRIHTGEKPYQCGECGKAFSHSSSLTKHQRIHTGEKPYECQACGKAFTQITPLIQHQRIHTGERPYECSECGRAFSQSTLLTEHR-RIHTGEKPYGCNECGKAFSHSSSLSQHERTHTGEK 463          

HSP 5 Score: 99.3673 bits (246), Expect = 1.454e-20
Identity = 57/147 (38.78%), Postives = 83/147 (56.46%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C  C  +F++   L +H+R+H   +PY C+ C  SF+      +H+ THT EKPY CS C  AF+ S HL +H +IHT  KP+QC EC  +F  S  L +H  ++H   KPY C +C   F     L +HQ++H  ++
Sbjct:  262 IHTGEKPYKCAQCGRTFNQIAPLIQHQRTHTGEKPYECSECGKSFSFRSSFSQHERTHTGEKPYTCSQCGKAFRQSIHLTQHLRIHTGEKPYQCGECGKAFSHSSSLTKHQ-RIHTGEKPYECQACGKAFTQITPLIQHQRIHTGER 407          

HSP 6 Score: 96.2857 bits (238), Expect = 1.356e-19
Identity = 60/143 (41.96%), Postives = 79/143 (55.24%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             KP+ C+ C  +FS    L +H+R H   +PY C  C  +F+    L +HQ  HT EKPY+C+ C  AF  S  L  HQ+IHTK KP+ CNEC  SF  S  L +H  + H   KPY C  C   F    HL +HQ++H  +K
Sbjct:  490 EKPYECSDCGKAFSHSSSLTKHQRIHTGEKPYECNECGKAFSQLAPLIQHQRIHTGEKPYECNQCGRAFSQSSLLIEHQRIHTKEKPYGCNECGKSFSHSSSLSQHE-RTHTGEKPYDCQDCGKSFRQRTHLTQHQRIHTGEK 631          

HSP 7 Score: 93.9745 bits (232), Expect = 7.020e-19
Identity = 59/157 (37.58%), Postives = 82/157 (52.23%), Query Frame = 2
Query:  656 TNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            +N  +KT +   KP+ C  C  +FS    L  H R+H   RPY C  C   F +S  L +HQ  HT EKPY+C+ C   F     L +HQ+ HT  KP++C+EC  SF       +H  + H   KPY+C+ C   F  S HL +H ++H  +K  Q
Sbjct:  200 SNAQQKTCAK-EKPYGCQECGKAFSHSLALIEHHRTHTGERPYECPECGKGFRNSSALTKHQRIHTGEKPYKCAQCGRTFNQIAPLIQHQRTHTGEKPYECSECGKSFSFRSSFSQHE-RTHTGEKPYTCSQCGKAFRQSIHLTQHLRIHTGEKPYQ 354          

HSP 8 Score: 87.8113 bits (216), Expect = 7.232e-17
Identity = 55/143 (38.46%), Postives = 75/143 (52.45%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ CN C  +FS+   L +H+R H   +PY C  C  +F+ S  L  HQ  HT EKPY C+ C  +F  S  L +H++ HT  KP+ C +C  SF    HL +H  ++H   KPY C  C   F  S    +HQ+ H
Sbjct:  514 IHTGEKPYECNECGKAFSQLAPLIQHQRIHTGEKPYECNQCGRAFSQSSLLIEHQRIHTKEKPYGCNECGKSFSHSSSLSQHERTHTGEKPYDCQDCGKSFRQRTHLTQHQ-RIHTGEKPYECRDCGKAFTHSSSFIKHQRTH 655          

HSP 9 Score: 60.8474 bits (146), Expect = 2.118e-8
Identity = 39/87 (44.83%), Postives = 47/87 (54.02%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
            I    KP+ CN C  SFS    L +HER+H   +PY C  C  SF    HL +HQ  HT EKPY+C  C  AF  S    +HQ+ HT
Sbjct:  570 IHTKEKPYGCNECGKSFSHSSSLSQHERTHTGEKPYDCQDCGKSFRQRTHLTQHQRIHTGEKPYECRDCGKAFTHSSSFIKHQRTHT 656          
BLAST of SMED30027210 vs. UniProt/SwissProt
Match: sp|Q15937|ZNF79_HUMAN (Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 8.557e-26
Identity = 62/138 (44.93%), Postives = 82/138 (59.42%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C+ C  +FS      +H+R H   +PYRC  C  +F+ S +L  HQ THT EKPY+CS C  AF  S +L  HQ+ HT  KP++CNEC   F +S  L RHH+ +H   KPY CN C   F  S  L +HQ++H
Sbjct:  331 KPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHI-IHTGEKPYECNECGKAFNQSSSLSQHQRIH 467          

HSP 2 Score: 105.916 bits (263), Expect = 6.601e-23
Identity = 60/143 (41.96%), Postives = 84/143 (58.74%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C  C  +FS+  +L  H+R+H   +PY+C+ C  +F+ S +L  HQ THT EKPY+C+ C   F +S  L RH  IHT  KP++CNEC  +F  S  L +H  ++H  VKPY C+ C   F  S    RHQ++H
Sbjct:  354 IHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQ-RIHTGVKPYECSECGKAFRCSSAFVRHQRLH 495          

HSP 3 Score: 103.99 bits (258), Expect = 2.409e-22
Identity = 61/162 (37.65%), Postives = 96/162 (59.26%), Query Frame = 2
Query:  632 KLSSLCNSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  S C+S ++ +K+ +   KP+ C+ C  +FS+   L +H+R H   +PY+C+ C  +F+ + +L +HQ THT EKPY+CS C  AF D   L +HQ+IHT  KP++C++C  +F  S +L  H  + H   KPY C+ C   F       +HQ++H  +K
Sbjct:  200 KAFSYCSSLSQHQKSHTG-EKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQ-RTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEK 359          

HSP 4 Score: 98.5969 bits (244), Expect = 1.678e-20
Identity = 47/115 (40.87%), Postives = 68/115 (59.13%), Query Frame = 2
Query:  773 TRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             +PY C  C  +F+    L +HQ +HT EKPY+CS C  AF  S  L +HQ+IHT  KP++C+EC  +F  + +L +H  + H   KPY C+ C   F D   L +HQ++H  +K
Sbjct:  190 AKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQ-RTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEK 303          

HSP 5 Score: 97.8265 bits (242), Expect = 2.707e-20
Identity = 57/152 (37.50%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            I    KP+ C+ C  +F    +L  H+R+H   +PY+C+ C  +F+      +HQ  HT EKPY+C+ C  AF  S +L  HQ+ HT  KP++C+EC  +F  S +L  H  + H   KPY CN C   F +S  L RH  +H  +K  + N
Sbjct:  298 IHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQ-KTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECN 448          

HSP 6 Score: 96.2857 bits (238), Expect = 8.129e-20
Identity = 57/142 (40.14%), Postives = 78/142 (54.93%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C+ C  +FS    L +H+R H   +PY C+ C  +F  S +L  HQ THT EKPY+CS C  AF       +HQ+IHT  KP++C  C  +F  S +L  H  + H   KPY C+ C   F  S +L  HQ+ H  +K
Sbjct:  275 KPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQ-RTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEK 415          

HSP 7 Score: 60.8474 bits (146), Expect = 1.671e-8
Identity = 37/91 (40.66%), Postives = 46/91 (50.55%), Query Frame = 2
Query:  665 IEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
            I +      KP+ CN C   FS    L RH   H   +PY C  C  +FN S  L +HQ  HT  KPY+CS C  AF+ S    RHQ++H 
Sbjct:  406 IHQKTHTGEKPYKCNECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQRIHTGVKPYECSECGKAFRCSSAFVRHQRLHA 496          

HSP 8 Score: 57.7658 bits (138), Expect = 1.657e-7
Identity = 38/127 (29.92%), Postives = 57/127 (44.88%), Query Frame = 2
Query:  806 SFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLK-----------------------RHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            SFN    L   Q      +P +C   T +FK+S  LK                       +HQ+ HT  KP++C+EC  +F  S  L +H  ++H   KPY C+ C   F  + +L +HQ+ H  +K
Sbjct:  150 SFNLRPVLSPQQRVPVEARPRKCETHTESFKNSEILKPHRAKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQ-RIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEK 275          
BLAST of SMED30027210 vs. UniProt/SwissProt
Match: sp|Q8N9F8|ZN454_HUMAN (Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 1.692e-25
Identity = 61/147 (41.50%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CN C  +F  +  L  H+R H   +PY+C  C  +F D+    RH+  HT EKPY+C LC  AF+D   L +HQ+IHT  KP+ CN C+ +F D   L +H  ++H + KPY C  C   F  S HL +HQ++H  +K
Sbjct:  349 IHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRIHTGEKPYTCNICEKAFSDHSALTQHK-RIHTREKPYKCKICEKAFIRSTHLTQHQRIHTGEK 494          

HSP 2 Score: 112.079 bits (279), Expect = 6.013e-25
Identity = 61/156 (39.10%), Postives = 89/156 (57.05%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            NS+    + I    KP+ CN C  +F  +    RH + H   +PYRC LC  +F D   L +HQ  HT EKPY C++C  AF D   L +H++IHT+ KP++C  C+ +F  S HL +H  ++H   KPY CN C   F  + +L +HQ+ H+ +K
Sbjct:  368 NSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRIHTGEKPYTCNICEKAFSDHSALTQHKRIHTREKPYKCKICEKAFIRSTHLTQHQ-RIHTGEKPYKCNKCGKAFNQTANLIQHQRHHIGEK 522          

HSP 3 Score: 108.612 bits (270), Expect = 9.105e-24
Identity = 59/147 (40.14%), Postives = 83/147 (56.46%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CN+C  +F    HL +H+  H   +PY+C  C  +FN S    +HQ  HT EKP++C+ C  AF+ +  L  HQ+IHT  KP++CNEC  +F D+    RH  ++H   KPY C  C   F D   L +HQ++H  +K
Sbjct:  293 IHTGEKPFKCNICEKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHR-KIHTGEKPYRCGLCEKAFRDQSALAQHQRIHTGEK 438          

HSP 4 Score: 108.227 bits (269), Expect = 1.219e-23
Identity = 61/147 (41.50%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CNLC  +F R+ HL  H R H   +P++C +C  +F    HL +HQ  H+ EKPY+C+ C  AF  S    +HQ+IHT  KPF+CNEC  +F  +  L  H  ++H   KPY CN C   F D+    RH+++H  +K
Sbjct:  265 IHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEKPFKCNICEKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQ-RIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEK 410          

HSP 5 Score: 100.523 bits (249), Expect = 4.219e-21
Identity = 50/117 (42.74%), Postives = 65/117 (55.56%), Query Frame = 2
Query:  767 LNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +  + Y C  C  +F+ S HL  HQ  HT EKPY+C  C  AF  S  L  HQ+IHT  KPF+CN C  +F  + HL  HH ++H   KP+ CN C   F    HL +HQ +H  +K
Sbjct:  211 IKEKRYECRECGKAFHQSTHLIHHQRIHTGEKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECNLCGKAFIRNIHLAHHH-RIHTGEKPFKCNICEKAFVCRAHLTKHQNIHSGEK 326          

HSP 6 Score: 98.9821 bits (245), Expect = 1.360e-20
Identity = 54/147 (36.73%), Postives = 79/147 (53.74%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C  C  +FS    L  H++ H   +P+ C LC  +F  + HL  H   HT EKP++C++C  AF    HL +HQ IH+  KP++CNEC  +F  S    +H  ++H   KP+ CN C   F  +  L  HQ++H  +K
Sbjct:  237 IHTGEKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEKPFKCNICEKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQ-RIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEK 382          

HSP 7 Score: 79.337 bits (194), Expect = 2.581e-14
Identity = 44/122 (36.07%), Postives = 61/122 (50.00%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTN----------EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            + C+ C   F+ S  L +HQ  H            EK Y+C  C  AF  S HL  HQ+IHT  KP++C EC  +F  S  L  +H ++H   KP+ CN C   F  + HL  H ++H  +K
Sbjct:  178 FECSECGKVFSKSSTLNKHQKIHNEKNANQKIHIKEKRYECRECGKAFHQSTHLIHHQRIHTGEKPYECKECGKAFSVSSSLT-YHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEK 298          

HSP 8 Score: 65.855 bits (159), Expect = 4.814e-10
Identity = 42/131 (32.06%), Postives = 61/131 (46.56%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRH----------QQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            NT    C    S+ + S H  + Q    ++  ++CS C   F  S  L +H          Q+IH K K ++C EC  +F+ S HL  HH ++H   KPY C  C   F  S  L  HQ++H  +K  + N
Sbjct:  146 NTPSQECDESGSTMSSSLHSDQSQGFQPSKNAFECSECGKVFSKSSTLNKHQKIHNEKNANQKIHIKEKRYECRECGKAFHQSTHLI-HHQRIHTGEKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECN 275          
BLAST of SMED30027210 vs. UniProt/SwissProt
Match: sp|Q6ECI4|ZN470_HUMAN (Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3)

HSP 1 Score: 114.39 bits (285), Expect = 2.378e-25
Identity = 62/156 (39.74%), Postives = 86/156 (55.13%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             S+  + + I    KP+ CN+C  +FS    L  H+R H   +PY C  C  +F  S HL  HQ  HT EKPY+C  C+  F  + HL +HQ+IHT  KP++C EC  +F    HL +H  +VH   KPY C  C   F D  +L +HQ++H  K+
Sbjct:  437 GSSLTVHQRIHTGEKPYECNICEKAFSHRGSLTLHQRVHTGEKPYECKECGKAFRQSTHLAHHQRIHTGEKPYECKECSKTFSQNAHLAQHQKIHTGEKPYECKECGKAFSQIAHLVQHQ-RVHTGEKPYECIECGKAFSDGSYLVQHQRLHSGKR 591          

HSP 2 Score: 112.849 bits (281), Expect = 7.694e-25
Identity = 59/143 (41.26%), Postives = 81/143 (56.64%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             +P+ CN+C  +FS    L  H+R H   +PY C +C  +F+    L  HQ  HT EKPY+C  C  AF+ S HL  HQ+IHT  KP++C EC  +F  + HL +H  ++H   KPY C  C   F    HL +HQ+VH  +K
Sbjct:  422 ERPYKCNVCGKAFSHGSSLTVHQRIHTGEKPYECNICEKAFSHRGSLTLHQRVHTGEKPYECKECGKAFRQSTHLAHHQRIHTGEKPYECKECSKTFSQNAHLAQHQ-KIHTGEKPYECKECGKAFSQIAHLVQHQRVHTGEK 563          

HSP 3 Score: 103.605 bits (257), Expect = 6.459e-22
Identity = 60/156 (38.46%), Postives = 83/156 (53.21%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +S  K  K      K   CN C   FS+   L  H+R H   +PY C  C  +F+ S HL +HQ  HT EKP++C+ C  AF  + HL +HQ++HT  KP+QC +C  +F    HL +H  +VH   KPY C  C   F D   L  H+++H  K+
Sbjct:  212 HSVVKKHKQDRGEKKLLKCNDCEKIFSKISTLTLHQRIHTGEKPYECIECGKAFSQSAHLAQHQRIHTGEKPFECTECGKAFSQNAHLVQHQRVHTGEKPYQCKQCNKAFSQLAHLAQHQ-RVHTGEKPYECIECGKAFSDCSSLAHHRRIHTGKR 366          

HSP 4 Score: 98.2117 bits (243), Expect = 3.422e-20
Identity = 55/151 (36.42%), Postives = 82/151 (54.30%), Query Frame = 2
Query:  665 IEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            + + +    KP+ C  C  +F +  HL  H+R H   +PY C  C+ +F+ + HL +HQ  HT EKPY+C  C  AF    HL +HQ++HT  KP++C EC  +F D  +L +H  ++H   +PY C  C   F     L  HQ+ H  +K
Sbjct:  470 LHQRVHTGEKPYECKECGKAFRQSTHLAHHQRIHTGEKPYECKECSKTFSQNAHLAQHQKIHTGEKPYECKECGKAFSQIAHLVQHQRVHTGEKPYECIECGKAFSDGSYLVQHQ-RLHSGKRPYECLECGKAFRQRASLICHQRCHTGEK 619          

HSP 5 Score: 97.8265 bits (242), Expect = 4.961e-20
Identity = 56/143 (39.16%), Postives = 75/143 (52.45%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +    KP+ C  C  +FS   +L +H+R H   RPY C  C  +F     L  HQ  HT EKPY+C++C  AF     L  HQ+IHT  KP++C EC  +F    HL  H  ++H   +PY C  C   F  S HL  HQ++H
Sbjct:  558 VHTGEKPYECIECGKAFSDGSYLVQHQRLHSGKRPYECLECGKAFRQRASLICHQRCHTGEKPYECNVCGKAFSHRKSLTLHQRIHTGEKPYECKECSKAFSQVAHLTLHK-RIHTGERPYECKECGKAFRQSVHLAHHQRIH 699          

HSP 6 Score: 95.9005 bits (237), Expect = 1.985e-19
Identity = 55/143 (38.46%), Postives = 78/143 (54.55%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KPF C  C  +FS++ HL +H+R H   +PY+C  C  +F+   HL +HQ  HT EKPY+C  C  AF D   L  H++IHT  +P++C +C  +F  +  L RH    H   KP+ C  C   F D   L +H++ H
Sbjct:  277 IHTGEKPFECTECGKAFSQNAHLVQHQRVHTGEKPYQCKQCNKAFSQLAHLAQHQRVHTGEKPYECIECGKAFSDCSSLAHHRRIHTGKRPYECIDCGKAFRQNASLIRHRRYYHTGEKPFDCIDCGKAFTDHIGLIQHKRTH 419          

HSP 7 Score: 95.5153 bits (236), Expect = 3.005e-19
Identity = 46/116 (39.66%), Postives = 64/116 (55.17%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
              +P+ C  C  +F D   L +H+ THT E+PY+C++C  AF     L  HQ+IHT  KP++CN C+ +F     L  H  +VH   KPY C  C   F  S HL  HQ++H  +K
Sbjct:  393 GEKPFDCIDCGKAFTDHIGLIQHKRTHTGERPYKCNVCGKAFSHGSSLTVHQRIHTGEKPYECNICEKAFSHRGSLTLHQ-RVHTGEKPYECKECGKAFRQSTHLAHHQRIHTGEK 507          

HSP 8 Score: 90.5077 bits (223), Expect = 9.908e-18
Identity = 53/143 (37.06%), Postives = 77/143 (53.85%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C  C  +FS+  HL +H+R H   +PY C  C  +F+D  +L +HQ  H+ ++PY+C  C  AF+    L  HQ+ HT  KP++CN C  +F     L  H  ++H   KPY C  CS  F    HL  H+++H
Sbjct:  530 IHTGEKPYECKECGKAFSQIAHLVQHQRVHTGEKPYECIECGKAFSDGSYLVQHQRLHSGKRPYECLECGKAFRQRASLICHQRCHTGEKPYECNVCGKAFSHRKSLTLHQ-RIHTGEKPYECKECSKAFSQVAHLTLHKRIH 671          

HSP 9 Score: 85.5001 bits (210), Expect = 4.621e-16
Identity = 55/148 (37.16%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQ-YTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +    KP+ C  C  +FS    L  H R H   RPY C  C  +F  +  L RH+ Y HT EKP+ C  C  AF D   L +H++ HT  +P++CN C  +F     L  H  ++H   KPY CN C   F     L  HQ+VH  +K
Sbjct:  333 VHTGEKPYECIECGKAFSDCSSLAHHRRIHTGKRPYECIDCGKAFRQNASLIRHRRYYHTGEKPFDCIDCGKAFTDHIGLIQHKRTHTGERPYKCNVCGKAFSHGSSLTVHQ-RIHTGEKPYECNICEKAFSHRGSLTLHQRVHTGEK 479          

HSP 10 Score: 68.5514 bits (166), Expect = 8.694e-11
Identity = 36/100 (36.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  827 LKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            +K+H+     +K  +C+ C   F     L  HQ+IHT  KP++C EC  +F  S HL +H  ++H   KP+ C  C   F  + HL +HQ+VH  +K  Q
Sbjct:  215 VKKHKQDRGEKKLLKCNDCEKIFSKISTLTLHQRIHTGEKPYECIECGKAFSQSAHLAQHQ-RIHTGEKPFECTECGKAFSQNAHLVQHQRVHTGEKPYQ 313          

HSP 11 Score: 67.781 bits (164), Expect = 1.353e-10
Identity = 36/83 (43.37%), Postives = 49/83 (59.04%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
             KP+ CN+C  +FS    L  H+R H   +PY C  C+ +F+   HL  H+  HT E+PY+C  C  AF+ S HL  HQ+IHT
Sbjct:  618 EKPYECNVCGKAFSHRKSLTLHQRIHTGEKPYECKECSKAFSQVAHLTLHKRIHTGERPYECKECGKAFRQSVHLAHHQRIHT 700          
BLAST of SMED30027210 vs. UniProt/SwissProt
Match: sp|Q08ER8|ZN543_HUMAN (Zinc finger protein 543 OS=Homo sapiens OX=9606 GN=ZNF543 PE=1 SV=3)

HSP 1 Score: 112.849 bits (281), Expect = 5.607e-25
Identity = 62/147 (42.18%), Postives = 77/147 (52.38%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KPF CN C  +F     L +H   H   +PY+C  C  +FN   HLK+HQ  HT EKPY+CS C  AF        H++ HT  KP++C EC  +F D   L R H  +H   KPY C  C   F  S HL RHQQ+H  +K
Sbjct:  360 IHTGVKPFECNECGKAFCESADLIQHYIIHTGEKPYKCMECGKAFNRRSHLKQHQRIHTGEKPYECSECGKAFTHCSTFVLHKRTHTGEKPYECKECGKAFSDRADLIR-HFSIHTGEKPYECVECGKAFNRSSHLTRHQQIHTGEK 505          

HSP 2 Score: 107.457 bits (267), Expect = 3.367e-23
Identity = 59/147 (40.14%), Postives = 81/147 (55.10%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I +  KP+ C+ C  +F+       H RSH   +P+ C  C  +F D     RH   HT EKPY+C  C  AF    +L  HQQIHT +KPF+CNEC  +F +S  L +H++ +H   KPY C  C   F    HLK+HQ++H  +K
Sbjct:  276 IHSGEKPYKCSECGKAFTHRSTFVLHHRSHTGEKPFVCKECGKAFRDRPGFIRHYIIHTGEKPYECIECGKAFNRRSYLTWHQQIHTGVKPFECNECGKAFCESADLIQHYI-IHTGEKPYKCMECGKAFNRRSHLKQHQRIHTGEK 421          

HSP 3 Score: 105.531 bits (262), Expect = 1.330e-22
Identity = 58/143 (40.56%), Postives = 78/143 (54.55%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C+ C  +F+       H+R+H   +PY C  C  +F+D   L RH   HT EKPY+C  C  AF  S HL RHQQIHT  KP++C +C  +F  S +L RH + +H   KPY C+ C   F     L  HQ++H
Sbjct:  416 IHTGEKPYECSECGKAFTHCSTFVLHKRTHTGEKPYECKECGKAFSDRADLIRHFSIHTGEKPYECVECGKAFNRSSHLTRHQQIHTGEKPYECIQCGKAFCRSANLIRHSI-IHTGEKPYECSECGKAFNRGSSLTHHQRIH 557          

HSP 4 Score: 101.679 bits (252), Expect = 2.526e-21
Identity = 64/160 (40.00%), Postives = 86/160 (53.75%), Query Frame = 2
Query:  641 SLCNSTNKIEKTISNVS-KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            + C S + I+  I +   KP+ C  C  +F+R  HL++H+R H   +PY C+ C  +F        H+ THT EKPY+C  C  AF D   L RH  IHT  KP++C EC  +F  S HL RH  Q+H   KPY C  C   F  S +L RH  +H  +K
Sbjct:  375 AFCESADLIQHYIIHTGEKPYKCMECGKAFNRRSHLKQHQRIHTGEKPYECSECGKAFTHCSTFVLHKRTHTGEKPYECKECGKAFSDRADLIRHFSIHTGEKPYECVECGKAFNRSSHLTRHQ-QIHTGEKPYECIQCGKAFCRSANLIRHSIIHTGEK 533          

HSP 5 Score: 96.2857 bits (238), Expect = 1.194e-19
Identity = 59/152 (38.82%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQN 1132
            I    KP+ C  C  +FS+  HL +H   H   +PY+C  C  +FN   HL RHQ  H+ EKPY+CS C  AF        H + HT  KPF C EC  +F D     RH++ +H   KPY C  C   F    +L  HQQ+H   K  + N
Sbjct:  220 IHTQVKPYECTECGKTFSKSTHLLQHLIIHTGEKPYKCMECGKAFNRRSHLTRHQRIHSGEKPYKCSECGKAFTHRSTFVLHHRSHTGEKPFVCKECGKAFRDRPGFIRHYI-IHTGEKPYECIECGKAFNRRSYLTWHQQIHTGVKPFECN 370          

HSP 6 Score: 80.1073 bits (196), Expect = 1.891e-14
Identity = 48/145 (33.10%), Postives = 67/145 (46.21%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK-VIQQNCATTPNFEVSRNGFVS*IIINLPPPSY 1213
            Y+C  C   F  +  L +H+  HT  KPY+C+ C   F  S HL +H  IHT  KP++C EC  +F    HL RH  ++H   KPY C+ C   F        H + H  +K  + + C         R GF+   II+     Y
Sbjct:  199 YKCEECGKVFKKNALLVQHERIHTQVKPYECTECGKTFSKSTHLLQHLIIHTGEKPYKCMECGKAFNRRSHLTRHQ-RIHSGEKPYKCSECGKAFTHRSTFVLHHRSHTGEKPFVCKECGKAFR---DRPGFIRHYIIHTGEKPY 339          

HSP 7 Score: 60.8474 bits (146), Expect = 2.042e-8
Identity = 39/92 (42.39%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  674 TISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKP 949
            +I    KP+ C  C  +F+R  HL RH++ H   +PY C  C  +F  S +L RH   HT EKPY+CS C  AF     L  HQ+IHT   P
Sbjct:  471 SIHTGEKPYECVECGKAFNRSSHLTRHQQIHTGEKPYECIQCGKAFCRSANLIRHSIIHTGEKPYECSECGKAFNRGSSLTHHQRIHTGRNP 562          
BLAST of SMED30027210 vs. TrEMBL
Match: A0A444V1U0 (Zinc finger protein 3 OS=Acipenser ruthenus OX=7906 GN=EOD39_18077 PE=4 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 4.208e-31
Identity = 73/151 (48.34%), Postives = 98/151 (64.90%), Query Frame = 2
Query:  665 IEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             +K   N SKP+ C+ C  SFS+ H L  H+R H   + Y C+ C  SFNDS HLKRHQ  HT EKPY C+ C  +F+DS +LK+HQ+IHT  KP+ C+EC  SF  S +LK+ H ++H    PYSC+ C  +F  S +LK+HQQ+H  +K
Sbjct:   46 FKKHQQNTSKPYHCSDCGKSFSQSHSLVSHKRIHTGEKLYHCSDCGKSFNDSGHLKRHQRIHTGEKPYHCTYCGKSFRDSGNLKKHQRIHTGEKPYSCSECGKSFNHSGNLKK-HQRIHTGENPYSCSECGRRFSHSGNLKKHQQIHRGEK 195          

HSP 2 Score: 90.8929 bits (224), Expect = 5.469e-17
Identity = 54/125 (43.20%), Postives = 72/125 (57.60%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKP 1036
            K  + I    KP+ C  C  SF    +L++H+R H   +PY C+ C  SFN S +LK+HQ  HT E PY CS C   F  S +LK+HQQIH   KP+ C+EC   F  S +LK+ H ++H   KP
Sbjct:  101 KRHQRIHTGEKPYHCTYCGKSFRDSGNLKKHQRIHTGEKPYSCSECGKSFNHSGNLKKHQRIHTGENPYSCSECGRRFSHSGNLKKHQQIHRGEKPYSCSECGRRFSHSGNLKK-HQRIHRGEKP 224          
BLAST of SMED30027210 vs. TrEMBL
Match: H2YDD7 (Uncharacterized protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 4.443e-30
Identity = 73/147 (49.66%), Postives = 95/147 (64.63%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I  V KP+ CN+C  SF R   L+RH   H   +P++C LC  SF ++  LK+HQ  HT EKP++C +C  +FK+S +LKRHQ IHT  KP++CN CK SF ++ HLKRH + VH KVKPY C  C   F  +  LKRHQ VH + K
Sbjct:    7 IYTVEKPYKCNVCEKSFKRAGSLKRHRLIHTEEKPHKCDLCKKSFTEAGTLKKHQRIHTGEKPHKCDVCEKSFKESGNLKRHQMIHTGEKPYKCNACKKSFTEATHLKRHQM-VHTKVKPYKCTLCEKLFQQACDLKRHQMVHTKVK 152          

HSP 2 Score: 130.568 bits (327), Expect = 4.974e-28
Identity = 73/167 (43.71%), Postives = 98/167 (58.68%), Query Frame = 2
Query:  653 STNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNF 1153
             T K  + I    KP  C++C  SF    +L+RH+  H   +PY+C  C  SF ++ HLKRHQ  HT  KPY+C+LC   F+ +  LKRHQ +HTK+KP++C  C+ SF  +  LKRH + VH KVKPY CN C   F    HLK+HQ +H        +  TTPN+
Sbjct:   55 GTLKKHQRIHTGEKPHKCDVCEKSFKESGNLKRHQMIHTGEKPYKCNACKKSFTEATHLKRHQMVHTKVKPYKCTLCEKLFQQACDLKRHQMVHTKVKPYKCTVCEKSFQQACDLKRHQI-VHTKVKPYKCNVCEKLFQRPSHLKKHQMIHT-------SFETTPNY 213          

HSP 3 Score: 124.02 bits (310), Expect = 6.752e-26
Identity = 68/156 (43.59%), Postives = 95/156 (60.90%), Query Frame = 2
Query:  653 STNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKV 1120
             T K  + I + +KP  CN+C  SF +   L++H+  H   +PY+C +C  SFN +  LK+HQY HT EKPY+C +C  AF  S  LKRHQ+IHT +K ++C  C+ SF +   LKRH + +H   KP+ CN C   F  + HLKRHQ +H   K+
Sbjct:  741 GTLKRHQRIHSETKPNKCNVCERSFKQSSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQRIHTVVKSYKCTVCEKSFKEGGALKRHQM-IHTGEKPFKCNVCKKSFTQACHLKRHQIIHTVNKI 895          

HSP 4 Score: 118.627 bits (296), Expect = 4.560e-24
Identity = 66/152 (43.42%), Postives = 91/152 (59.87%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K+ + I    K + C +C   F+R  HL+RH+  H   +PY+CT+C  SF ++ +LK HQ  HT EKP++CS+C   F    +LK+HQ IHT+ KP++CN CK SF  + HLKR HL +H   KPY C  C   F      KRHQ +H  +K
Sbjct:  469 KMHQLIHTGEKSYKCTVCEKLFNRAGHLKRHQLVHTGEKPYKCTVCEKSFTEAGNLKVHQLVHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEKPYKCNVCKKSFKLAGHLKR-HLMIHAGEKPYKCMLCEKSFKKEGTFKRHQMIHTGEK 619          

HSP 5 Score: 117.087 bits (292), Expect = 1.158e-23
Identity = 68/170 (40.00%), Postives = 94/170 (55.29%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVH-----------------------VKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ CN C  SF+   HL+RH+  H   +PY+CTLC   F  +  LKRHQ  HT  KPY+C++C  +F+ +  LKRHQ +HTK+KP++CN C+  F    HLK+H + +H                       V+ KPY CN C   F  + +LKRHQ +H R+K
Sbjct:   91 IHTGEKPYKCNACKKSFTEATHLKRHQMVHTKVKPYKCTLCEKLFQQACDLKRHQMVHTKVKPYKCTVCEKSFQQACDLKRHQIVHTKVKPYKCNVCEKLFQRPSHLKKHQM-IHTSFETTPNYSHWKGTCVCKFFARVESKPYKCNICEKSFQQAGNLKRHQMIHTREK 259          

HSP 6 Score: 115.161 bits (287), Expect = 5.537e-23
Identity = 59/143 (41.26%), Postives = 90/143 (62.94%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            SKP+ C +C  SF +  +L+ H+++   ++PY+CT+C  SF  + +LK HQ  HT EK Y+C++C   F  + HLKRHQ +HT  KP++C  C+ SF ++ +LK H L VH   KP+ C+ C   F    +LK+HQ +H  +K
Sbjct:  422 SKPYKCTVCEKSFKQAGNLKMHQQTQAQSKPYKCTVCEKSFKQAGNLKMHQLIHTGEKSYKCTVCEKLFNRAGHLKRHQLVHTGEKPYKCTVCEKSFTEAGNLKVHQL-VHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEK 563          

HSP 7 Score: 109.768 bits (273), Expect = 2.583e-21
Identity = 60/157 (38.22%), Postives = 84/157 (53.50%), Query Frame = 2
Query:  647 CNSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            C S  K  + I   +KP+ C +C +        R        T+P +C +C  SF  S  LK+HQ  HT EKPY+C +C  +F  +  LK+HQ +HTK KP++C+ C  +F  S  LKRH  ++H  VK Y C  C   F +   LKRHQ +H  +K
Sbjct:  712 CASVLKAHQRIHTEAKPYKCTMCKSFKEAGTLKRHQRIHS-ETKPNKCNVCERSFKQSSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQ-RIHTVVKSYKCTVCEKSFKEGGALKRHQMIHTGEK 866          

HSP 8 Score: 104.375 bits (259), Expect = 1.734e-19
Identity = 55/129 (42.64%), Postives = 78/129 (60.47%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCN 1048
            K+ + +    KPF C++C  +FS   +L++H+  H   +PY+C +C  SF  + HLKRH   H  EKPY+C LC  +FK     KRHQ IHT  KP++CN C+ SF  + +LK H + +H   KPY CN
Sbjct:  525 KVHQLVHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEKPYKCNVCKKSFKLAGHLKRHLMIHAGEKPYKCMLCEKSFKKEGTFKRHQMIHTGEKPYKCNVCEKSFKQAGNLKTHQM-IHTGQKPYKCN 652          

HSP 9 Score: 98.2117 bits (243), Expect = 1.422e-17
Identity = 55/121 (45.45%), Postives = 76/121 (62.81%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHL 1012
            +ST K  + I    KP+ C++C  SF+R   L++H+  H   +PY+C +C  +F  S  LKRHQ  HT  K Y+C++C  +FK+   LKRHQ IHT  KPF+CN CK SF  + HLKRH +
Sbjct:  768 SSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQRIHTVVKSYKCTVCEKSFKEGGALKRHQMIHTGEKPFKCNVCKKSFTQACHLKRHQI 888          

HSP 10 Score: 96.2857 bits (238), Expect = 5.864e-17
Identity = 64/176 (36.36%), Postives = 86/176 (48.86%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFY------------------------DSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    KP+ CN+C  SF    HL+RH   H   +PY+C LC  SF      KRHQ  HT EKPY+C++C  +FK + +LK HQ IHT  KP++CN   +S+                          S HLK H  +   + +PY CN C   F  +  LK HQ++H   K
Sbjct:  553 KKHQMIHTEEKPYKCNVCKKSFKLAGHLKRHLMIHAGEKPYKCMLCEKSFKKEGTFKRHQMIHTGEKPYKCNVCEKSFKQAGNLKTHQMIHTGQKPYKCNVVPASYAVCKLPYPPPTQDRIIYKMSKNSRTVSVHLKTHQ-RTRAQSRPYKCNVCEKSFQCASVLKAHQRIHTEAK 727          

HSP 11 Score: 94.7449 bits (234), Expect = 1.871e-16
Identity = 55/143 (38.46%), Postives = 77/143 (53.85%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKI-----------------------KPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNS 1051
            KP+ C LC   F +   L+RH+  H   +PY+CT+C  SF  +  LKRHQ  HT  KPY+C++C   F+   HLK+HQ IHT                         KP++CN C+ SF  + +LKRH + +H + KPY CN+
Sbjct:  124 KPYKCTLCEKLFQQACDLKRHQMVHTKVKPYKCTVCEKSFQQACDLKRHQIVHTKVKPYKCNVCEKLFQRPSHLKKHQMIHTSFETTPNYSHWKGTCVCKFFARVESKPYKCNICEKSFQQAGNLKRHQM-IHTREKPYKCNA 265          

HSP 12 Score: 93.9745 bits (232), Expect = 3.310e-16
Identity = 45/97 (46.39%), Postives = 66/97 (68.04%), Query Frame = 2
Query:  827 LKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            LKRHQ  +T EKPY+C++C  +FK +  LKRH+ IHT+ KP +C+ CK SF ++  LK+H  ++H   KP+ C+ C   F +S +LKRHQ +H  +K
Sbjct:    1 LKRHQMIYTVEKPYKCNVCEKSFKRAGSLKRHRLIHTEEKPHKCDLCKKSFTEAGTLKKHQ-RIHTGEKPHKCDVCEKSFKESGNLKRHQMIHTGEK 96          

HSP 13 Score: 90.5077 bits (223), Expect = 4.356e-15
Identity = 64/188 (34.04%), Postives = 95/188 (50.53%), Query Frame = 2
Query:  644 LCNSTNKIEKT------ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSF------------------------NDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            LC  + K E T      I    KP+ CN+C  SF +  +L+ H+  H   +PY+C +  +S+                          S HLK HQ T    +PY+C++C  +F+ +  LK HQ+IHT+ KP++C  CK SF ++  LKRH  ++H + KP  CN C   F  S  LK+HQ +H  +K
Sbjct:  597 LCEKSFKKEGTFKRHQMIHTGEKPYKCNVCEKSFKQAGNLKTHQMIHTGQKPYKCNVVPASYAVCKLPYPPPTQDRIIYKMSKNSRTVSVHLKTHQRTRAQSRPYKCNVCEKSFQCASVLKAHQRIHTEAKPYKCTMCK-SFKEAGTLKRHQ-RIHSETKPNKCNVCERSFKQSSTLKKHQMIHTGEK 782          

HSP 14 Score: 84.3445 bits (207), Expect = 3.121e-13
Identity = 46/115 (40.00%), Postives = 63/115 (54.78%), Query Frame = 2
Query:  773 TRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +RP    L    F  S HL  +Q T    KPY+C++C  +FK + +LK HQQ   + KP++C  C+ SF  + +LK H L +H   K Y C  C   F  + HLKRHQ VH  +K
Sbjct:  394 SRPVASNLGWPLFTVSVHLNIYQQTQAQSKPYKCTVCEKSFKQAGNLKMHQQTQAQSKPYKCTVCEKSFKQAGNLKMHQL-IHTGEKSYKCTVCEKLFNRAGHLKRHQLVHTGEK 507          

HSP 15 Score: 72.4034 bits (176), Expect = 2.049e-9
Identity = 41/96 (42.71%), Postives = 61/96 (63.54%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
             ST K  + +    KP+ C++C  +F++   L+RH+R H   + Y+CT+C  SF +   LKRHQ  HT EKP++C++C  +F  + HLKRHQ IHT
Sbjct:  796 TSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQRIHTVVKSYKCTVCEKSFKEGGALKRHQMIHTGEKPFKCNVCKKSFTQACHLKRHQIIHT 891          
BLAST of SMED30027210 vs. TrEMBL
Match: H2YDE4 (Uncharacterized protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 5.200e-30
Identity = 73/147 (49.66%), Postives = 95/147 (64.63%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I  V KP+ CN+C  SF R   L+RH   H   +P++C LC  SF ++  LK+HQ  HT EKP++C +C  +FK+S +LKRHQ IHT  KP++CN CK SF ++ HLKRH + VH KVKPY C  C   F  +  LKRHQ VH + K
Sbjct:   29 IYTVEKPYKCNVCEKSFKRAGSLKRHRLIHTEEKPHKCDLCKKSFTEAGTLKKHQRIHTGEKPHKCDVCEKSFKESGNLKRHQMIHTGEKPYKCNACKKSFTEATHLKRHQM-VHTKVKPYKCTLCEKLFQQACDLKRHQMVHTKVK 174          

HSP 2 Score: 126.331 bits (316), Expect = 8.952e-27
Identity = 67/147 (45.58%), Postives = 92/147 (62.59%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ CN C  SF+   HL+RH+  H   +PY+CTLC   F  +  LKRHQ  HT  KPY+C++C  +F+ +  LKRHQ +HTK+KP++CN C+  F    HLK+H +   V+ KPY CN C   F  + +LKRHQ +H R+K
Sbjct:  113 IHTGEKPYKCNACKKSFTEATHLKRHQMVHTKVKPYKCTLCEKLFQQACDLKRHQMVHTKVKPYKCTVCEKSFQQACDLKRHQIVHTKVKPYKCNVCEKLFQRPSHLKKHQMIHTVESKPYKCNICEKSFQQAGNLKRHQMIHTREK 259          

HSP 3 Score: 117.087 bits (292), Expect = 1.003e-23
Identity = 66/152 (43.42%), Postives = 91/152 (59.87%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K+ + I    K + C +C   F+R  HL+RH+  H   +PY+CT+C  SF ++ +LK HQ  HT EKP++CS+C   F    +LK+HQ IHT+ KP++CN CK SF  + HLKR HL +H   KPY C  C   F      KRHQ +H  +K
Sbjct:  337 KMHQLIHTGEKSYKCTVCEKLFNRAGHLKRHQLVHTGEKPYKCTVCEKSFTEAGNLKVHQLVHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEKPYKCNVCKKSFKLAGHLKR-HLMIHAGEKPYKCMLCEKSFKKEGTFKRHQMIHTGEK 487          

HSP 4 Score: 110.923 bits (276), Expect = 1.070e-21
Identity = 57/141 (40.43%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  695 PFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            P+ C +C  SF +  +L+ H+++   ++PY+CT+C  SF  + +LK HQ  HT EK Y+C++C   F  + HLKRHQ +HT  KP++C  C+ SF ++ +LK H L VH   KP+ C+ C   F    +LK+HQ +H  +K
Sbjct:  292 PYKCTVCEKSFKQAGNLKMHQQTQAQSKPYKCTVCEKSFKQAGNLKMHQLIHTGEKSYKCTVCEKLFNRAGHLKRHQLVHTGEKPYKCTVCEKSFTEAGNLKVHQL-VHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEK 431          

HSP 5 Score: 108.997 bits (271), Expect = 4.011e-21
Identity = 52/116 (44.83%), Postives = 76/116 (65.52%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
              +PY+C +C  SF  S  LKRHQ  +T EKPY+C++C  +FK +  LKRH+ IHT+ KP +C+ CK SF ++  LK+H  ++H   KP+ C+ C   F +S +LKRHQ +H  +K
Sbjct:    4 QAKPYKCNVCEKSFQYSCELKRHQMIYTVEKPYKCNVCEKSFKRAGSLKRHRLIHTEEKPHKCDLCKKSFTEAGTLKKHQ-RIHTGEKPHKCDVCEKSFKESGNLKRHQMIHTGEK 118          

HSP 6 Score: 108.227 bits (269), Expect = 6.911e-21
Identity = 60/157 (38.22%), Postives = 84/157 (53.50%), Query Frame = 2
Query:  647 CNSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            C S  K  + I   +KP+ C +C +        R        T+P +C +C  SF  S  LK+HQ  HT EKPY+C +C  +F  +  LK+HQ +HTK KP++C+ C  +F  S  LKRH  ++H  VK Y C  C   F +   LKRHQ +H  +K
Sbjct:  558 CASVLKAHQRIHTEAKPYKCTMCKSFKEAGTLKRHQRIHS-ETKPNKCNVCERSFKQSSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQ-RIHTVVKSYKCTVCEKSFKEGGALKRHQMIHTGEK 712          

HSP 7 Score: 107.457 bits (267), Expect = 1.108e-20
Identity = 62/139 (44.60%), Postives = 88/139 (63.31%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            S+P+ CN+C  SF     L+ H+R H   +PY+CT+C  SF ++  LKRHQ  H+  KP +C++C  +FK S  LK+HQ IHT  KP++C+ C+ SF  +  LK+H   +H K KPY C+ C   F  S  LKRHQ++H
Sbjct:  544 SRPYKCNVCEKSFQCASVLKAHQRIHTEAKPYKCTMC-KSFKEAGTLKRHQRIHSETKPNKCNVCERSFKQSSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQY-LHTKEKPYKCHVCDKAFTQSCLLKRHQRIH 680          

HSP 8 Score: 105.916 bits (263), Expect = 3.559e-20
Identity = 59/134 (44.03%), Postives = 83/134 (61.94%), Query Frame = 2
Query:  653 STNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSC 1054
             T K  + I + +KP  CN+C  SF +   L++H+  H   +PY+C +C  SFN +  LK+HQY HT EKPY+C +C  AF  S  LKRHQ+IHT +K ++C  C+ SF +   LKRH + +H   KP+ CN C
Sbjct:  587 GTLKRHQRIHSETKPNKCNVCERSFKQSSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQRIHTVVKSYKCTVCEKSFKEGGALKRHQM-IHTGEKPFKCNVC 719          

HSP 9 Score: 103.219 bits (256), Expect = 2.560e-19
Identity = 64/181 (35.36%), Postives = 91/181 (50.28%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH-------------------------HLQVHVKV----KPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K+ + +    KPF C++C  +FS   +L++H+  H   +PY+C +C  SF  + HLKRH   H  EKPY+C LC  +FK     KRHQ IHT  KP++CN C+ SF  + +LK H                         HL+ H +     +PY CN C   F  +  LK HQ++H   K
Sbjct:  393 KVHQLVHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEKPYKCNVCKKSFKLAGHLKRHLMIHAGEKPYKCMLCEKSFKKEGTFKRHQMIHTGEKPYKCNVCEKSFKQAGNLKTHQMIHTGQKPYKFIYKMSKNSRTVSVHLKTHQRTRAQSRPYKCNVCEKSFQCASVLKAHQRIHTEAK 573          

HSP 10 Score: 100.138 bits (248), Expect = 2.477e-18
Identity = 54/147 (36.73%), Postives = 82/147 (55.78%), Query Frame = 2
Query:  692 KPFLCNLCXXX-XXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIK----PFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ CN+C        H  +      + ++PY+C +C  SF  + +LKRHQ  HT EKPY+C++C  +F    +LKRH+ IHT ++    P++C  C+ SF  + +LK H  Q   + KPY C  C   F  + +LK HQ +H  +K
Sbjct:  202 KPYKCNVCEKLFQRPSHLKKHQMIHTVESKPYKCNICEKSFQQAGNLKRHQMIHTREKPYKCNVCEKSFTRKSNLKRHEIIHTGMEPANFPYKCTVCEKSFKQAGNLKMHQ-QTQAQSKPYKCTVCEKSFKQAGNLKMHQLIHTGEK 347          

HSP 11 Score: 90.8929 bits (224), Expect = 2.454e-15
Identity = 61/177 (34.46%), Postives = 89/177 (50.28%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQ------------------------------CSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C LC  SF +    +RH+  H   +PY+C +C  SF  + +LK HQ  HT +KPY+                              C++C  +F+ +  LK HQ+IHT+ KP++C  CK SF ++  LKRH  ++H + KP  CN C   F  S  LK+HQ +H  +K
Sbjct:  454 IHAGEKPYKCMLCEKSFKKEGTFKRHQMIHTGEKPYKCNVCEKSFKQAGNLKTHQMIHTGQKPYKFIYKMSKNSRTVSVHLKTHQRTRAQSRPYKCNVCEKSFQCASVLKAHQRIHTEAKPYKCTMCK-SFKEAGTLKRHQ-RIHSETKPNKCNVCERSFKQSSTLKKHQMIHTGEK 628          

HSP 12 Score: 82.8037 bits (203), Expect = 9.938e-13
Identity = 48/107 (44.86%), Postives = 67/107 (62.62%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECK 970
            +ST K  + I    KP+ C++C  SF+R   L++H+  H   +PY+C +C  +F  S  LKRHQ  HT  K Y+C++C  +FK+   LKRHQ IHT  KPF+CN CK
Sbjct:  614 SSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQRIHTVVKSYKCTVCEKSFKEGGALKRHQMIHTGEKPFKCNVCK 720          

HSP 13 Score: 80.4925 bits (197), Expect = 4.199e-12
Identity = 39/91 (42.86%), Postives = 59/91 (64.84%), Query Frame = 2
Query:  845 THTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            T    KPY+C++C  +F+ S  LKRHQ I+T  KP++CN C+ SF  +  LKRH L +H + KP+ C+ C   F ++  LK+HQ++H  +K
Sbjct:    1 TQAQAKPYKCNVCEKSFQYSCELKRHQMIYTVEKPYKCNVCEKSFKRAGSLKRHRL-IHTEEKPHKCDLCKKSFTEAGTLKKHQRIHTGEK 90          
BLAST of SMED30027210 vs. TrEMBL
Match: H2YDE0 (Uncharacterized protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 5.513e-30
Identity = 73/147 (49.66%), Postives = 95/147 (64.63%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I  V KP+ CN+C  SF R   L+RH   H   +P++C LC  SF ++  LK+HQ  HT EKP++C +C  +FK+S +LKRHQ IHT  KP++CN CK SF ++ HLKRH + VH KVKPY C  C   F  +  LKRHQ VH + K
Sbjct:   44 IYTVEKPYKCNVCEKSFKRAGSLKRHRLIHTEEKPHKCDLCKKSFTEAGTLKKHQRIHTGEKPHKCDVCEKSFKESGNLKRHQMIHTGEKPYKCNACKKSFTEATHLKRHQM-VHTKVKPYKCTLCEKLFQQACDLKRHQMVHTKVK 189          

HSP 2 Score: 127.872 bits (320), Expect = 1.934e-27
Identity = 69/152 (45.39%), Postives = 95/152 (62.50%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    KP  C+LC  SF+    L++H+R H   +P++C +C  SF +S +LKRHQ  HT EKPY+C+ C  +F ++ HLKRHQ +HTK+KP++C  C+  F  +  LKRH + VH KVKPY C  C   F  +  LKRHQ VH + K
Sbjct:   67 KRHRLIHTEEKPHKCDLCKKSFTEAGTLKKHQRIHTGEKPHKCDVCEKSFKESGNLKRHQMIHTGEKPYKCNACKKSFTEATHLKRHQMVHTKVKPYKCTLCEKLFQQACDLKRHQM-VHTKVKPYKCTVCEKSFQQACDLKRHQIVHTKVK 217          

HSP 3 Score: 122.094 bits (305), Expect = 1.915e-25
Identity = 67/151 (44.37%), Postives = 93/151 (61.59%), Query Frame = 2
Query:  653 STNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
             T K  + I + +KP  CN+C  SF +   L++H+  H   +PY+C +C  SFN +  LK+HQY HT EKPY+C +C  AF  S  LKRHQ+IHT +K ++C  C+ SF +   LKRH + +H   KP+ CN C   F  + HLKRHQ +H
Sbjct:  480 GTLKRHQRIHSETKPNKCNVCERSFKQSSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQRIHTVVKSYKCTVCEKSFKEGGALKRHQM-IHTGEKPFKCNVCKKSFTQACHLKRHQIIH 629          

HSP 4 Score: 116.701 bits (291), Expect = 1.168e-23
Identity = 66/152 (43.42%), Postives = 91/152 (59.87%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K+ + I    K + C +C   F+R  HL+RH+  H   +PY+CT+C  SF ++ +LK HQ  HT EKP++CS+C   F    +LK+HQ IHT+ KP++CN CK SF  + HLKR HL +H   KPY C  C   F      KRHQ +H  +K
Sbjct:  264 KMHQLIHTGEKSYKCTVCEKLFNRAGHLKRHQLVHTGEKPYKCTVCEKSFTEAGNLKVHQLVHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEKPYKCNVCKKSFKLAGHLKR-HLMIHAGEKPYKCMLCEKSFKKEGTFKRHQMIHTGEK 414          

HSP 5 Score: 115.931 bits (289), Expect = 1.787e-23
Identity = 63/147 (42.86%), Postives = 88/147 (59.86%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ CN C  SF+   HL+RH+  H   +PY+CTLC   F  +  LKRHQ  HT  KPY+C++C  +F+ +  LKRHQ +HTK+KP++CN C+  F    HLK+H +    + KPY C  C   F  + +LK HQ +H  +K
Sbjct:  128 IHTGEKPYKCNACKKSFTEATHLKRHQMVHTKVKPYKCTLCEKLFQQACDLKRHQMVHTKVKPYKCTVCEKSFQQACDLKRHQIVHTKVKPYKCNVCEKLFQRPSHLKKHQMIHTAQSKPYKCTVCEKSFKQAGNLKMHQLIHTGEK 274          

HSP 6 Score: 110.538 bits (275), Expect = 1.206e-21
Identity = 64/171 (37.43%), Postives = 92/171 (53.80%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH-----------------------HLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            K+ + +    KPF C++C  +FS   +L++H+  H   +PY+C +C  SF  + HLKRH   H  EKPY+C LC  +FK     KRHQ IHT  KP++CN C+ SF  + +LK H                       H ++H + KPY C  C S F ++  LKRHQ++H
Sbjct:  320 KVHQLVHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEKPYKCNVCKKSFKLAGHLKRHLMIHAGEKPYKCMLCEKSFKKEGTFKRHQMIHTGEKPYKCNVCEKSFKQAGNLKTHQMIHTGQKPYKCNVCEKSFTRTTHQRIHTEAKPYKCTMCKS-FKEAGTLKRHQRIH 489          

HSP 7 Score: 108.612 bits (270), Expect = 5.071e-21
Identity = 52/116 (44.83%), Postives = 76/116 (65.52%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
              +PY+C +C  SF  S  LKRHQ  +T EKPY+C++C  +FK +  LKRH+ IHT+ KP +C+ CK SF ++  LK+H  ++H   KP+ C+ C   F +S +LKRHQ +H  +K
Sbjct:   19 QAKPYKCNVCEKSFQYSCELKRHQMIYTVEKPYKCNVCEKSFKRAGSLKRHRLIHTEEKPHKCDLCKKSFTEAGTLKKHQ-RIHTGEKPHKCDVCEKSFKESGNLKRHQMIHTGEK 133          

HSP 8 Score: 108.227 bits (269), Expect = 5.648e-21
Identity = 56/143 (39.16%), Postives = 82/143 (57.34%), Query Frame = 2
Query:  692 KPFLCNLCXXX-XXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ CN+C        H  +        ++PY+CT+C  SF  + +LK HQ  HT EK Y+C++C   F  + HLKRHQ +HT  KP++C  C+ SF ++ +LK H L VH   KP+ C+ C   F    +LK+HQ +H  +K
Sbjct:  217 KPYKCNVCEKLFQRPSHLKKHQMIHTAQSKPYKCTVCEKSFKQAGNLKMHQLIHTGEKSYKCTVCEKLFNRAGHLKRHQLVHTGEKPYKCTVCEKSFTEAGNLKVHQL-VHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEK 358          

HSP 9 Score: 104.76 bits (260), Expect = 8.199e-20
Identity = 57/147 (38.78%), Postives = 80/147 (54.42%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I   +KP+ C +C +        R        T+P +C +C  SF  S  LK+HQ  HT EKPY+C +C  +F  +  LK+HQ +HTK KP++C+ C  +F  S  LKRH  ++H  VK Y C  C   F +   LKRHQ +H  +K
Sbjct:  461 IHTEAKPYKCTMCKSFKEAGTLKRHQRIHS-ETKPNKCNVCERSFKQSSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQ-RIHTVVKSYKCTVCEKSFKEGGALKRHQMIHTGEK 605          

HSP 10 Score: 101.679 bits (252), Expect = 7.158e-19
Identity = 65/164 (39.63%), Postives = 95/164 (57.93%), Query Frame = 2
Query:  644 LCNSTNKIEKT------ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            LC  + K E T      I    KP+ CN+C  SF +  +L+ H+  H   +PY+C +C  SF  +     HQ  HT  KPY+C++C S FK++  LKRHQ+IH++ KP +CN C+ SF  S  LK+H + +H   KPY C+ C   F  +  LK+HQ +H ++K
Sbjct:  392 LCEKSFKKEGTFKRHQMIHTGEKPYKCNVCEKSFKQAGNLKTHQMIHTGQKPYKCNVCEKSFTRTT----HQRIHTEAKPYKCTMCKS-FKEAGTLKRHQRIHSETKPNKCNVCERSFKQSSTLKKHQM-IHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEK 549          

HSP 11 Score: 97.0561 bits (240), Expect = 2.170e-17
Identity = 55/121 (45.45%), Postives = 76/121 (62.81%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHL 1012
            +ST K  + I    KP+ C++C  SF+R   L++H+  H   +PY+C +C  +F  S  LKRHQ  HT  K Y+C++C  +FK+   LKRHQ IHT  KPF+CN CK SF  + HLKRH +
Sbjct:  507 SSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQRIHTVVKSYKCTVCEKSFKEGGALKRHQMIHTGEKPFKCNVCKKSFTQACHLKRHQI 627          

HSP 12 Score: 85.8853 bits (211), Expect = 7.564e-14
Identity = 44/104 (42.31%), Postives = 66/104 (63.46%), Query Frame = 2
Query:  806 SFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            S NDS+ L  +  T    KPY+C++C  +F+ S  LKRHQ I+T  KP++CN C+ SF  +  LKRH L +H + KP+ C+ C   F ++  LK+HQ++H  +K
Sbjct:    3 SCNDSFPLTTYHQTQAQAKPYKCNVCEKSFQYSCELKRHQMIYTVEKPYKCNVCEKSFKRAGSLKRHRL-IHTEEKPHKCDLCKKSFTEAGTLKKHQRIHTGEK 105          

HSP 13 Score: 72.0182 bits (175), Expect = 2.168e-9
Identity = 41/96 (42.71%), Postives = 61/96 (63.54%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHT 937
             ST K  + +    KP+ C++C  +F++   L+RH+R H   + Y+CT+C  SF +   LKRHQ  HT EKP++C++C  +F  + HLKRHQ IHT
Sbjct:  535 TSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQRIHTVVKSYKCTVCEKSFKEGGALKRHQMIHTGEKPFKCNVCKKSFTQACHLKRHQIIHT 630          
BLAST of SMED30027210 vs. TrEMBL
Match: H2YDD9 (Uncharacterized protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 5.635e-30
Identity = 73/147 (49.66%), Postives = 95/147 (64.63%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I  V KP+ CN+C  SF R   L+RH   H   +P++C LC  SF ++  LK+HQ  HT EKP++C +C  +FK+S +LKRHQ IHT  KP++CN CK SF ++ HLKRH + VH KVKPY C  C   F  +  LKRHQ VH + K
Sbjct:   24 IYTVEKPYKCNVCEKSFKRAGSLKRHRLIHTEEKPHKCDLCKKSFTEAGTLKKHQRIHTGEKPHKCDVCEKSFKESGNLKRHQMIHTGEKPYKCNACKKSFTEATHLKRHQM-VHTKVKPYKCTLCEKLFQQACDLKRHQMVHTKVK 169          

HSP 2 Score: 126.331 bits (316), Expect = 8.619e-27
Identity = 67/147 (45.58%), Postives = 92/147 (62.59%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ CN C  SF+   HL+RH+  H   +PY+CTLC   F  +  LKRHQ  HT  KPY+C++C  +F+ +  LKRHQ +HTK+KP++CN C+  F    HLK+H +   V+ KPY CN C   F  + +LKRHQ +H R+K
Sbjct:  108 IHTGEKPYKCNACKKSFTEATHLKRHQMVHTKVKPYKCTLCEKLFQQACDLKRHQMVHTKVKPYKCTVCEKSFQQACDLKRHQIVHTKVKPYKCNVCEKLFQRPSHLKKHQMIHTVESKPYKCNICEKSFQQAGNLKRHQMIHTREK 254          

HSP 3 Score: 122.865 bits (307), Expect = 1.083e-25
Identity = 68/156 (43.59%), Postives = 95/156 (60.90%), Query Frame = 2
Query:  653 STNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKV 1120
             T K  + I + +KP  CN+C  SF +   L++H+  H   +PY+C +C  SFN +  LK+HQY HT EKPY+C +C  AF  S  LKRHQ+IHT +K ++C  C+ SF +   LKRH + +H   KP+ CN C   F  + HLKRHQ +H   K+
Sbjct:  526 GTLKRHQRIHSETKPNKCNVCERSFKQSSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQRIHTVVKSYKCTVCEKSFKEGGALKRHQM-IHTGEKPFKCNVCKKSFTQACHLKRHQIIHTVNKI 680          

HSP 4 Score: 117.472 bits (293), Expect = 7.161e-24
Identity = 66/147 (44.90%), Postives = 87/147 (59.18%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ CN+C  SF    HL+RH   H   +PY+C LC  SF      KRHQ  HT EKPY+C++C  +FK + +LK HQ IHT  KP++CN C+ SF  +  LKRH  ++H + KP  CN C   F  S  LK+HQ +H  +K
Sbjct:  422 IHTEEKPYKCNVCKKSFKLAGHLKRHLMIHAGEKPYKCMLCEKSFKKEGTFKRHQMIHTGEKPYKCNVCEKSFKQAGNLKTHQMIHTGQKPYKCNVCEKSFTQAGTLKRHQ-RIHSETKPNKCNVCERSFKQSSTLKKHQMIHTGEK 567          

HSP 5 Score: 117.087 bits (292), Expect = 9.731e-24
Identity = 66/152 (43.42%), Postives = 91/152 (59.87%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K+ + I    K + C +C   F+R  HL+RH+  H   +PY+CT+C  SF ++ +LK HQ  HT EKP++CS+C   F    +LK+HQ IHT+ KP++CN CK SF  + HLKR HL +H   KPY C  C   F      KRHQ +H  +K
Sbjct:  333 KMHQLIHTGEKSYKCTVCEKLFNRAGHLKRHQLVHTGEKPYKCTVCEKSFTEAGNLKVHQLVHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEKPYKCNVCKKSFKLAGHLKR-HLMIHAGEKPYKCMLCEKSFKKEGTFKRHQMIHTGEK 483          

HSP 6 Score: 110.538 bits (275), Expect = 1.159e-21
Identity = 57/141 (40.43%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  695 PFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            P+ C +C  SF +  +L+ H+++   ++PY+CT+C  SF  + +LK HQ  HT EK Y+C++C   F  + HLKRHQ +HT  KP++C  C+ SF ++ +LK H L VH   KP+ C+ C   F    +LK+HQ +H  +K
Sbjct:  288 PYKCTVCEKSFKQAGNLKMHQQTQAQSKPYKCTVCEKSFKQAGNLKMHQLIHTGEKSYKCTVCEKLFNRAGHLKRHQLVHTGEKPYKCTVCEKSFTEAGNLKVHQL-VHTGEKPFKCSVCKKTFSVPGNLKKHQMIHTEEK 427          

HSP 7 Score: 110.153 bits (274), Expect = 1.398e-21
Identity = 65/152 (42.76%), Postives = 91/152 (59.87%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    KP+ CN+C  SF++   L+RH+R H  T+P +C +C  SF  S  LK+HQ  HT EKPY+C +C  +F  +  LK+HQ +HTK KP++C+ C  +F  S  LKRH  ++H  VK Y C  C   F +   LKRHQ +H  +K
Sbjct:  501 KTHQMIHTGQKPYKCNVCEKSFTQAGTLKRHQRIHSETKPNKCNVCERSFKQSSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQ-RIHTVVKSYKCTVCEKSFKEGGALKRHQMIHTGEK 651          

HSP 8 Score: 109.383 bits (272), Expect = 2.810e-21
Identity = 66/160 (41.25%), Postives = 93/160 (58.13%), Query Frame = 2
Query:  644 LCNSTNKIEKT------ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            LC  + K E T      I    KP+ CN+C  SF +  +L+ H+  H   +PY+C +C  SF  +  LKRHQ  H+  KP +C++C  +FK S  LK+HQ IHT  KP++C+ C+ SF  +  LK+H   +H K KPY C+ C   F  S  LKRHQ++H
Sbjct:  461 LCEKSFKKEGTFKRHQMIHTGEKPYKCNVCEKSFKQAGNLKTHQMIHTGQKPYKCNVCEKSFTQAGTLKRHQRIHSETKPNKCNVCERSFKQSSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQY-LHTKEKPYKCHVCDKAFTQSCLLKRHQRIH 619          

HSP 9 Score: 108.612 bits (270), Expect = 4.394e-21
Identity = 52/114 (45.61%), Postives = 76/114 (66.67%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            +PY+C +C  SF  S  LKRHQ  +T EKPY+C++C  +FK +  LKRH+ IHT+ KP +C+ CK SF ++  LK+H  ++H   KP+ C+ C   F +S +LKRHQ +H  +K
Sbjct:    1 KPYKCNVCEKSFQYSCELKRHQMIYTVEKPYKCNVCEKSFKRAGSLKRHRLIHTEEKPHKCDLCKKSFTEAGTLKKHQ-RIHTGEKPHKCDVCEKSFKESGNLKRHQMIHTGEK 113          

HSP 10 Score: 104.76 bits (260), Expect = 9.880e-20
Identity = 63/152 (41.45%), Postives = 86/152 (56.58%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXX-----XXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ CN+C  SF+R  +L+R           N  PY+CT+C  SF  + +LK HQ T    KPY+C++C  +FK + +LK HQ IHT  K ++C  C+  F  + HLKRH L VH   KPY C  C   F ++ +LK HQ VH  +K
Sbjct:  249 IHTREKPYKCNVCEKSFTRKSNLKRHEIIHTGMEPANLPPYKCTVCEKSFKQAGNLKMHQQTQAQSKPYKCTVCEKSFKQAGNLKMHQLIHTGEKSYKCTVCEKLFNRAGHLKRHQL-VHTGEKPYKCTVCEKSFTEAGNLKVHQLVHTGEK 399          

HSP 11 Score: 99.7525 bits (247), Expect = 3.481e-18
Identity = 54/148 (36.49%), Postives = 82/148 (55.41%), Query Frame = 2
Query:  692 KPFLCNLCXXX-XXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIK-----PFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ CN+C        H  +      + ++PY+C +C  SF  + +LKRHQ  HT EKPY+C++C  +F    +LKRH+ IHT ++     P++C  C+ SF  + +LK H  Q   + KPY C  C   F  + +LK HQ +H  +K
Sbjct:  197 KPYKCNVCEKLFQRPSHLKKHQMIHTVESKPYKCNICEKSFQQAGNLKRHQMIHTREKPYKCNVCEKSFTRKSNLKRHEIIHTGMEPANLPPYKCTVCEKSFKQAGNLKMHQ-QTQAQSKPYKCTVCEKSFKQAGNLKMHQLIHTGEK 343          

HSP 12 Score: 97.4413 bits (241), Expect = 1.992e-17
Identity = 55/121 (45.45%), Postives = 76/121 (62.81%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHL 1012
            +ST K  + I    KP+ C++C  SF+R   L++H+  H   +PY+C +C  +F  S  LKRHQ  HT  K Y+C++C  +FK+   LKRHQ IHT  KPF+CN CK SF  + HLKRH +
Sbjct:  553 SSTLKKHQMIHTGEKPYKCDVCEISFNRTSTLKQHQYLHTKEKPYKCHVCDKAFTQSCLLKRHQRIHTVVKSYKCTVCEKSFKEGGALKRHQMIHTGEKPFKCNVCKKSFTQACHLKRHQI 673          
BLAST of SMED30027210 vs. Ensembl Cavefish
Match: ENSAMXT00000043605.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001626.1:98037:99041:-1 gene:ENSAMXG00000033669.1 transcript:ENSAMXT00000043605.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 4.267e-31
Identity = 69/169 (40.83%), Postives = 94/169 (55.62%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH---------------------------HLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KPF C+ C   F +   L++H+R H   +PY+C+ C  SF +S HLK+HQ  HT EKPY CS C  +F+DS +LK+H +IHT  KP+QC++C  SF +S  LKRH                           H  VH   KPY C+ C   F +S HLK+HQ++H  +K
Sbjct:  137 KPFQCSECGQYFRKTETLKKHQRIHTGEKPYQCSECEMSFRESGHLKKHQRIHTGEKPYHCSECGQSFRDSANLKKHHRIHTGEKPYQCSDCGMSFTESGSLKRHRFIHTGEKPYHCIVCGKSFNQQSDLRRHQSVHTGEKPYQCSECEMSFRESGHLKKHQRIHTGEK 305          

HSP 2 Score: 124.02 bits (310), Expect = 5.722e-31
Identity = 66/153 (43.14%), Postives = 94/153 (61.44%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKV 1120
            K  + I    KP+ C+ C  SF    +L++H R H   +PY+C+ C  SF +S  LKRH++ HT EKPY C +C  +F     L+RHQ +HT  KP+QC+EC+ SF +S HLK+H  ++H   KPY C  C   F DS +LK+HQ++H   K+
Sbjct:  183 KKHQRIHTGEKPYHCSECGQSFRDSANLKKHHRIHTGEKPYQCSDCGMSFTESGSLKRHRFIHTGEKPYHCIVCGKSFNQQSDLRRHQSVHTGEKPYQCSECEMSFRESGHLKKHQ-RIHTGEKPYPCLECGMSFRDSGNLKKHQRIHSGAKL 334          

HSP 3 Score: 121.324 bits (303), Expect = 4.806e-30
Identity = 69/170 (40.59%), Postives = 105/170 (61.76%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ-QNCAT--TPNFEVSRNGFV 1177
            I    KP+ C+ C  SF++  +L++H+R H   +PY C+ C  +FN    L+ H+ THT EKP+QCS C   F+ +  LK+HQ+IHT  KP+QC+EC+ SF +S HLK+H  ++H   KPY C+ C   F DS +LK+H ++H  +K  Q  +C    T +  + R+ F+
Sbjct:   76 IHTGEKPYQCSDCGRSFTQQSNLKKHQRIHTGQKPYMCSECGMTFNQQSALQAHRRTHTGEKPFQCSECGQYFRKTETLKKHQRIHTGEKPYQCSECEMSFRESGHLKKHQ-RIHTGEKPYHCSECGQSFRDSANLKKHHRIHTGEKPYQCSDCGMSFTESGSLKRHRFI 244          

HSP 4 Score: 92.4337 bits (228), Expect = 4.681e-20
Identity = 49/140 (35.00%), Postives = 68/140 (48.57%), Query Frame = 2
Query:  779 PYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH---------------------------HLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            P+ C+ C  SF      + HQ  HT EKPYQCS C  +F    +LK+HQ+IHT  KP+ C+EC  +F     L+ H                           H ++H   KPY C+ C   F +S HLK+HQ++H  +K
Sbjct:   54 PFHCSDCGKSFMKKSAFQTHQRIHTGEKPYQCSDCGRSFTQQSNLKKHQRIHTGQKPYMCSECGMTFNQQSALQAHRRTHTGEKPFQCSECGQYFRKTETLKKHQRIHTGEKPYQCSECEMSFRESGHLKKHQRIHTGEK 193          
BLAST of SMED30027210 vs. Ensembl Cavefish
Match: ENSAMXT00000011527.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000940.1:12316:16543:-1 gene:ENSAMXG00000041975.1 transcript:ENSAMXT00000011527.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 1.639e-30
Identity = 70/154 (45.45%), Postives = 96/154 (62.34%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVI 1123
            KI + I    KP+ C+ C  SF+R  HL+ H+R H   +PY C+ C +SFN   HL+RHQ  HT EKPY CS C ++F    HL+RHQ+IHT  KP+ C++C  SF    HLK+H  ++H   KPY C+ C   F    HL+RHQ++H  +K+I
Sbjct:  219 KIHQRIHTGEKPYHCSDCGKSFTRQSHLKLHQRIHTGEKPYHCSDCGNSFNRQSHLQRHQRIHTGEKPYHCSDCGNSFNRQSHLQRHQRIHTGEKPYYCSDCGKSFNTQSHLKQH-QRIHTGEKPYHCSECGKSFNRRSHLQRHQRIHTGEKII 371          

HSP 2 Score: 114.775 bits (286), Expect = 1.919e-27
Identity = 63/152 (41.45%), Postives = 90/152 (59.21%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K+ + +    KP+ C+ C  S ++   L+ H+R H   +PY C+ C  SF    HLK HQ  HT EKPY CS C ++F    HL+RHQ+IHT  KP+ C++C +SF    HL+R H ++H   KPY C+ C   F    HLK+HQ++H  +K
Sbjct:  191 KVHQRMHTGEKPYHCSDCGKSLTKQSDLKIHQRIHTGEKPYHCSDCGKSFTRQSHLKLHQRIHTGEKPYHCSDCGNSFNRQSHLQRHQRIHTGEKPYHCSDCGNSFNRQSHLQR-HQRIHTGEKPYYCSDCGKSFNTQSHLKQHQRIHTGEK 341          

HSP 3 Score: 106.686 bits (265), Expect = 1.040e-24
Identity = 61/152 (40.13%), Postives = 85/152 (55.92%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K+ + +    KP+ C+ C  S ++   L+ H+R H   +PY C+ C  SF    HLK HQ  HT EKPY CS C  +      LK HQ+IHT  KP+ C++C  SF    HLK  H ++H   KPY C+ C + F    HL+RHQ++H  +K
Sbjct:  135 KVHQRMHTGEKPYHCSDCGKSLTKQSDLKIHQRIHTGEKPYHCSDCGKSFTRQSHLKVHQRMHTGEKPYHCSDCGKSLTKQSDLKIHQRIHTGEKPYHCSDCGKSFTRQSHLKL-HQRIHTGEKPYHCSDCGNSFNRQSHLQRHQRIHTGEK 285          

HSP 4 Score: 96.2857 bits (238), Expect = 3.470e-21
Identity = 60/152 (39.47%), Postives = 79/152 (51.97%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    KP  C+ C  S ++   L+ H+R H   +PY C+ C  SF    HLK HQ  HT EKPY CS C  +      LK HQ+IHT  KP+ C++C  SF    HLK  H ++H   KPY C+ C         LK HQ++H  +K
Sbjct:   79 KKHQRIHTGEKPHHCSDCGKSLTKQSDLKIHQRIHTGEKPYHCSDCGKSFTRQSHLKVHQRMHTGEKPYHCSDCGKSLTKQSDLKIHQRIHTGEKPYHCSDCGKSFTRQSHLKV-HQRMHTGEKPYHCSDCGKSLTKQSDLKIHQRIHTGEK 229          

HSP 5 Score: 78.9518 bits (193), Expect = 1.822e-15
Identity = 43/104 (41.35%), Postives = 57/104 (54.81%), Query Frame = 2
Query:  806 SFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            SF    +LK+HQ  HT EKP+ CS C  +      LK HQ+IHT  KP+ C++C  SF    HLK  H ++H   KPY C+ C         LK HQ++H  +K
Sbjct:   71 SFTKQSNLKKHQRIHTGEKPHHCSDCGKSLTKQSDLKIHQRIHTGEKPYHCSDCGKSFTRQSHLKV-HQRMHTGEKPYHCSDCGKSLTKQSDLKIHQRIHTGEK 173          
BLAST of SMED30027210 vs. Ensembl Cavefish
Match: ENSAMXT00000047628.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000247.1:25723:28371:-1 gene:ENSAMXG00000029178.1 transcript:ENSAMXT00000047628.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 1.335e-28
Identity = 66/147 (44.90%), Postives = 96/147 (65.31%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C  SFS    L +H+R H   +PY+C+ C +SF  + HL+RHQ  HT EKPY CS C ++FK + HL+RHQ+IHT  KP+ C++C +SF  + HL+R H ++H   KPY C+ C + F  + HL+RHQ++H  +K
Sbjct:   62 IHTGEKPYYCSDCGKSFSHQSTLLKHQRIHTGEKPYQCSDCGTSFKQNIHLQRHQRIHTGEKPYHCSDCGTSFKQNIHLQRHQRIHTGEKPYYCSDCGTSFKQNIHLQR-HQRIHTGEKPYYCSDCGTSFKQNIHLQRHQRIHTGEK 207          

HSP 2 Score: 107.071 bits (266), Expect = 7.824e-24
Identity = 63/147 (42.86%), Postives = 90/147 (61.22%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C  SF ++ HL+RH+R H   +PY C+ C +SF  + HL+RHQ  HT EKPY CS C ++FK + HL+RHQ+IHT  KP+ C++C  SF      +R HL++H   KPY C+ C   F      +RH ++H  +K
Sbjct:  118 IHTGEKPYHCSDCGTSFKQNIHLQRHQRIHTGEKPYYCSDCGTSFKQNIHLQRHQRIHTGEKPYYCSDCGTSFKQNIHLQRHQRIHTGEKPYHCSDCGKSFTHRGTFQR-HLRIHTGEKPYHCSDCGKSFNHRGTFQRHLRIHTGEK 263          

HSP 3 Score: 100.908 bits (250), Expect = 6.376e-22
Identity = 62/152 (40.79%), Postives = 87/152 (57.24%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    KP+ C+ C  SFSR   L  H+R H   +PY C+ C  SF+    L +HQ  HT EKPY CS C  +FK + HL+RHQ+IHT  KP+ C++C  SF    +L++ H ++H   KPY C+ C   F     L +HQ++H  +K
Sbjct:  505 KTHQRIHTGEKPYHCSDCGKSFSRQSTLITHQRLHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFKQNIHLQRHQRIHTGEKPYHCSDCGKSFSHQSNLQQ-HRRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEK 655          

HSP 4 Score: 100.908 bits (250), Expect = 7.812e-22
Identity = 50/116 (43.10%), Postives = 72/116 (62.07%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
              +PY C+ C  SF+    L +HQ  HT EKPY CS C  +F     L +HQ+IHT  KP+QC++C +SF  + HL+R H ++H   KPY C+ C + F  + HL+RHQ++H  +K
Sbjct:   37 GEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYYCSDCGKSFSHQSTLLKHQRIHTGEKPYQCSDCGTSFKQNIHLQR-HQRIHTGEKPYHCSDCGTSFKQNIHLQRHQRIHTGEK 151          

HSP 5 Score: 97.8265 bits (242), Expect = 7.402e-21
Identity = 58/147 (39.46%), Postives = 81/147 (55.10%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C  SF+     ++H+R H   +PY C+ C  SF+   HL+ HQ THT EKPY CS C  +F    HL+ HQ+ HT  KP+ C++C  SF    HL+  H + H   KPY C+ C   F     L +HQ++H  +K
Sbjct:  258 IHTGEKPYRCSDCGKSFNHRGTFQQHQRIHTGEKPYHCSDCGKSFSRQSHLQLHQRTHTGEKPYHCSDCGKSFSRQSHLQLHQRTHTGEKPYHCSDCGKSFSRQSHLQL-HQRTHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEK 403          

HSP 6 Score: 94.3597 bits (233), Expect = 8.099e-20
Identity = 60/153 (39.22%), Postives = 86/153 (56.21%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSF-YDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            ++ +      KP+ C+ C  SFS    L +H+R H   +PY C+ C  SF+   +LK HQ  HT EKPY CS C  +F     L  HQ++HT  KP+ C++C  SF + S  LK  H ++H   KPY C+ C   F  + HL+RHQ++H  +K
Sbjct:  449 QLHQRTHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSQQNNLKTHQRIHTGEKPYHCSDCGKSFSRQSTLITHQRLHTGEKPYHCSDCGKSFSHQSTLLK--HQRIHTGEKPYHCSDCGKSFKQNIHLQRHQRIHTGEK 599          

HSP 7 Score: 93.2041 bits (230), Expect = 1.754e-19
Identity = 57/147 (38.78%), Postives = 78/147 (53.06%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C  SF+     +RH R H   +PY C+ C  SFN     +RH   HT EKPY+CS C  +F      ++HQ+IHT  KP+ C++C  SF    HL+  H + H   KPY C+ C   F    HL+ HQ+ H  +K
Sbjct:  202 IHTGEKPYHCSDCGKSFTHRGTFQRHLRIHTGEKPYHCSDCGKSFNHRGTFQRHLRIHTGEKPYRCSDCGKSFNHRGTFQQHQRIHTGEKPYHCSDCGKSFSRQSHLQL-HQRTHTGEKPYHCSDCGKSFSRQSHLQLHQRTHTGEK 347          

HSP 8 Score: 92.8189 bits (229), Expect = 2.768e-19
Identity = 61/152 (40.13%), Postives = 86/152 (56.58%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            ++ +      KP+ C+ C  SFSR  HL+ H+R+H   +PY C+ C  SF+   HL+ HQ THT EKPY CS C  +F     L +HQ+IHT  KP+ C++C  SF     LK  H ++H   KPY C+ C   F    +L+ HQ+ H  +K
Sbjct:  309 QLHQRTHTGEKPYHCSDCGKSFSRQSHLQLHQRTHTGEKPYHCSDCGKSFSRQSHLQLHQRTHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYYCSDCGKSFSQQNTLKT-HQRLHTGEKPYHCSDCGKSFTQQRNLQLHQRTHTGEK 459          

HSP 9 Score: 92.0485 bits (227), Expect = 4.292e-19
Identity = 60/148 (40.54%), Postives = 82/148 (55.41%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSF-YDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C  SFS    L +H+R H   +PY C+ C  SF+    L +HQ  HT EKPY CS C  +F     L +HQ+IHT  KP+ C++C  SF + S  LK  H ++H   KPY C+ C   F     L+RHQ++H  +K
Sbjct:  734 IHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLK--HQRIHTGKKPYHCSDCGKSFTQQRTLQRHQRIHTGQK 879          

HSP 10 Score: 91.6633 bits (226), Expect = 6.595e-19
Identity = 59/147 (40.14%), Postives = 82/147 (55.78%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C  SFS+ + L+ H+R H   +PY C+ C  SF    +L+ HQ THT EKPY CS C  +F     L +HQ+IHT  KP+ C++C  SF    +LK  H ++H   KPY C+ C   F     L  HQ++H  +K
Sbjct:  398 IHTGEKPYYCSDCGKSFSQQNTLKTHQRLHTGEKPYHCSDCGKSFTQQRNLQLHQRTHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSQQNNLKT-HQRIHTGEKPYHCSDCGKSFSRQSTLITHQRLHTGEK 543          

HSP 11 Score: 88.9669 bits (219), Expect = 4.527e-18
Identity = 59/150 (39.33%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  671 KTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSF-YDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            + I    KP+ C+ C  SFS    L +H+R H   +PY C+ C  SF+    L +HQ  HT EKPY CS C  +F     L +HQ+IHT  KP+ C++C  SF + S  LK  H ++H   KPY C+ C   F     L +HQ++H  +K
Sbjct:  620 RRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLK--HQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEK 767          

HSP 12 Score: 88.5817 bits (218), Expect = 5.392e-18
Identity = 59/148 (39.86%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSF-YDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C  SFS    L +H+R H   +PY C+ C  SF+    L +HQ  HT EKPY CS C  +F     L +HQ+IHT  KP+ C++C  SF + S  LK  H ++H   KPY C+ C   F     L +HQ++H  +K
Sbjct:  678 IHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLK--HQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEK 823          

HSP 13 Score: 88.1965 bits (217), Expect = 7.071e-18
Identity = 59/148 (39.86%), Postives = 86/148 (58.11%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSF-YDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C  SF ++ HL+RH+R H   +PY C+ C  SF+   +L++H+  HT EKPY CS C  +F     L +HQ+IHT  KP+ C++C  SF + S  LK  H ++H   KPY C+ C   F     L +HQ++H  +K
Sbjct:  566 IHTGEKPYHCSDCGKSFKQNIHLQRHQRIHTGEKPYHCSDCGKSFSHQSNLQQHRRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLK--HQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEK 711          

HSP 14 Score: 78.1814 bits (191), Expect = 1.068e-14
Identity = 50/121 (41.32%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPY 1039
            I    KP+ C+ C  SFS    L +H+R H   +PY C+ C  SF+    L +HQ  HT EKPY CS C  +F     L +HQ+IHT  KP+ C++C  SF     L+R H ++H   KPY
Sbjct:  762 IHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGKKPYHCSDCGKSFTQQRTLQR-HQRIHTGQKPY 881          

HSP 15 Score: 75.8702 bits (185), Expect = 6.006e-14
Identity = 42/101 (41.58%), Postives = 60/101 (59.41%), Query Frame = 2
Query:  848 HTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSF-YDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ-QNCATT 1144
            HT EKPY CS C  +F     L +HQ+IHT  KP+ C++C  SF + S  LK  H ++H   KPY C+ C + F  + HL+RHQ++H  +K     +C T+
Sbjct:   35 HTGEKPYHCSDCGKSFSHQSTLLKHQRIHTGEKPYYCSDCGKSFSHQSTLLK--HQRIHTGEKPYQCSDCGTSFKQNIHLQRHQRIHTGEKPYHCSDCGTS 133          
BLAST of SMED30027210 vs. Ensembl Cavefish
Match: ENSAMXT00000000012.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001040.1:1997:3076:1 gene:ENSAMXG00000038636.1 transcript:ENSAMXT00000000012.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 4.538e-28
Identity = 67/148 (45.27%), Postives = 91/148 (61.49%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            K  + I    KP+ C+ C  SF+R  HL++H+R H   +PY C+ C  SFN   HLK+HQ  HT EKPY CS C  +F    +LK HQ+IHT +KP+ C++C  SF    HLK+ H ++H  VKPY C+ C   F    HLK+HQ++H
Sbjct:  130 KKHQRIHTGEKPYHCSDCGKSFNRQSHLKKHQRIHTGEKPYHCSDCGKSFNRQSHLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKNHQRIHTGVKPYHCSDCGKSFNRQSHLKK-HQRIHTGVKPYHCSDCGKSFNRQSHLKKHQRIH 276          

HSP 2 Score: 115.546 bits (288), Expect = 5.830e-28
Identity = 67/152 (44.08%), Postives = 91/152 (59.87%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    KP+ C+ C  SF++  HL+ H+R H   +PY C+ C  SFN   HLK+HQ  HT EKPY CS C  +F    HLK+HQ+IHT  KP+ C++C  SF    HLK+H  ++H   KPY C+ C   F    HLK+HQ++H  +K
Sbjct:   46 KKHQLIHTGEKPYYCSDCGKSFNQQSHLKMHQRIHTGEKPYYCSDCGKSFNRQSHLKKHQRIHTGEKPYHCSDCGKSFNRQSHLKKHQRIHTGEKPYHCSDCGKSFNRQSHLKKH-QRIHTGEKPYHCSDCGKSFNRQSHLKKHQRIHTGEK 196          

HSP 3 Score: 113.62 bits (283), Expect = 2.716e-27
Identity = 66/148 (44.59%), Postives = 90/148 (60.81%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            K+ + I    KP+ C+ C  SF+R  HL++H+R H   +PY C+ C  SFN   HLK+HQ  HT EKPY CS C  +F    HLK+HQ+IHT  KP+ C++C  SF    HLK+ H ++H   KPY C+ C   F    +LK HQ++H
Sbjct:   74 KMHQRIHTGEKPYYCSDCGKSFNRQSHLKKHQRIHTGEKPYHCSDCGKSFNRQSHLKKHQRIHTGEKPYHCSDCGKSFNRQSHLKKHQRIHTGEKPYHCSDCGKSFNRQSHLKK-HQRIHTGEKPYHCSDCGKSFTKQSNLKNHQRIH 220          

HSP 4 Score: 113.235 bits (282), Expect = 4.103e-27
Identity = 64/145 (44.14%), Postives = 87/145 (60.00%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQ 1096
            K  + I    KP+ C+ C  SF++  +L+ H+R H   +PY C+ C  SFN   HLK+HQ  HT  KPY CS C  +F    HLK+HQ+IHT +KP+ C++C  SF    HLK+ H ++H  VKPY C+ C   F    HLK+HQ
Sbjct:  186 KKHQRIHTGEKPYHCSDCGKSFTKQSNLKNHQRIHTGVKPYHCSDCGKSFNRQSHLKKHQRIHTGVKPYHCSDCGKSFNRQSHLKKHQRIHTGVKPYHCSDCGKSFNRQSHLKK-HQRIHTGVKPYHCSDCGKSFNRQSHLKKHQ 329          

HSP 5 Score: 110.538 bits (275), Expect = 3.123e-26
Identity = 65/148 (43.92%), Postives = 89/148 (60.14%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            K  + I    KP+ C+ C  SF+R  HL++H+R H   +PY C+ C  SF    +LK HQ  HT  KPY CS C  +F    HLK+HQ+IHT +KP+ C++C  SF    HLK+H  ++H  VKPY C+ C   F    HLK+HQ++H
Sbjct:  158 KKHQRIHTGEKPYHCSDCGKSFNRQSHLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKNHQRIHTGVKPYHCSDCGKSFNRQSHLKKHQRIHTGVKPYHCSDCGKSFNRQSHLKKH-QRIHTGVKPYHCSDCGKSFNRQSHLKKHQRIH 304          

HSP 6 Score: 110.153 bits (274), Expect = 4.709e-26
Identity = 64/152 (42.11%), Postives = 89/152 (58.55%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    KP  C+ C  +F++  +L++H+  H   +PY C+ C  SFN   HLK HQ  HT EKPY CS C  +F    HLK+HQ+IHT  KP+ C++C  SF    HLK+ H ++H   KPY C+ C   F    HLK+HQ++H  +K
Sbjct:   18 KKHQRIHTGVKPCHCSDCGKNFTKQSNLKKHQLIHTGEKPYYCSDCGKSFNQQSHLKMHQRIHTGEKPYYCSDCGKSFNRQSHLKKHQRIHTGEKPYHCSDCGKSFNRQSHLKK-HQRIHTGEKPYHCSDCGKSFNRQSHLKKHQRIHTGEK 168          

HSP 7 Score: 83.5741 bits (205), Expect = 4.323e-17
Identity = 46/104 (44.23%), Postives = 59/104 (56.73%), Query Frame = 2
Query:  806 SFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            SF    HLK+HQ  HT  KP  CS C   F    +LK+HQ IHT  KP+ C++C  SF    HLK  H ++H   KPY C+ C   F    HLK+HQ++H  +K
Sbjct:   10 SFTKQSHLKKHQRIHTGVKPCHCSDCGKNFTKQSNLKKHQLIHTGEKPYYCSDCGKSFNQQSHLKM-HQRIHTGEKPYYCSDCGKSFNRQSHLKKHQRIHTGEK 112          
BLAST of SMED30027210 vs. Ensembl Cavefish
Match: ENSAMXT00000033231.1 (zinc finger protein 239-like [Source:NCBI gene;Acc:103042603])

HSP 1 Score: 116.316 bits (290), Expect = 4.944e-28
Identity = 65/143 (45.45%), Postives = 85/143 (59.44%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I +  +P+ C  C  +FS   HLR H+R H   RP+RC+LC  SF  S  LKRH  THT E+PYQC  C  +F +S HLK H++IHT  KP+ CN+C  SF     LK H   +H   +P+ C  C   F+ S  LKRHQ++H
Sbjct:  229 IHSGERPYKCPQCDKTFSDSGHLRGHQRIHTGERPHRCSLCEKSFFRSGDLKRHHRTHTGERPYQCYQCGKSFSESGHLKEHRRIHTGEKPYHCNQCDKSFSRLERLKGHQ-SIHTGERPFHCAQCGKNFFRSGELKRHQRIH 370          

HSP 2 Score: 113.235 bits (282), Expect = 6.044e-27
Identity = 63/152 (41.45%), Postives = 87/152 (57.24%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + +    +P+ C  C+  F R   L+RH R H   RPY+C  C  +F+DS HL+ HQ  HT E+P++CSLC  +F  S  LKRH + HT  +P+QC +C  SF +S HLK  H ++H   KPY CN C   F     LK HQ +H  ++
Sbjct:  196 KQHERMHTGERPYQCPQCAKRFYRSGDLKRHLRIHSGERPYKCPQCDKTFSDSGHLRGHQRIHTGERPHRCSLCEKSFFRSGDLKRHHRTHTGERPYQCYQCGKSFSESGHLKE-HRRIHTGEKPYHCNQCDKSFSRLERLKGHQSIHTGER 346          

HSP 3 Score: 113.235 bits (282), Expect = 6.523e-27
Identity = 63/155 (40.65%), Postives = 89/155 (57.42%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            K  + I +  +PF C  C  +F     L+RHER H   RPY C  C  +F+DS HLK+H+  HT E+PYQC  C   F  S  LKRH +IH+  +P++C +C  +F DS HL R H ++H   +P+ C+ C   F+ S  LKRH + H  ++  Q
Sbjct:  140 KRHQRIHSGERPFPCFQCGKNFPTSGDLKRHERIHTGERPYHCLQCGKNFSDSGHLKQHERMHTGERPYQCPQCAKRFYRSGDLKRHLRIHSGERPYKCPQCDKTFSDSGHL-RGHQRIHTGERPHRCSLCEKSFFRSGDLKRHHRTHTGERPYQ 293          

HSP 4 Score: 113.235 bits (282), Expect = 6.906e-27
Identity = 64/152 (42.11%), Postives = 88/152 (57.89%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    +P+ C  C  +FS   HL++HER H   RPY+C  C   F  S  LKRH   H+ E+PY+C  C   F DS HL+ HQ+IHT  +P +C+ C+ SF+ S  LKRHH + H   +PY C  C   F +S HLK H+++H  +K
Sbjct:  168 KRHERIHTGERPYHCLQCGKNFSDSGHLKQHERMHTGERPYQCPQCAKRFYRSGDLKRHLRIHSGERPYKCPQCDKTFSDSGHLRGHQRIHTGERPHRCSLCEKSFFRSGDLKRHH-RTHTGERPYQCYQCGKSFSESGHLKEHRRIHTGEK 318          

HSP 5 Score: 97.4413 bits (241), Expect = 1.628e-21
Identity = 48/110 (43.64%), Postives = 66/110 (60.00%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            RPY C  C   F  S  +KRHQ  H+ E+P+ C  C   F  S  LKRH++IHT  +P+ C +C  +F DS HLK+H  ++H   +PY C  C+ +FY S  LKRH ++H
Sbjct:  123 RPYHCQDCGKYFRIS-DIKRHQRIHSGERPFPCFQCGKNFPTSGDLKRHERIHTGERPYHCLQCGKNFSDSGHLKQHE-RMHTGERPYQCPQCAKRFYRSGDLKRHLRIH 230          
BLAST of SMED30027210 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009822.1 (pep scaffold:Pmarinus_7.0:GL479431:4162:28680:-1 gene:ENSPMAG00000008879.1 transcript:ENSPMAT00000009822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 2.839e-24
Identity = 64/143 (44.76%), Postives = 84/143 (58.74%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KPF C +C+ SF++  +L+ HER+H   +PYRC +C SSF+ S HLK HQ TH ++ P  C++   +F    H  RHQ+IHT  KPF C  C  SF  S +LK  H + H   KPY C+ C+S F  S HL  HQ  H
Sbjct:    4 IHTGEKPFRCKMCNRSFAQSCNLKVHERTHTGQKPYRCDICNSSFSRSHHLKGHQRTHADDPPVPCTVLNISFMVFSHWTRHQRIHTGEKPFHCEMCNRSFSHSSNLKV-HERTHTGQKPYRCDICNSSFSRSHHLTDHQCTH 145          

HSP 2 Score: 67.781 bits (164), Expect = 7.526e-14
Identity = 40/121 (33.06%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  836 HQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH---------------------------HLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            H   HT EKP++C +C  +F  S +LK H++ HT  KP++C+ C SSF  S HLK H                           H ++H   KP+ C  C+  F  S +LK H++ H  +K
Sbjct:    1 HHRIHTGEKPFRCKMCNRSFAQSCNLKVHERTHTGQKPYRCDICNSSFSRSHHLKGHQRTHADDPPVPCTVLNISFMVFSHWTRHQRIHTGEKPFHCEMCNRSFSHSSNLKVHERTHTGQK 121          
BLAST of SMED30027210 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006856.1 (pep scaffold:Pmarinus_7.0:GL476534:515915:516469:1 gene:ENSPMAG00000006196.1 transcript:ENSPMAT00000006856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 2.200e-23
Identity = 41/110 (37.27%), Postives = 64/110 (58.18%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            RP+ C LC  +F  +W+L+ H+  HT EKPY+C+ C  AF +S HL +H+  H   +PF+C+ C  +F  + +LK H    H   +P+ C +C   F  + +L RH+  H
Sbjct:   28 RPFTCALCGKAFGTAWNLRIHERKHTGEKPYECNACGRAFSESGHLDKHRATHAAERPFKCDTCGRAFAQARYLKSHR-ATHAADRPFECGACGKTFTLARYLDRHRSRH 136          

HSP 2 Score: 92.0485 bits (227), Expect = 2.052e-22
Identity = 41/109 (37.61%), Postives = 64/109 (58.72%), Query Frame = 2
Query:  779 PYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            PY      S    SW+L +H+ THT E+P+ C+LC  AF  +W+L+ H++ HT  KP++CN C  +F +S HL +H    H   +P+ C++C   F  + +LK H+  H
Sbjct:    1 PYSTDHLGSMTTTSWNLHKHRRTHTGERPFTCALCGKAFGTAWNLRIHERKHTGEKPYECNACGRAFSESGHLDKHR-ATHAAERPFKCDTCGRAFAQARYLKSHRATH 108          
BLAST of SMED30027210 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009820.1 (pep scaffold:Pmarinus_7.0:GL479431:4162:28680:-1 gene:ENSPMAG00000008879.1 transcript:ENSPMAT00000009820.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 1.791e-22
Identity = 63/143 (44.06%), Postives = 81/143 (56.64%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KPF C +C+ SF++  +L+ HER+H   +PYRC +C SSF+ S HLK HQ TH ++ P  C    S  +    L  HQ+IHT  KPF C  C  SF  S +LK  H + H   KPY C+ C+S F  S HL  HQ  H
Sbjct:    4 IHTGEKPFRCKMCNRSFAQSCNLKVHERTHTGQKPYRCDICNSSFSRSHHLKGHQRTHADDPPVDCLQMPSPRRWDAALGHHQRIHTGEKPFHCEMCNRSFSHSSNLKV-HERTHTGQKPYRCDICNSSFSRSHHLTDHQCTH 145          

HSP 2 Score: 67.781 bits (164), Expect = 8.130e-14
Identity = 40/121 (33.06%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  836 HQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLK---------------------------RHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            H   HT EKP++C +C  +F  S +LK H++ HT  KP++C+ C SSF  S HLK                            HH ++H   KP+ C  C+  F  S +LK H++ H  +K
Sbjct:    1 HHRIHTGEKPFRCKMCNRSFAQSCNLKVHERTHTGQKPYRCDICNSSFSRSHHLKGHQRTHADDPPVDCLQMPSPRRWDAALGHHQRIHTGEKPFHCEMCNRSFSHSSNLKVHERTHTGQK 121          
BLAST of SMED30027210 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002403.1 (pep scaffold:Pmarinus_7.0:GL486389:4672:6368:-1 gene:ENSPMAG00000002187.1 transcript:ENSPMAT00000002403.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 2.310e-22
Identity = 47/119 (39.50%), Postives = 66/119 (55.46%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
              +PY C++C  +F    HL  HQ THTNEKPY+C LC  AF+   +L  HQ+ HT  KP+ C  C  +F  S +L+ H  + H   +PY C  C   F     L+RH+ +H  KK+ +
Sbjct:   86 GAKPYACSVCEKAFPSKEHLLVHQRTHTNEKPYKCLLCEMAFRQKKYLLIHQRNHTGEKPYTCAVCDKAFKKSEYLQIHQ-RTHTGERPYKCVQCEKAFTQKGDLQRHEAIHSGKKLFE 203          

HSP 2 Score: 90.5077 bits (223), Expect = 9.728e-21
Identity = 52/139 (37.41%), Postives = 79/139 (56.83%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +KP+ C++C  +F    HL  H+R+H N +PY+C LC  +F    +L  HQ  HT EKPY C++C  AFK S +L+ HQ+ HT  +P++C +C+ +F     L+RH   +H   K + C  C   F    +L  H+  H
Sbjct:   87 AKPYACSVCEKAFPSKEHLLVHQRTHTNEKPYKCLLCEMAFRQKKYLLIHQRNHTGEKPYTCAVCDKAFKKSEYLQIHQRTHTGERPYKCVQCEKAFTQKGDLQRHEA-IHSGKKLFECPVCGKAFKRKDYLAIHKNNH 224          

HSP 3 Score: 75.8702 bits (185), Expect = 9.689e-16
Identity = 46/138 (33.33%), Postives = 70/138 (50.72%), Query Frame = 2
Query:  776 RPYRCTLCTSSFN-DSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRK---KVIQQNCATTPNFEVSRNGFV 1177
            R + C +C  +F     HL+ H  +H+  KPY CS+C  AF    HL  HQ+ HT  KP++C  C+ +F    +L  H  + H   KPY+C  C   F  S +L+ HQ+ H  +   K +Q   A T   ++ R+  +
Sbjct:   59 RLHGCAVCDKAFKRKKGHLRMHLMSHSGAKPYACSVCEKAFPSKEHLLVHQRTHTNEKPYKCLLCEMAFRQKKYLLIHQ-RNHTGEKPYTCAVCDKAFKKSEYLQIHQRTHTGERPYKCVQCEKAFTQKGDLQRHEAI 195          

HSP 4 Score: 56.225 bits (134), Expect = 4.036e-9
Identity = 33/98 (33.67%), Postives = 55/98 (56.12%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKI-----KPFQCNEC 967
             KP+ C +C  +F +  +L+ H+R+H   RPY+C  C  +F     L+RH+  H+ +K ++C +C  AFK   +L  H+  H+ +     KP +C EC
Sbjct:  143 EKPYTCAVCDKAFKKSEYLQIHQRTHTGERPYKCVQCEKAFTQKGDLQRHEAIHSGKKLFECPVCGKAFKRKDYLAIHKNNHSVVKGEQKKPHRCLEC 240          
BLAST of SMED30027210 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 5.188e-22
Identity = 60/165 (36.36%), Postives = 79/165 (47.88%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH---------------------------HLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +PF+C  C   F +   L+ H + H   RPY C  C  SF+ S  +  HQ THT EKP+ C  C   F    HLK HQ+IHT  KP+ CN C  SF  +++LK H                           H++ H  VKPY C  C +KF    HLK H+++H
Sbjct:  128 RPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIH 292          

HSP 2 Score: 97.4413 bits (241), Expect = 8.739e-22
Identity = 58/155 (37.42%), Postives = 81/155 (52.26%), Query Frame = 2
Query:  653 STNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            ST K      ++ KPF+CN C   FS+  +++ H  +H   RPY C  C   F+    LK HQ+THT E+P+ C+ C   F  +  LK H +IHT  +P+ C EC  SF  S  +  H  + H   KP+ C  C   F    HLK HQ++H  +K
Sbjct:   59 STLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQ-KTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEK 212          

HSP 3 Score: 92.8189 bits (229), Expect = 2.564e-20
Identity = 61/182 (33.52%), Postives = 90/182 (49.45%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH-LRKKVIQQNCA-------TTPNFEVSRNG 1171
            +S   + +      KPF+C  C   F++  HL+ H+R H   +PY C +C  SF+ +++LK HQ TH  E+PY C LC   F D   L  H + HT +KP+ C  C + F    HLK  H ++H   +P+ C  C   F     LK H+  H + K  I ++C        T  N E+  +G
Sbjct:  170 SSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKA-HKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSG 350          

HSP 4 Score: 89.7373 bits (221), Expect = 2.778e-19
Identity = 59/152 (38.82%), Postives = 79/152 (51.97%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    KP+ CN+C  SFS +++L+ H+++HL  RPY C LC   F+D   L  H  THT  KPY C+ C + F    HLK H++IHT  +PF C  C   F     LK H    H   KP+ C  C   +     LK H+ VH  +K
Sbjct:  202 KTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEF-THSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEK 352          

HSP 5 Score: 87.8113 bits (216), Expect = 1.207e-18
Identity = 60/163 (36.81%), Postives = 84/163 (51.53%), Query Frame = 2
Query:  653 STNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ-QNCA 1138
            ST K  + + +  KPFLC  C   FS+   L+ H+ +H   +P+ C  C   F+ +  LK HQ  HT EK + C  C   F     LK+HQQ+H+  +PF C EC  SF    +LK H  + H   KP++C  C   F    HLK HQ+ H  +K  + Q+C 
Sbjct:  339 STLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQ-KTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCG 500          

HSP 6 Score: 85.5001 bits (210), Expect = 6.241e-18
Identity = 53/150 (35.33%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK-VIQQNCA 1138
            KPF+C  C   FS    L+ H  +H   +P+ C  C   F+ + ++K H+ THT E+PY C  C   F     LK HQ  HT  +PF C +C   F  +  LK HH ++H   +PY C  C   F  S  +  HQ+ H  +K  I ++C 
Sbjct:   44 KPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHH-KIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCG 192          

HSP 7 Score: 83.1889 bits (204), Expect = 3.910e-17
Identity = 52/144 (36.11%), Postives = 73/144 (50.69%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVI 1123
            KP++C  C   FS+  HL+ H+R H   RP+ C +C   F     LK H++TH+ EKP+ C  C   +     LK H+ +H+  KPF C EC   F     LK H L  H   +P+ C  C  +F  +  LK HQ +H  +K  
Sbjct:  268 KPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKL-THDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTF 410          

HSP 8 Score: 78.9518 bits (193), Expect = 6.977e-16
Identity = 54/155 (34.84%), Postives = 74/155 (47.74%), Query Frame = 2
Query:  653 STNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            ST K  +   +V KPF+C  C   +S    L+ HE  H   +P+ C  C   F+    LK H+ TH  E+P+ C  C   F  +  LK HQ +HT  K F C +C   F     LK+H  Q+H   +P+ C  C   F    +LK HQ+ H   K
Sbjct:  311 STLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQ-QMHSSERPFICKECGKSFSYYSNLKVHQKTHTGDK 464          

HSP 9 Score: 72.7886 bits (177), Expect = 7.037e-14
Identity = 42/112 (37.50%), Postives = 53/112 (47.32%), Query Frame = 2
Query:  782 YRCTLCTSSFND----SWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            Y C  C  +F+       HLK H  THT EKP+ C  C   F     LK H   H+  KPF CN+C   F  + ++K H L  H   +PY+C  C  +F     LK HQ  H
Sbjct:   14 YMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRL-THTGERPYACQDCGQRFSQPSSLKTHQFTH 124          

HSP 10 Score: 71.633 bits (174), Expect = 1.524e-13
Identity = 46/119 (38.66%), Postives = 66/119 (55.46%), Query Frame = 2
Query:  650 NSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH 1006
             S+ K  + +    K FLC  C   FS    L++H++ H + RP+ C  C  SF+   +LK HQ THT +KP+ C+LC   F    HLK HQ+ HT  KP++C +C   F  + +LK H
Sbjct:  394 TSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVH 512          

HSP 11 Score: 60.077 bits (144), Expect = 7.425e-10
Identity = 37/94 (39.36%), Postives = 57/94 (60.64%), Query Frame = 2
Query:  653 STNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIH 934
            S+ K  + + +  +PF+C  C  SFS + +L+ H+++H   +P+ CTLC   F+   HLK HQ THT EKPY+C  C   F  + +LK H++ H
Sbjct:  423 SSLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKTH 516          
BLAST of SMED30027210 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 72.0182 bits (175), Expect = 1.101e-13
Identity = 39/103 (37.86%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHL 1084
            +PY+C  C   F+    L +H  TH+ EKPY+C +C   F  S  LK H + HT  KP QC  C   F +S +L +H   +    K Y C+ CS  F D   L
Sbjct:  766 KPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKH---IKTHQKKYKCSDCSKSFDDLGKL 865          

HSP 2 Score: 67.3958 bits (163), Expect = 3.718e-12
Identity = 44/116 (37.93%), Postives = 62/116 (53.45%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPY 1039
            KP+ C  C   FS    L +H R+H   +PY+C +C   F  S  LK H  THT EKP QC +C   F +S +L +H  I T  K ++C++C  SF D   L    ++  ++ KPY
Sbjct:  766 KPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKH--IKTHQKKYKCSDCSKSFDDLGKLNSQKVKCALERKPY 879          

HSP 3 Score: 63.1586 bits (152), Expect = 6.093e-11
Identity = 35/106 (33.02%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  797 CTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRK 1114
            C  +F     L RH   H+  KPY+C  C   F     L +H + H+  KP++C+ C   F  S  LK  H++ H   KP  C  C  +F +S +L +H + H +K
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKI-HIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQKK 849          
BLAST of SMED30027210 vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 68.5514 bits (166), Expect = 7.326e-13
Identity = 42/112 (37.50%), Postives = 55/112 (49.11%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNE--CKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            R ++C  C  SF    HL+RH YTH++ KP+QCS C         LKRH+  HT  K F C E  C   FY    L+ H L VH  +   +C  C+  F   + L+ H   H
Sbjct:   78 RAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKHPQLRAHILSVH--LHKLTCPHCNKSFQRPYRLRNHISKH 185          

HSP 2 Score: 53.1434 bits (126), Expect = 6.576e-8
Identity = 36/110 (32.73%), Postives = 49/110 (44.55%), Query Frame = 2
Query:  797 CTSSFNDSWHLKRHQYT-HTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSC--NSCSSKFYDSWHLKRH-QQVHLRK 1114
            C  +F     L  HQ + H   + +QC  C  +F    HL+RH   H+  KPFQC+ C         LKRH +      K + C    C+ +FY    L+ H   VHL K
Sbjct:   56 CDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEV---THTKSFICPEEGCNLRFYKHPQLRAHILSVHLHK 162          
BLAST of SMED30027210 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 68.5514 bits (166), Expect = 1.351e-12
Identity = 34/107 (31.78%), Postives = 54/107 (50.47%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSC--NSCSSKFYDSWHLKRHQ 1096
            + C  C   F+ + HL+ H  +H   KP+ C  C   F    +L+ H+++HT  KP+ C+ C   F    +L   HL  H K+KP+ C   +C+  F    ++K HQ
Sbjct:  593 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAA-HLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ 698          

HSP 2 Score: 62.3882 bits (150), Expect = 1.159e-10
Identity = 28/84 (33.33%), Postives = 40/84 (47.62%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQC--NECKSSFYDSWHLKRHHLQVH 1021
            +P+ C  C   F    +L+ H+  HT EKPY C +C   F    +L  H   H K+KPF C    C  +F    ++K H  + H
Sbjct:  619 KPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH 702          

HSP 3 Score: 58.5362 bits (140), Expect = 2.005e-9
Identity = 30/86 (34.88%), Postives = 42/86 (48.84%), Query Frame = 2
Query:  860 KPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K ++C  C   F  + HL+ H + H   KPF C+ C   F    +L R H ++H   KPYSC+ C  KF    +L  H   H + K
Sbjct:  591 KKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNL-RTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLK 675          
BLAST of SMED30027210 vs. Ensembl Yeast
Match: MIG3 (Transcriptional regulator; partially nonfunctional in S288C strains but has a major role in catabolite repression and ethanol response in some other strains; involved in response to toxic agents; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genesenvironment [Source:SGD;Acc:S000000830])

HSP 1 Score: 60.4622 bits (145), Expect = 2.681e-10
Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSL--CTSAFKDSWHLKRHQQIHTK 940
            RP+RC +C+  F+   H KRH  THT EKP++C++  C  +F  S  LKRH + HTK
Sbjct:   15 RPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTK 71          

HSP 2 Score: 48.521 bits (114), Expect = 1.545e-6
Identity = 24/60 (40.00%), Postives = 34/60 (56.67%), Query Frame = 2
Query:  854 NEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCN--ECKSSFYDSWHLKRHHLQVHVK 1027
            +++P++C +C+  F    H KRH + HT  KP +C    C  SF  S  LKR HL+ H K
Sbjct:   13 DQRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKR-HLRTHTK 71          
BLAST of SMED30027210 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 59.6918 bits (143), Expect = 6.816e-10
Identity = 40/128 (31.25%), Postives = 56/128 (43.75%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSR 1165
            + C +C   F   ++LK H  THTNE+P+ CS+C  AF      KRH+ +HT  K + C            LK          KP+    C  KF  S  L RH +    ++ I      TP +E +R
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVC---------GGKLK--------DGKPW---GCGKKFARSDALGRHFKTESGRRCI------TPLYEEAR 670          
BLAST of SMED30027210 vs. Ensembl Nematostella
Match: EDO26879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAT8])

HSP 1 Score: 102.834 bits (255), Expect = 1.205e-23
Identity = 59/147 (40.14%), Postives = 80/147 (54.42%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C   FS   HL+ H   H   +PY+C  C   F  S  LK H   H+ EKPY+C  C   F  S  +KRH +IHT  KP++C+EC + F +S  LKR HL +H   KP+ C+ C  +F  S  LK H ++H  +K
Sbjct:  192 IHTGKKPYKCDECGNCFSESAHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKR-HLVIHTGEKPHKCDDCGKRFTQSGDLKTHLRIHTGEK 337          

HSP 2 Score: 99.7525 bits (247), Expect = 1.166e-22
Identity = 56/148 (37.84%), Postives = 85/148 (57.43%), Query Frame = 2
Query:  674 TISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             I +  KP+ C+ C   F++   ++RH R H   +PY+C  C + F++S  LKRH   HT EKP++C  C   F  S  LK H +IHT  KP++C++C   F  S ++K+ H+++H   KPY C+ C   F +  +LK H  +H  KK
Sbjct:  247 VIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKRHLVIHTGEKPHKCDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKK-HVKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKK 393          

HSP 3 Score: 98.9821 bits (245), Expect = 2.165e-22
Identity = 59/147 (40.14%), Postives = 81/147 (55.10%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            + +  KP+ C+ C   F++H HL+ H   H   +PY+C  C   F  S  LK H   H+ EKPY+C  C   F  S  +KRH +IHT  KP++C+EC + F +S HLK  HL +H   KPY C+ C   F  S  LK H  +H  +K
Sbjct:  108 VHSGQKPYKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESAHLKA-HLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEK 253          

HSP 4 Score: 90.5077 bits (223), Expect = 1.736e-19
Identity = 46/117 (39.32%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  767 LNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            L+ +P++C  C   F  S  LK H   HT  KPY+C +C   F    HLK H  +H+  KP++C+EC   F    HLK  HL +H   KPY C+ C   F  S  LK H  +H  +K
Sbjct:   54 LSDKPHKCDECGKCFTQSGTLKTHLRIHTKVKPYECEVCGKCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHLKA-HLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSGEK 169          

HSP 5 Score: 60.8474 bits (146), Expect = 5.299e-10
Identity = 36/102 (35.29%), Postives = 53/102 (51.96%), Query Frame = 2
Query:  674 TISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSF 979
             I    KP  C+ C   F++   L+ H R H   +PY C  C   F  S ++K+H   H+ +KPY+C  C  +F +  +LK H  IH+  KP++C EC   F
Sbjct:  303 VIHTGEKPHKCDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCYECGKCF 404          
BLAST of SMED30027210 vs. Ensembl Nematostella
Match: EDO31838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWT3])

HSP 1 Score: 102.064 bits (253), Expect = 4.292e-23
Identity = 60/150 (40.00%), Postives = 84/150 (56.00%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYR---CTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I +  KP+ C++C   F+R   L  H   H   +PY+   C  C   FN S HLKRH   HT +KPY+C  C+  F  S  LK H +IH+  KP++C+ C   F +S +LKR HL +H   KPY C+ C   F +S +LK+H  +H  +K
Sbjct:  308 IHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKR-HLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQK 456          

HSP 2 Score: 100.523 bits (249), Expect = 1.479e-22
Identity = 56/147 (38.10%), Postives = 82/147 (55.78%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C   F+   +++ H R H   +PY+C  C   F +S +LK H   H+ EKPY+C  C   F  S  LKRH +IHT  KP++C++C   F  S ++K+ HL++H   KPY C+ C   F +  +LK H  +H  KK
Sbjct:  112 IHTGEKPYECDDCGKRFTLSGNMKTHLRIHSGKKPYKCDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKK-HLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKK 257          

HSP 3 Score: 97.8265 bits (242), Expect = 1.049e-21
Identity = 62/167 (37.13%), Postives = 85/167 (50.90%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPF---QCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRN 1168
            I +  KP+ C+ C   F+    L+ H   H   +PY+C  C   F  S +LKRH   H+ +KPY+C +C   F  S  L  H  IH+  KP+   +C+EC   F  S HLKR HL++H   KPY C  CS  F  S  LK H ++H  +K  + +      F  SRN
Sbjct:  252 IHSGKKPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKR-HLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCD-VCGKCFSESRN 416          

HSP 4 Score: 94.7449 bits (234), Expect = 1.108e-20
Identity = 47/116 (40.52%), Postives = 67/116 (57.76%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
              +PY+C  C   F++S  LKRH   HT EKP++C  C   F  S  LK H +IHT  KP++C++C   F  S ++K  HL++H   KPY C+ C   F +S +LK H  +H  +K
Sbjct:   59 GKKPYKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKT-HLRIHSGKKPYKCDECGKCFTESGNLKTHLMIHSGEK 173          

HSP 5 Score: 91.6633 bits (226), Expect = 1.139e-19
Identity = 55/140 (39.29%), Postives = 79/140 (56.43%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLR 1111
            KP  C+ C   F++  HL+RH + H   +PY C  C+  F  S  LK H   H+ +KPY+C +C   F +S +LKRH  IH+  KP++C+ C   F +S +LK+H L +H   KPY C+ C   F    +LK H  +H R
Sbjct:  344 KPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKH-LMIHSGQKPYKCDECGKCFILYRNLKTHLSIHSR 482          

HSP 6 Score: 90.8929 bits (224), Expect = 1.631e-19
Identity = 53/147 (36.05%), Postives = 78/147 (53.06%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            I    KP+ C+ C   F+   ++++H + H   +PY+C  C  SF +  +LK H   H+ +KPY+C  C   F +   LK H  IH+  KP++C+EC   F  S +LKR HL +H   KPY C+ C   F  S  L  H  +H  +K
Sbjct:  196 IHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKR-HLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQK 341          

HSP 7 Score: 87.4261 bits (215), Expect = 2.270e-18
Identity = 45/116 (38.79%), Postives = 63/116 (54.31%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
              +PY+C  C   F  + H   H   H+ +KPY+C  C   F +S  LKRH  IHT  KP +C++C   F  S  LK  HL++H   KPY C+ C  +F  S ++K H ++H  KK
Sbjct:   33 GKKPYKCDECGKCF--TQHANTHLRIHSGKKPYKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKT-HLRIHTGEKPYECDDCGKRFTLSGNMKTHLRIHSGKK 145          

HSP 8 Score: 82.0333 bits (201), Expect = 1.276e-16
Identity = 42/116 (36.21%), Postives = 60/116 (51.72%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
              + Y C  C   F     LK H   H+ +KPY+C  C   F  + H   H +IH+  KP++C+EC   F +S  LKR HL +H   KP+ C+ C  +F  S  LK H ++H  +K
Sbjct:    5 GQKRYNCDECGKCFTRHAQLKEHLVIHSGKKPYKCDECGKCF--TQHANTHLRIHSGKKPYKCDECGKCFSESGKLKR-HLMIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEK 117          

HSP 9 Score: 64.6994 bits (156), Expect = 4.727e-11
Identity = 33/90 (36.67%), Postives = 46/90 (51.11%), Query Frame = 2
Query:  848 HTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            H+ +K Y C  C   F     LK H  IH+  KP++C+EC   F    +    HL++H   KPY C+ C   F +S  LKRH  +H  +K
Sbjct:    3 HSGQKRYNCDECGKCFTRHAQLKEHLVIHSGKKPYKCDECGKCFTQHANT---HLRIHSGKKPYKCDECGKCFSESGKLKRHLMIHTGEK 89          

HSP 10 Score: 53.5286 bits (127), Expect = 1.386e-7
Identity = 32/88 (36.36%), Postives = 51/88 (57.95%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTK 940
            I +  KP+ C++C   FS   +L+RH   H   +PY+C +C   F++S +LK+H   H+ +KPY+C  C   F    +LK H  IH++
Sbjct:  395 IHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLSIHSR 482          
BLAST of SMED30027210 vs. Ensembl Nematostella
Match: EDO46570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU6])

HSP 1 Score: 97.8265 bits (242), Expect = 7.068e-23
Identity = 56/134 (41.79%), Postives = 75/134 (55.97%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRH 1093
            KPF C  C  +FS    + +H   H  T+PY+C  C  SFNDS  L RH  +HT EKP++C  C+ AF     L  H ++HT  KP++C  C  SF  S +L+RH L +H   +PY C+ C   F +  HL RH
Sbjct:   92 KPFKCEYCGRAFSDSLSIEKHLLVHTGTKPYKCQYCVRSFNDSQMLVRHIRSHTGEKPFKCKHCSMAFSKQSALIIHTRVHTGEKPYKCPHCTKSFSISGNLQRHIL-IHTGERPYKCSKCPKAFNNPSHLSRH 224          

HSP 2 Score: 90.1225 bits (222), Expect = 2.692e-20
Identity = 55/143 (38.46%), Postives = 75/143 (52.45%), Query Frame = 2
Query:  689 SKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             KPF C  C  +F R   L+ H   H   + Y+C  C   FND   L++H Y+HT  KP++C  C  AF DS  +++H  +HT  KP++C  C  SF DS  L R H++ H   KP+ C  CS  F     L  H +VH  +K
Sbjct:   35 EKPFKCPECQRAFCRADGLQCHMLVHNKKKMYKCNFCGKGFNDKIVLEKHIYSHTGVKPFKCEYCGRAFSDSLSIEKHLLVHTGTKPYKCQYCVRSFNDSQMLVR-HIRSHTGEKPFKCKHCSMAFSKQSALIIHTRVHTGEK 176          

HSP 3 Score: 89.3521 bits (220), Expect = 4.715e-20
Identity = 53/147 (36.05%), Postives = 77/147 (52.38%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            + N  K + CN C   F+    L +H  SH   +P++C  C  +F+DS  +++H   HT  KPY+C  C  +F DS  L RH + HT  KPF+C  C  +F     L  H  +VH   KPY C  C+  F  S +L+RH  +H  ++
Sbjct:   59 VHNKKKMYKCNFCGKGFNDKIVLEKHIYSHTGVKPFKCEYCGRAFSDSLSIEKHLLVHTGTKPYKCQYCVRSFNDSQMLVRHIRSHTGEKPFKCKHCSMAFSKQSALIIH-TRVHTGEKPYKCPHCTKSFSISGNLQRHILIHTGER 204          

HSP 4 Score: 75.8702 bits (185), Expect = 1.803e-15
Identity = 41/112 (36.61%), Postives = 58/112 (51.79%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            + C  C+  F    HL  H+ THT EKP++C  C  AF  +  L+ H  +H K K ++CN C   F D   L++ H+  H  VKP+ C  C   F DS  +++H  VH   K
Sbjct:   10 FTCRYCSKGFQWHSHLASHERTHTGEKPFKCPECQRAFCRADGLQCHMLVHNKKKMYKCNFCGKGFNDKIVLEK-HIYSHTGVKPFKCEYCGRAFSDSLSIEKHLLVHTGTK 120          
BLAST of SMED30027210 vs. Ensembl Nematostella
Match: EDO40121 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S835])

HSP 1 Score: 97.0561 bits (240), Expect = 7.918e-23
Identity = 50/117 (42.74%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  767 LNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            L  RPY+C  C+  F  +  LKRH  THT EKP QC  C   F  + +LKRH   HT  KP QC +C   F  + HLK H L  H + K + C  C   F  + HLKRH   H  +K
Sbjct:   26 LGERPYKCEQCSKCFEQAGTLKRHALTHTGEKPQQCPQCGKCFAQAGNLKRHVLTHTGEKPHQCLQCGKCFAQARHLKTHAL-THTRKKEHQCPQCGKCFSQAGHLKRHALTHTEEK 141          

HSP 2 Score: 87.8113 bits (216), Expect = 9.600e-20
Identity = 47/117 (40.17%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            + ++C  C   F+ + HLKRH  THT EKP+QC  C   F  + +LK H   HT  KP QC +C   F  + HLKRH L  H   KP+ C  C   F  + +LK H   H  +K  Q
Sbjct:  113 KEHQCPQCGKCFSQAGHLKRHALTHTEEKPHQCLQCGKCFTQAGNLKTHALTHTGEKPHQCLQCGKCFAQAGHLKRHAL-THTGEKPHQCLQCGKCFTQAGNLKTHALTHTGEKEHQ 228          

HSP 3 Score: 84.3445 bits (207), Expect = 1.860e-18
Identity = 47/117 (40.17%), Postives = 60/117 (51.28%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ 1126
            R + C L    F+ S H   H+ TH  E+PY+C  C+  F+ +  LKRH   HT  KP QC +C   F  + +LKRH L  H   KP+ C  C   F  + HLK H   H RKK  Q
Sbjct:    1 RSFECDLYGKCFSQSGHRNVHRRTHLGERPYKCEQCSKCFEQAGTLKRHALTHTGEKPQQCPQCGKCFAQAGNLKRHVL-THTGEKPHQCLQCGKCFAQARHLKTHALTHTRKKEHQ 116          

HSP 4 Score: 60.8474 bits (146), Expect = 1.678e-10
Identity = 28/67 (41.79%), Postives = 37/67 (55.22%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECK 970
              +P++C  C   F  + HLKRH  THT EKP+QC  C   F  + +LK H   HT  K  QC +C+
Sbjct:  167 GEKPHQCLQCGKCFAQAGHLKRHALTHTGEKPHQCLQCGKCFTQAGNLKTHALTHTGEKEHQCPQCR 233          
BLAST of SMED30027210 vs. Ensembl Nematostella
Match: EDO42127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2E0])

HSP 1 Score: 99.3673 bits (246), Expect = 1.969e-22
Identity = 57/155 (36.77%), Postives = 80/155 (51.61%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQ-QNCA 1138
            I    KPF C+ C  +  +   L +H+ +H   +PY+C  C   F     L+ H  THT EKPY C +C   F     LK HQ IHT  KPF+C+EC+ +F  +  L+  H+  H  VKP+ C+ C  +F  +   KRH  VH  +K  + Q C 
Sbjct:  172 IHTGEKPFKCDQCDFACIQSFDLVKHKFTHSGDKPYKCDSCPKQFTRPARLRDHMRTHTGEKPYVCDVCGKGFAIQTGLKSHQAIHTGDKPFKCDECEKTFRTALELQA-HMGRHTGVKPFKCDICDKEFISAITFKRHAIVHTGEKPYECQECG 325          

HSP 2 Score: 91.2781 bits (225), Expect = 1.006e-19
Identity = 50/152 (32.89%), Postives = 75/152 (49.34%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            K  + I    KPF C+ C  +F     L+ H   H   +P++C +C   F  +   KRH   HT EKPY+C  C   F  S  LK H  +H++ KP++C EC+  F     LK  H++ H   +P+ C+ C  +F    H   H ++H  +K
Sbjct:  251 KSHQAIHTGDKPFKCDECEKTFRTALELQAHMGRHTGVKPFKCDICDKEFISAITFKRHAIVHTGEKPYECQECGRRFARSTDLKVHLPVHSEDKPYKCGECEKMFTRFSTLKE-HIRTHTGERPFKCDECGREFNHRSHFNNHLRIHTGEK 401          

HSP 3 Score: 78.5666 bits (192), Expect = 1.421e-15
Identity = 41/107 (38.32%), Postives = 58/107 (54.21%), Query Frame = 2
Query:  797 CTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            C  +F  +  L RH + HT EKP++C  C  AF     LKRH +IHT  KPF+C++C  +   S+ L +H    H   KPY C+SC  +F     L+ H + H  +K
Sbjct:  128 CDKAFKTAAELSRHAFRHTGEKPHKCDQCEKAFIRYDDLKRHYRIHTGEKPFKCDQCDFACIQSFDLVKHKF-THSGDKPYKCDSCPKQFTRPARLRDHMRTHTGEK 233          

HSP 4 Score: 78.1814 bits (191), Expect = 1.513e-15
Identity = 50/154 (32.47%), Postives = 73/154 (47.40%), Query Frame = 2
Query:  662 KIEKTISNVSKPFLCN--LCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            ++ + +    KP +C    C  +F     L RH   H   +P++C  C  +F     LKRH   HT EKP++C  C  A   S+ L +H+  H+  KP++C+ C   F     L R H++ H   KPY C+ C   F     LK HQ +H   K
Sbjct:  109 RVHRRVHQEDKPHICEHEGCDKAFKTAAELSRHAFRHTGEKPHKCDQCEKAFIRYDDLKRHYRIHTGEKPFKCDQCDFACIQSFDLVKHKFTHSGDKPYKCDSCPKQFTRPARL-RDHMRTHTGEKPYVCDVCGKGFAIQTGLKSHQAIHTGDK 261          

HSP 5 Score: 64.3142 bits (155), Expect = 4.298e-11
Identity = 42/121 (34.71%), Postives = 57/121 (47.11%), Query Frame = 2
Query:  656 TNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQV 1018
            T K    +    KP+ C  C   F+R   L+ H   H   +PY+C  C   F     LK H  THT E+P++C  C   F    H   H +IHT  KPF+C+ C   F     L R+H++V
Sbjct:  305 TFKRHAIVHTGEKPYECQECGRRFARSTDLKVHLPVHSEDKPYKCGECEKMFTRFSTLKEHIRTHTGERPFKCDECGREFNHRSHFNNHLRIHTGEKPFKCDTCDKDFSRKASL-RYHMKV 424          

HSP 6 Score: 61.6178 bits (148), Expect = 3.478e-10
Identity = 40/121 (33.06%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  770 NTRPYRCTLCTSSFNDSWHLKRHQYTHTN-EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNE--CKSSFYDSWHLKRHHLQVHVKVKPYSC--NSCSSKFYDSWHLKRHQQVHLRKK 1117
              + ++C +C   FN + +L++H   HT  EKPY+C  C  AF +   L+ H   H++ +PF C++  C  SF +   L R H +VH + KP+ C    C   F  +  L RH   H  +K
Sbjct:   30 GEKQHKCEVCGKVFNYASNLRQHMLIHTGSEKPYECEYCDKAFNNPSSLRSHVLSHSEERPFVCDQEGCGKSFNNPGSL-RVHRRVHQEDKPHICEHEGCDKAFKTAAELSRHAFRHTGEK 149          

HSP 7 Score: 56.6102 bits (135), Expect = 1.214e-8
Identity = 42/140 (30.00%), Postives = 68/140 (48.57%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTH-TNEKPYQCSLCTSAFKDSWHLKRHQQIHTKI-KPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCN--SCSSKFYDSWHLKRHQQVHLRKK---VIQQNC--ATTPNFEVSRNGF 1174
            Y C +C  S+  SW    H   H + EK ++C +C   F  + +L++H  IHT   KP++C  C  +F +   L R H+  H + +P+ C+   C   F +   L+ H++VH   K      + C  A     E+SR+ F
Sbjct:    5 YTCDICHKSYIRSWSYYGHMREHASGEKQHKCEVCGKVFNYASNLRQHMLIHTGSEKPYECEYCDKAFNNPSSL-RSHVLSHSEERPFVCDQEGCGKSFNNPGSLRVHRRVHQEDKPHICEHEGCDKAFKTAAELSRHAF 143          
BLAST of SMED30027210 vs. Ensembl Medaka
Match: ENSORLT00000038558.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 119.398 bits (298), Expect = 2.393e-28
Identity = 61/143 (42.66%), Postives = 81/143 (56.64%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C +C   F + +HL RH   H   +PY CT+C   F   +HL+RH+ THT  KPY CSLC   F   +HL RH   HT +KP+ C+ C   F+  +HL RH L  H  VKPY+C+ C  +F+  +HL RH   H
Sbjct:  163 IHTGEKPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSL-THTGVKPYACSMCDMRFFQRYHLARHTLTH 304          

HSP 2 Score: 114.775 bits (286), Expect = 8.177e-27
Identity = 57/138 (41.30%), Postives = 79/138 (57.25%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C++C   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY C++C   F   + L+RH   HT +KP+ C  C   F+  +HL RH L  H+ VKPY+C  C  KF+  +HL RH   H
Sbjct:  280 KPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSL-THMGVKPYACTMCDMKFFQRYHLARHSLTH 416          

HSP 3 Score: 114.39 bits (285), Expect = 1.151e-26
Identity = 57/142 (40.14%), Postives = 79/142 (55.63%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C++C   F + +HL RH  +H   +PY CT+C   F   + L+RH  THT  KPY C++C   F   +HL RH   H  +KP+ C  C   F+  +HL RH L  H  VKPY+C  C  +F+  +HL RH   H+  K
Sbjct:  308 KPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSL-THTGVKPYACTMCDKRFFQRYHLARHSLTHMGVK 448          

HSP 4 Score: 113.62 bits (283), Expect = 1.932e-26
Identity = 60/163 (36.81%), Postives = 86/163 (52.76%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS 1180
            KP+ C +C   F + + L RH  +H   +PY CT+C   F   +HL RH  TH   KPY C++C   F   +HL RH   HT +KP+ C  C   F+  +HL RH L  H+ VKPY+C+ C  +F    HL+RH   H   +       ++P    +R+G V+
Sbjct:  336 KPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSL-THMGVKPYACSMCDMRFIQRNHLERHSLTHTGMR-------SSPGALPARSGTVA 490          

HSP 5 Score: 113.62 bits (283), Expect = 2.219e-26
Identity = 58/142 (40.85%), Postives = 79/142 (55.63%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C++C   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY CS+C   F   +HL RH   HT +KP+ C  C   F   + L+RH L  H  VKPY+C  C  +F+  +HL RH   H+  K
Sbjct:  252 KPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSL-THTGVKPYACTMCDKRFFQRYHLARHSLTHMGVK 392          

HSP 6 Score: 112.849 bits (281), Expect = 3.424e-26
Identity = 58/138 (42.03%), Postives = 78/138 (56.52%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C+LC   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY CS+C   F   +HL RH   HT +KP+ C+ C   F+  +HL RH L  H  VKPY+C  C  +F   + L+RH   H
Sbjct:  224 KPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTL-THTGVKPYACTMCDMRFIQRYQLERHSLTH 360          

HSP 7 Score: 109.768 bits (273), Expect = 3.677e-25
Identity = 47/106 (44.34%), Postives = 63/106 (59.43%), Query Frame = 2
Query:  788 CTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            C  C  +F   +HLKRH   HT EKPY C++C   F   +HL+RH  IHT +KP+ C  C   F+  +HL+RH L  H  VKPY+C+ C  +F+  +HL RH   H
Sbjct:  144 CDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKL-THTGVKPYACSLCDMRFFQRYHLARHTLTH 248          

HSP 8 Score: 81.6481 bits (200), Expect = 5.315e-16
Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  857 EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +K + C  C  AF+  +HLKRH  IHT  KP+ C  C   F   +HL+RH L +H  VKPY+C  C  +F+  +HL+RH+  H
Sbjct:  139 QKNFICDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERHSL-IHTGVKPYACTMCDMRFFQRYHLERHKLTH 220          
BLAST of SMED30027210 vs. Ensembl Medaka
Match: ENSORLT00000046979.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 119.398 bits (298), Expect = 2.508e-28
Identity = 61/143 (42.66%), Postives = 81/143 (56.64%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C +C   F + +HL RH   H   +PY CT+C   F   +HL+RH+ THT  KPY CSLC   F   +HL RH   HT +KP+ C+ C   F+  +HL RH L  H  VKPY+C+ C  +F+  +HL RH   H
Sbjct:  163 IHTGEKPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSL-THTGVKPYACSMCDMRFFQRYHLARHTLTH 304          

HSP 2 Score: 115.546 bits (288), Expect = 5.052e-27
Identity = 57/142 (40.14%), Postives = 81/142 (57.04%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C++C   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY C++C   F   + L+RH   HT +KP+ C  C   F+  +HL RH L  H+ VKPY+C  C  +F+  +HL RH   H+  K
Sbjct:  280 KPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSL-THMGVKPYACTMCDKRFFQRYHLARHSLTHMGVK 420          

HSP 3 Score: 112.849 bits (281), Expect = 3.553e-26
Identity = 58/138 (42.03%), Postives = 78/138 (56.52%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C+LC   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY CS+C   F   +HL RH   HT +KP+ C+ C   F+  +HL RH L  H  VKPY+C  C  +F   + L+RH   H
Sbjct:  224 KPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTL-THTGVKPYACTMCDMRFIQRYQLERHSLTH 360          

HSP 4 Score: 110.538 bits (275), Expect = 2.199e-25
Identity = 60/163 (36.81%), Postives = 83/163 (50.92%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS 1180
            KP+ C +C   F + + L RH  +H   +PY CT+C   F   +HL RH  TH   KPY C++C   F   +HL RH   H  +KPF C  C   F   +HL RH L  H  VKPY+C+ C  +F    HL+RH   H   +       ++P    +R+G V+
Sbjct:  336 KPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRHSL-THTGVKPYACSMCDMRFIQRNHLERHSLTHTGMR-------SSPGALPARSGTVA 490          

HSP 5 Score: 109.768 bits (273), Expect = 3.815e-25
Identity = 47/106 (44.34%), Postives = 63/106 (59.43%), Query Frame = 2
Query:  788 CTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            C  C  +F   +HLKRH   HT EKPY C++C   F   +HL+RH  IHT +KP+ C  C   F+  +HL+RH L  H  VKPY+C+ C  +F+  +HL RH   H
Sbjct:  144 CDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKL-THTGVKPYACSLCDMRFFQRYHLARHTLTH 248          

HSP 6 Score: 81.6481 bits (200), Expect = 5.459e-16
Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  857 EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +K + C  C  AF+  +HLKRH  IHT  KP+ C  C   F   +HL+RH L +H  VKPY+C  C  +F+  +HL+RH+  H
Sbjct:  139 QKNFICDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERHSL-IHTGVKPYACTMCDMRFFQRYHLERHKLTH 220          
BLAST of SMED30027210 vs. Ensembl Medaka
Match: ENSORLT00000027777.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 119.398 bits (298), Expect = 2.594e-28
Identity = 61/143 (42.66%), Postives = 81/143 (56.64%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C +C   F + +HL RH   H   +PY CT+C   F   +HL+RH+ THT  KPY CSLC   F   +HL RH   HT +KP+ C+ C   F+  +HL RH L  H  VKPY+C+ C  +F+  +HL RH   H
Sbjct:  163 IHTGEKPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSL-THTGVKPYACSMCDMRFFQRYHLARHTLTH 304          

HSP 2 Score: 115.161 bits (287), Expect = 8.674e-27
Identity = 57/138 (41.30%), Postives = 79/138 (57.25%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C++C   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY C++C   F   + L+RH   HT +KP+ C  C   F+  +HL RH L  H+ VKPY+C  C  KF+  +HL RH   H
Sbjct:  280 KPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSL-THMGVKPYACTMCDMKFFQRYHLARHSLTH 416          

HSP 3 Score: 114.39 bits (285), Expect = 1.219e-26
Identity = 57/142 (40.14%), Postives = 79/142 (55.63%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C++C   F + +HL RH  +H   +PY CT+C   F   + L+RH  THT  KPY C++C   F   +HL RH   H  +KP+ C  C   F+  +HL RH L  H  VKPY+C  C  +F+  +HL RH   H+  K
Sbjct:  308 KPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSL-THTGVKPYACTMCDKRFFQRYHLARHSLTHMGVK 448          

HSP 4 Score: 114.005 bits (284), Expect = 1.912e-26
Identity = 62/163 (38.04%), Postives = 86/163 (52.76%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS 1180
            KP+ C +C   F + +HL RH  +H+  +PY CT+C   F   +HL RH  THT  KPY C++C   F   +HL RH   H  +KPF C  C   F   +HL RH L  H  VKPY+C+ C  +F    HL+RH   H   +       ++P    +R+G V+
Sbjct:  364 KPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLARHSL-THTGVKPYACSMCDMRFIQRNHLERHSLTHTGMR-------SSPGALPARSGTVA 518          

HSP 5 Score: 113.62 bits (283), Expect = 2.362e-26
Identity = 58/142 (40.85%), Postives = 79/142 (55.63%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C++C   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY CS+C   F   +HL RH   HT +KP+ C  C   F   + L+RH L  H  VKPY+C  C  +F+  +HL RH   H+  K
Sbjct:  252 KPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSL-THTGVKPYACTMCDKRFFQRYHLARHSLTHMGVK 392          

HSP 6 Score: 113.235 bits (282), Expect = 3.702e-26
Identity = 58/138 (42.03%), Postives = 78/138 (56.52%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C+LC   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY CS+C   F   +HL RH   HT +KP+ C+ C   F+  +HL RH L  H  VKPY+C  C  +F   + L+RH   H
Sbjct:  224 KPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTL-THTGVKPYACTMCDMRFIQRYQLERHSLTH 360          

HSP 7 Score: 109.768 bits (273), Expect = 3.957e-25
Identity = 47/106 (44.34%), Postives = 63/106 (59.43%), Query Frame = 2
Query:  788 CTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            C  C  +F   +HLKRH   HT EKPY C++C   F   +HL+RH  IHT +KP+ C  C   F+  +HL+RH L  H  VKPY+C+ C  +F+  +HL RH   H
Sbjct:  144 CDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKL-THTGVKPYACSLCDMRFFQRYHLARHTLTH 248          

HSP 8 Score: 81.6481 bits (200), Expect = 5.022e-16
Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  857 EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +K + C  C  AF+  +HLKRH  IHT  KP+ C  C   F   +HL+RH L +H  VKPY+C  C  +F+  +HL+RH+  H
Sbjct:  139 QKNFICDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERHSL-IHTGVKPYACTMCDMRFFQRYHLERHKLTH 220          
BLAST of SMED30027210 vs. Ensembl Medaka
Match: ENSORLT00000032597.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 119.398 bits (298), Expect = 2.642e-28
Identity = 61/143 (42.66%), Postives = 81/143 (56.64%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C +C   F + +HL RH   H   +PY CT+C   F   +HL+RH+ THT  KPY CSLC   F   +HL RH   HT +KP+ C+ C   F+  +HL RH L  H  VKPY+C+ C  +F+  +HL RH   H
Sbjct:  163 IHTGEKPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSL-THTGVKPYACSMCDMRFFQRYHLARHTLTH 304          

HSP 2 Score: 114.39 bits (285), Expect = 1.386e-26
Identity = 58/142 (40.85%), Postives = 78/142 (54.93%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C++C   F + +HL RH  +H   +PY CT+C   F   + L+RH  THT  KPY C++C   F   +HL RH   H  +KPF C  C   F   +HL RH L  H  VKPY+C  C  +F+  +HL RH   H+  K
Sbjct:  308 KPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLARHSL-THTGVKPYACTMCDKRFFQRYHLARHSLTHMGVK 448          

HSP 3 Score: 113.62 bits (283), Expect = 2.405e-26
Identity = 58/142 (40.85%), Postives = 79/142 (55.63%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C++C   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY CS+C   F   +HL RH   HT +KP+ C  C   F   + L+RH L  H  VKPY+C  C  +F+  +HL RH   H+  K
Sbjct:  252 KPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSL-THTGVKPYACTMCDKRFFQRYHLARHSLTHMGVK 392          

HSP 4 Score: 112.849 bits (281), Expect = 3.806e-26
Identity = 58/138 (42.03%), Postives = 78/138 (56.52%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C+LC   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY CS+C   F   +HL RH   HT +KP+ C+ C   F+  +HL RH L  H  VKPY+C  C  +F   + L+RH   H
Sbjct:  224 KPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTL-THTGVKPYACTMCDMRFIQRYQLERHSLTH 360          

HSP 5 Score: 112.079 bits (279), Expect = 7.228e-26
Identity = 61/163 (37.42%), Postives = 86/163 (52.76%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS 1180
            KP+ C +C   F + +HL RH  +H+  +P+ CT+C   F   +HL RH  THT  KPY C++C   F   +HL RH   H  +KPF C  C   F   +HL RH L  H  VKPY+C+ C  +F    HL+RH   H   +       ++P    +R+G V+
Sbjct:  364 KPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRHSL-THTGVKPYACSMCDMRFIQRNHLERHSLTHTGMR-------SSPGALPARSGTVA 518          

HSP 6 Score: 111.694 bits (278), Expect = 1.042e-25
Identity = 54/138 (39.13%), Postives = 75/138 (54.35%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C +C   F + + L RH  +H   +PY CT+C   F   +HL RH  TH   KP+ C++C   F   +HL RH   HT +KP+ C  C   F+  +HL RH L  H+ VKP++C  C  +F   +HL RH   H
Sbjct:  336 KPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSL-THMGVKPFACTMCDMRFVQRYHLVRHSLTH 472          

HSP 7 Score: 111.309 bits (277), Expect = 1.436e-25
Identity = 55/138 (39.86%), Postives = 78/138 (56.52%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C++C   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY C++C   F   + L+RH   HT +KP+ C  C   F+  +HL RH L  H+ VKP++C  C  +F   +HL RH   H
Sbjct:  280 KPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSL-THMGVKPFACTMCDMRFVQRYHLARHSLTH 416          

HSP 8 Score: 109.768 bits (273), Expect = 4.030e-25
Identity = 47/106 (44.34%), Postives = 63/106 (59.43%), Query Frame = 2
Query:  788 CTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            C  C  +F   +HLKRH   HT EKPY C++C   F   +HL+RH  IHT +KP+ C  C   F+  +HL+RH L  H  VKPY+C+ C  +F+  +HL RH   H
Sbjct:  144 CDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKL-THTGVKPYACSLCDMRFFQRYHLARHTLTH 248          

HSP 9 Score: 81.6481 bits (200), Expect = 5.202e-16
Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  857 EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +K + C  C  AF+  +HLKRH  IHT  KP+ C  C   F   +HL+RH L +H  VKPY+C  C  +F+  +HL+RH+  H
Sbjct:  139 QKNFICDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERHSL-IHTGVKPYACTMCDMRFFQRYHLERHKLTH 220          
BLAST of SMED30027210 vs. Ensembl Medaka
Match: ENSORLT00000033968.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 119.398 bits (298), Expect = 2.742e-28
Identity = 61/143 (42.66%), Postives = 81/143 (56.64%), Query Frame = 2
Query:  677 ISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            I    KP+ C +C   F + +HL RH   H   +PY CT+C   F   +HL+RH+ THT  KPY CSLC   F   +HL RH   HT +KP+ C+ C   F+  +HL RH L  H  VKPY+C+ C  +F+  +HL RH   H
Sbjct:  163 IHTGEKPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSL-THTGVKPYACSMCDMRFFQRYHLARHTLTH 304          

HSP 2 Score: 114.775 bits (286), Expect = 9.166e-27
Identity = 57/138 (41.30%), Postives = 79/138 (57.25%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C++C   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY C++C   F   + L+RH   HT +KP+ C  C   F+  +HL RH L  H+ VKPY+C  C  KF+  +HL RH   H
Sbjct:  280 KPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSL-THMGVKPYACTMCDMKFFQRYHLARHSLTH 416          

HSP 3 Score: 114.39 bits (285), Expect = 1.265e-26
Identity = 57/142 (40.14%), Postives = 79/142 (55.63%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C++C   F + +HL RH  +H   +PY CT+C   F   + L+RH  THT  KPY C++C   F   +HL RH   H  +KP+ C  C   F+  +HL RH L  H  VKPY+C  C  +F+  +HL RH   H+  K
Sbjct:  308 KPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSL-THTGVKPYACTMCDKRFFQRYHLARHSLTHMGVK 448          

HSP 4 Score: 113.62 bits (283), Expect = 2.473e-26
Identity = 58/142 (40.85%), Postives = 79/142 (55.63%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            KP+ C++C   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY CS+C   F   +HL RH   HT +KP+ C  C   F   + L+RH L  H  VKPY+C  C  +F+  +HL RH   H+  K
Sbjct:  252 KPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSL-THTGVKPYACTMCDKRFFQRYHLARHSLTHMGVK 392          

HSP 5 Score: 113.235 bits (282), Expect = 3.110e-26
Identity = 62/163 (38.04%), Postives = 86/163 (52.76%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS 1180
            KP+ C +C   F + +HL RH  +H+  +PY CT+C   F   +HL RH  THT  KPY C++C   F   +HL RH   H  +KPF C  C   F   +HL RH L  H  VKPY+C+ C  +F    HL+RH   H   +       ++P    +R+G V+
Sbjct:  364 KPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRHSL-THTGVKPYACSMCDMRFIQRNHLERHSLTHTGMR-------SSPGALPARSGTVA 518          

HSP 6 Score: 112.849 bits (281), Expect = 3.948e-26
Identity = 58/138 (42.03%), Postives = 78/138 (56.52%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C+LC   F + +HL RH  +H   +PY C++C   F   +HL RH  THT  KPY CS+C   F   +HL RH   HT +KP+ C+ C   F+  +HL RH L  H  VKPY+C  C  +F   + L+RH   H
Sbjct:  224 KPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHTL-THTGVKPYACTMCDMRFIQRYQLERHSLTH 360          

HSP 7 Score: 112.464 bits (280), Expect = 5.441e-26
Identity = 55/138 (39.86%), Postives = 75/138 (54.35%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            KP+ C +C   F + + L RH  +H   +PY CT+C   F   +HL RH  TH   KPY C++C   F   +HL RH   HT +KP+ C  C   F+  +HL RH L  H+ VKP++C  C  +F   +HL RH   H
Sbjct:  336 KPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSL-THMGVKPFACTMCDMRFVQRYHLVRHSLTH 472          

HSP 8 Score: 109.768 bits (273), Expect = 4.067e-25
Identity = 47/106 (44.34%), Postives = 63/106 (59.43%), Query Frame = 2
Query:  788 CTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            C  C  +F   +HLKRH   HT EKPY C++C   F   +HL+RH  IHT +KP+ C  C   F+  +HL+RH L  H  VKPY+C+ C  +F+  +HL RH   H
Sbjct:  144 CDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKL-THTGVKPYACSLCDMRFFQRYHLARHTLTH 248          

HSP 9 Score: 81.6481 bits (200), Expect = 5.202e-16
Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  857 EKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVH 1105
            +K + C  C  AF+  +HLKRH  IHT  KP+ C  C   F   +HL+RH L +H  VKPY+C  C  +F+  +HL+RH+  H
Sbjct:  139 QKNFICDHCYGAFRSGYHLKRHILIHTGEKPYACAVCDMRFIQRYHLERHSL-IHTGVKPYACTMCDMRFFQRYHLERHKLTH 220          
BLAST of SMED30027210 vs. Planmine SMEST
Match: SMESG000027707.1 (SMESG000027707.1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 319/320 (99.69%), Postives = 320/320 (100.00%), Query Frame = 2
Query:  221 QVAPRFGNFMNDFNYYYAPVATSNFTSPINVFDQNMLHFGHFINDPKSRFQTRPTYFTNNWMKDFNSYNRCGFDVFPQLGQAQPNLSISPDRNASKNLMKALSQSDAISSAQCKNEPISVEXXXXXXXXXXXXXXXXKLSSLCNSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS 1180
            +VAPRFGNFMNDFNYYYAPVATSNFTSPINVFDQNMLHFGHFINDPKSRFQTRPTYFTNNWMKDFNSYNRCGFDVFPQLGQAQPNLSISPDRNASKNLMKALSQSDAISSAQCKNEPISVESAASINATSTASLITSKLSSLCNSTNKIEKTISNVSKPFLCNLCSASFSRHHHLRRHERSHLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS
Sbjct:    3 KVAPRFGNFMNDFNYYYAPVATSNFTSPINVFDQNMLHFGHFINDPKSRFQTRPTYFTNNWMKDFNSYNRCGFDVFPQLGQAQPNLSISPDRNASKNLMKALSQSDAISSAQCKNEPISVESAASINATSTASLITSKLSSLCNSTNKIEKTISNVSKPFLCNLCSASFSRHHHLRRHERSHLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS 322          
BLAST of SMED30027210 vs. Planmine SMEST
Match: SMESG000042947.1 (SMESG000042947.1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 319/320 (99.69%), Postives = 320/320 (100.00%), Query Frame = 2
Query:  221 QVAPRFGNFMNDFNYYYAPVATSNFTSPINVFDQNMLHFGHFINDPKSRFQTRPTYFTNNWMKDFNSYNRCGFDVFPQLGQAQPNLSISPDRNASKNLMKALSQSDAISSAQCKNEPISVEXXXXXXXXXXXXXXXXKLSSLCNSTNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS 1180
            +VAPRFGNFMNDFNYYYAPVATSNFTSPINVFDQNMLHFGHFINDPKSRFQTRPTYFTNNWMKDFNSYNRCGFDVFPQLGQAQPNLSISPDRNASKNLMKALSQSDAISSAQCKNEPISVESAASINATSTASLITSKLSSLCNSTNKIEKTISNVSKPFLCNLCSASFSRHHHLRRHERSHLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS
Sbjct:    3 KVAPRFGNFMNDFNYYYAPVATSNFTSPINVFDQNMLHFGHFINDPKSRFQTRPTYFTNNWMKDFNSYNRCGFDVFPQLGQAQPNLSISPDRNASKNLMKALSQSDAISSAQCKNEPISVESAASINATSTASLITSKLSSLCNSTNKIEKTISNVSKPFLCNLCSASFSRHHHLRRHERSHLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS 322          
BLAST of SMED30027210 vs. Planmine SMEST
Match: SMESG000000679.1 (SMESG000000679.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.464e-19
Identity = 51/141 (36.17%), Postives = 81/141 (57.45%), Query Frame = 2
Query:  686 VSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHL 1108
            + +P  C+LC  S++R   L+ H R+H   RP++C +C+ +F+   +L  H+  H+ EKP+ C +C   F  S  +  H + H+  +P++C+ C  +F DS  L +H  +VH   KPY C  C  KF  S +L RH +VHL
Sbjct:  313 LDEPNQCHLCGRSYARPSTLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKH-TRVHSGEKPYKCRICLLKFSQSGNLNRHMRVHL 452          

HSP 2 Score: 82.8037 bits (203), Expect = 1.431e-16
Identity = 41/114 (35.96%), Postives = 64/114 (56.14%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
             P +C LC  S+     LK H  TH+ E+P++C++C+  F    +L  H++IH+  KPF C+ C  +F  S  +   H++ H   +PY C+ CS  F DS  L +H +VH  +K
Sbjct:  315 EPNQCHLCGRSYARPSTLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTT-HMRTHSGERPYRCHHCSKAFSDSSTLTKHTRVHSGEK 427          

HSP 3 Score: 78.5666 bits (192), Expect = 3.097e-15
Identity = 47/124 (37.90%), Postives = 74/124 (59.68%), Query Frame = 2
Query:  653 STNKIEKTISNVSKPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHV 1024
            ST KI     +  +PF CN+CS +FS+  +L  H+R H   +P+ C +C  +F+ S  +  H  TH+ E+PY+C  C+ AF DS  L +H ++H+  KP++C  C   F  S +L R H++VH+
Sbjct:  330 STLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRVHSGEKPYKCRICLLKFSQSGNLNR-HMRVHL 452          
BLAST of SMED30027210 vs. Planmine SMEST
Match: SMESG000042630.1 (SMESG000042630.1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.983e-17
Identity = 46/114 (40.35%), Postives = 57/114 (50.00%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            RPY C +C  SF  S  L +H+ THT EK +QC  C   FK S  L  H  IHT  +PF C  C  SF+    +K+ H   H   KPY C  C   F  S +L  H + H  +K
Sbjct:  161 RPYECDICPKSFGHSVSLSQHRVTHTQEKQFQCPQCGKRFKRSSTLSTHLLIHTGNRPFPCPYCSKSFHQKSDMKK-HTYTHTGEKPYKCVVCGKAFSQSSNLITHSRKHSGEK 273          

HSP 2 Score: 73.1738 bits (178), Expect = 9.980e-14
Identity = 42/105 (40.00%), Postives = 56/105 (53.33%), Query Frame = 2
Query:  692 KPFLCNLCXXXXXXXXXXXXXXXXXLNTRPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRH 1006
            K F C  C   F R   L  H   H   RP+ C  C+ SF+    +K+H YTHT EKPY+C +C  AF  S +L  H + H+  KPF C++C   F  +  L+RH
Sbjct:  189 KQFQCPQCGKRFKRSSTLSTHLLIHTGNRPFPCPYCSKSFHQKSDMKKHTYTHTGEKPYKCVVCGKAFSQSSNLITHSRKHSGEKPFWCHKCSRGFQRNVDLRRH 293          

HSP 3 Score: 69.707 bits (169), Expect = 1.244e-12
Identity = 37/113 (32.74%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRH-QYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            ++C  C   F +S  L+ H + +H+  +PY+C +C  +F  S  L +H+  HT+ K FQC +C   F  S  L   HL +H   +P+ C  CS  F+    +K+H   H  +K
Sbjct:  134 FKCMRCKKYFPNSHGLEVHVRRSHSGRRPYECDICPKSFGHSVSLSQHRVTHTQEKQFQCPQCGKRFKRSSTLST-HLLIHTGNRPFPCPYCSKSFHQKSDMKKHTYTHTGEK 245          
BLAST of SMED30027210 vs. Planmine SMEST
Match: SMESG000005754.1 (SMESG000005754.1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.493e-17
Identity = 40/112 (35.71%), Postives = 62/112 (55.36%), Query Frame = 2
Query:  782 YRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRHQQVHLRKK 1117
            Y C++C   F    +LK HQ THT E+P+ C  C   F    HL++H  +HT  KP +C+ C   F  + +LK  H+++H   KP+ C  C +KF    HL+ H ++H  ++
Sbjct:  387 YNCSVCKKIFGQLSNLKVHQRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKT-HMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNER 497          

HSP 2 Score: 80.8777 bits (198), Expect = 7.076e-16
Identity = 37/106 (34.91%), Postives = 59/106 (55.66%), Query Frame = 2
Query:  776 RPYRCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIHTKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHLKRH 1093
            RP+ C  C   F    HL++H   HT EKP++CS+C+  F  + +LK H ++H   KPF+C  CK+ F    HL+  HL++H   +P+ C  C+  +     ++ H
Sbjct:  413 RPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQL-HLRLHTNERPFICPRCNKCYISISGIRTH 517          
The following BLAST results are available for this feature:
BLAST of SMED30027210 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF791.601e-2644.93zinc finger protein 79 [Source:HGNC Symbol;Acc:HGN... [more]
ZNF791.782e-2644.93zinc finger protein 79 [Source:HGNC Symbol;Acc:HGN... [more]
ZNF792.473e-2644.93zinc finger protein 79 [Source:HGNC Symbol;Acc:HGN... [more]
ZNF792.473e-2644.93zinc finger protein 79 [Source:HGNC Symbol;Acc:HGN... [more]
ZNF4543.523e-2641.50zinc finger protein 454 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30027210 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
che-11.682e-2038.18Transcription factor che-1 [Source:UniProtKB/Swis... [more]
che-19.082e-2038.18Transcription factor che-1 [Source:UniProtKB/Swis... [more]
blmp-13.916e-1935.19B lymphocyte-induced maturation protein 1 homolog ... [more]
blmp-14.227e-1935.19B lymphocyte-induced maturation protein 1 homolog ... [more]
fezf-19.192e-1735.86FEZ Family zinc finger protein [Source:UniProtKB/... [more]
back to top
BLAST of SMED30027210 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clamp1.486e-2438.78gene:FBgn0032979 transcript:FBtr0085964[more]
Clamp1.773e-2438.78gene:FBgn0032979 transcript:FBtr0100407[more]
gl6.105e-2339.04gene:FBgn0004618 transcript:FBtr0083584[more]
gl6.703e-2339.04gene:FBgn0004618 transcript:FBtr0330042[more]
CG173855.671e-2136.75gene:FBgn0033934 transcript:FBtr0087517[more]
back to top
BLAST of SMED30027210 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf740a1.797e-2841.96zinc finger protein 740a [Source:ZFIN;Acc:ZDB-GENE... [more]
si:dkeyp-44d3.13.203e-2842.86si:dkeyp-44d3.1 [Source:ZFIN;Acc:ZDB-GENE-120709-2... [more]
znf740a3.677e-2840.00zinc finger protein 740a [Source:ZFIN;Acc:ZDB-GENE... [more]
CZQB01141835.13.016e-2746.15zinc finger protein 883-like [Source:NCBI gene;Acc... [more]
znf10017.338e-2740.13zinc finger protein 1001 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30027210 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd637.900e-2641.72CD63 molecule [Source:Xenbase;Acc:XB-GENE-1015227][more]
ENSXETT00000047530.11.284e-2542.86pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
ENSXETT00000022840.11.724e-2540.13pep primary_assembly:Xenopus_tropicalis_v9.1:6:128... [more]
nosip4.892e-2540.82nitric oxide synthase interacting protein [Source:... [more]
synrg5.399e-2540.82synergin, gamma [Source:Xenbase;Acc:XB-GENE-993541... [more]
back to top
BLAST of SMED30027210 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm144447.053e-2740.13predicted gene 14444 [Source:MGI Symbol;Acc:MGI:36... [more]
Gm71459.748e-2742.59predicted gene 7145 [Source:MGI Symbol;Acc:MGI:364... [more]
Gm144061.058e-2640.13predicted gene 14406 [Source:MGI Symbol;Acc:MGI:36... [more]
Zfp4542.515e-2640.82zinc finger protein 454 [Source:MGI Symbol;Acc:MGI... [more]
Zfp4542.515e-2640.82zinc finger protein 454 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30027210 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08DG8|ZN135_BOVIN6.876e-2643.62Zinc finger protein 135 OS=Bos taurus OX=9913 GN=Z... [more]
sp|Q15937|ZNF79_HUMAN8.557e-2644.93Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q8N9F8|ZN454_HUMAN1.692e-2541.50Zinc finger protein 454 OS=Homo sapiens OX=9606 GN... [more]
sp|Q6ECI4|ZN470_HUMAN2.378e-2539.74Zinc finger protein 470 OS=Homo sapiens OX=9606 GN... [more]
sp|Q08ER8|ZN543_HUMAN5.607e-2542.18Zinc finger protein 543 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of SMED30027210 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A444V1U04.208e-3148.34Zinc finger protein 3 OS=Acipenser ruthenus OX=790... [more]
H2YDD74.443e-3049.66Uncharacterized protein OS=Ciona savignyi OX=51511... [more]
H2YDE45.200e-3049.66Uncharacterized protein OS=Ciona savignyi OX=51511... [more]
H2YDE05.513e-3049.66Uncharacterized protein OS=Ciona savignyi OX=51511... [more]
H2YDD95.635e-3049.66Uncharacterized protein OS=Ciona savignyi OX=51511... [more]
back to top
BLAST of SMED30027210 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000043605.14.267e-3140.83pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000011527.21.639e-3045.45pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000047628.11.335e-2844.90pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000000012.24.538e-2845.27pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033231.14.944e-2845.45zinc finger protein 239-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30027210 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009822.12.839e-2444.76pep scaffold:Pmarinus_7.0:GL479431:4162:28680:-1 g... [more]
ENSPMAT00000006856.12.200e-2337.27pep scaffold:Pmarinus_7.0:GL476534:515915:516469:1... [more]
ENSPMAT00000009820.11.791e-2244.06pep scaffold:Pmarinus_7.0:GL479431:4162:28680:-1 g... [more]
ENSPMAT00000002403.12.310e-2239.50pep scaffold:Pmarinus_7.0:GL486389:4672:6368:-1 ge... [more]
ENSPMAT00000002487.15.188e-2236.36pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1... [more]
back to top
BLAST of SMED30027210 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP11.101e-1337.86Zinc-regulated transcription factor; binds to zinc... [more]
PZF17.326e-1337.50Transcription factor IIIA (TFIIIA); essential DNA ... [more]
AZF11.351e-1231.78Zinc-finger transcription factor; involved in diau... [more]
MIG32.681e-1047.37Transcriptional regulator; partially nonfunctional... [more]
CRZ16.816e-1031.25Transcription factor, activates transcription of s... [more]
back to top
BLAST of SMED30027210 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO268791.205e-2340.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318384.292e-2340.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465707.068e-2341.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401217.918e-2342.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421271.969e-2236.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027210 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038558.12.393e-2842.66gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
ENSORLT00000046979.12.508e-2842.66gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
ENSORLT00000027777.12.594e-2842.66gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
ENSORLT00000032597.12.642e-2842.66gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
ENSORLT00000033968.12.742e-2842.66gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
back to top
BLAST of SMED30027210 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027707.10.000e+099.69SMESG000027707.1[more]
SMESG000042947.10.000e+099.69SMESG000042947.1[more]
SMESG000000679.11.464e-1936.17SMESG000000679.1[more]
SMESG000042630.14.983e-1740.35SMESG000042630.1[more]
SMESG000005754.17.493e-1735.71SMESG000005754.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027210 ID=SMED30027210|Name=SMED30027210|organism=Schmidtea mediterranea sexual|type=transcript|length=1678bp
TTACATTATTTTAATAATAAATGAAAAGTCTTTATTTCAAATATTTTAAT
TAACTTAATAAATAATATTTATTTTTGCTATATTTATTTTTCAATTGATG
AATTTAAGGATCATTTTATAATTTGCCAAACTAATTGACTTATTTTATTT
AAAACGTAGTTAAGATTATATTTTAAGTTCTATAATGCAAACTAATTTTT
TTGTCAGACCTGAATTTAATCAAGTAGCTCCAAGATTTGGAAATTTTATG
AATGATTTTAATTATTATTACGCCCCAGTTGCTACTAGCAATTTTACATC
TCCTATTAATGTATTTGATCAAAATATGTTACATTTTGGGCATTTTATTA
ATGATCCAAAGTCTCGATTTCAAACGAGACCAACTTATTTTACCAATAAT
TGGATGAAAGATTTTAATTCGTACAATCGATGTGGATTTGATGTCTTTCC
TCAGTTGGGTCAAGCGCAACCTAATCTGTCTATAAGTCCTGATAGAAATG
CTTCCAAAAACCTTATGAAAGCTCTTTCACAATCAGATGCCATTTCATCA
GCACAGTGTAAAAATGAACCTATATCAGTTGAAAGTGCAGCTTCGATAAA
TGCAACTTCAACTGCTTCTTTGATTACTAGTAAACTTTCCTCATTGTGTA
ATTCAACAAATAAAATAGAAAAAACTATTTCAAATGTATCAAAACCATTT
TTATGTAATTTGTGTTCGGCATCATTTTCCCGACATCATCATTTGCGTCG
TCATGAGCGTTCGCATCTCAATACGCGCCCATATCGATGTACATTGTGTA
CATCATCTTTCAATGACTCTTGGCACCTCAAACGACATCAATATACTCAC
ACAAACGAGAAGCCTTATCAGTGTTCTCTGTGCACATCGGCATTCAAGGA
TTCGTGGCATTTAAAGCGTCATCAGCAGATCCACACCAAAATCAAGCCAT
TTCAGTGCAACGAATGCAAATCGAGCTTCTATGACTCGTGGCATTTGAAG
CGACATCATTTGCAAGTCCATGTCAAAGTCAAACCGTATTCATGCAATAG
CTGCAGTTCGAAGTTCTATGACTCGTGGCATTTGAAACGCCATCAGCAAG
TTCATTTACGAAAGAAAGTTATCCAACAAAATTGCGCAACAACTCCGAAT
TTTGAGGTTTCCAGAAATGGATTTGTTTCTTGAATAATAATAAATCTCCC
GCCTCCCTCTTATTTGAGAATGTGTGTCAATTATTGATAATTTTTCAGTT
TTTAATGTACAGTATTAATATATAAATAAATAATTTGTTACCGCGCGTAG
ACAGACTGTCTACTTCATTGTGAATGTGTTCTCATTATTTTTCAGCTGTA
TATTTTATCAACATGTAGTTAATTTTATCAATAATAATAATTTTCTATTT
TAGATTTAGATGTGTGCGTGTACGTTGTAATTTTTAAAACAATGTGATTA
CCAATGACAACATAGATTTTGCGCAATCTTTGAGTTAATTATCTATAAAT
ATATATATTCATTTTTGCATGAAGCACGGCAATCTATTTGTTATTTCTTT
TTTTCATTTTGACAAATATATTTTTATAACTTTGCGATTATAGCTATTTA
TTATTTGTTGTCAGTAGTGTAATATACAGACAATCCGACTGTTGGTTTAT
CTACTTTGTAAATAAAAATTTGTAAGCC
back to top

protein sequence of SMED30027210-orf-1

>SMED30027210-orf-1 ID=SMED30027210-orf-1|Name=SMED30027210-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=333bp
MQTNFFVRPEFNQVAPRFGNFMNDFNYYYAPVATSNFTSPINVFDQNMLH
FGHFINDPKSRFQTRPTYFTNNWMKDFNSYNRCGFDVFPQLGQAQPNLSI
SPDRNASKNLMKALSQSDAISSAQCKNEPISVESAASINATSTASLITSK
LSSLCNSTNKIEKTISNVSKPFLCNLCSASFSRHHHLRRHERSHLNTRPY
RCTLCTSSFNDSWHLKRHQYTHTNEKPYQCSLCTSAFKDSWHLKRHQQIH
TKIKPFQCNECKSSFYDSWHLKRHHLQVHVKVKPYSCNSCSSKFYDSWHL
KRHQQVHLRKKVIQQNCATTPNFEVSRNGFVS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003677DNA binding
GO:0008270zinc ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 200..222
e-value: 0.0059
score: 25.8
coord: 172..194
e-value: 0.3
score: 20.1
coord: 285..307
e-value: 0.11
score: 21.6
coord: 228..250
e-value: 0.0035
score: 26.6
coord: 256..279
e-value: 0.18
score: 20.9
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 228..250
e-value: 9.3E-4
score: 19.5
coord: 200..222
e-value: 0.0042
score: 17.5
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 258..279
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 202..222
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 287..307
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 174..194
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 230..250
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 228..255
score: 13.277
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 256..284
score: 11.884
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 172..199
score: 13.588
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 200..227
score: 14.316
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 285..312
score: 11.448
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 255..277
e-value: 3.7E-7
score: 31.8
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 226..254
e-value: 2.5E-12
score: 48.3
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 164..199
e-value: 1.2E-7
score: 33.3
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 278..308
e-value: 1.6E-7
score: 33.3
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 200..225
e-value: 8.0E-12
score: 46.8
NoneNo IPR availablePANTHERPTHR24390:SF141coord: 161..274
coord: 194..308
NoneNo IPR availablePANTHERPTHR24390FAMILY NOT NAMEDcoord: 161..274
coord: 194..308
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 208..265
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 254..307
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 170..222