Ornithine decarboxylase

Overview
NameOrnithine decarboxylase
Smed IDSMED30027207
Length (bp)1488
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ornithine decarboxylase (SMED30027207) t-SNE clustered cells

Violin plots show distribution of expression levels for Ornithine decarboxylase (SMED30027207) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ornithine decarboxylase (SMED30027207) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ornithine decarboxylase (SMED30027207) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027207

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30027207SMESG000055750.1 dd_Smed_v4_5493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027207SMESG000055750.1 dd_Smed_v4_5493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027207SMESG000055750.1 SMED30027207smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30027207SMESG000055750.1 SMED30027207smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30027207SMESG000055750.1 dd_Smed_v6_5493_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027207SMESG000055750.1 dd_Smed_v4_5493_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30027207SMESG000055750.1 dd_Smed_v4_5493_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30027207SMESG000055750.1 H.63.4csmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30027207SMESG000055750.1 H.63.4csmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: ODC1 (ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:HGNC:8109])

HSP 1 Score: 261.922 bits (668), Expect = 1.590e-81
Identity = 154/435 (35.40%), Postives = 232/435 (53.33%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMV--LNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSN-DTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG I+ +HLRW K  PRV P+++VKC   + ++  L   G  FDCAS+ EI++V  L   P     RII+ NP K    + YA+N G+++ +FDS  EL ++ +  P+AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DVVG+SFH G  C D   + +A+  +  V  +    GF   +++IGGGF G    S + K K    +EEI   +N  L+KY+P ++G +IIA PGR+Y+  A+TLA  +I K+ +   + + S                            ++E       ++Y ++DGVYGSFN +++ D+          K  L K    D K Y S I+GPTCD  D +    ++PE+   +W+++ +MGAYT A+ + FNG   P IYY +S    QLM
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPP----ERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRL---SVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG----SEDVKLK----FEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIV-LKEQTGS----------------------------DDEDESSEQTFMYYVNDGVYGSFNCILY-DHAHV-------KPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLM 417          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: ODC1 (ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:HGNC:8109])

HSP 1 Score: 261.922 bits (668), Expect = 1.590e-81
Identity = 154/435 (35.40%), Postives = 232/435 (53.33%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMV--LNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSN-DTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG I+ +HLRW K  PRV P+++VKC   + ++  L   G  FDCAS+ EI++V  L   P     RII+ NP K    + YA+N G+++ +FDS  EL ++ +  P+AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DVVG+SFH G  C D   + +A+  +  V  +    GF   +++IGGGF G    S + K K    +EEI   +N  L+KY+P ++G +IIA PGR+Y+  A+TLA  +I K+ +   + + S                            ++E       ++Y ++DGVYGSFN +++ D+          K  L K    D K Y S I+GPTCD  D +    ++PE+   +W+++ +MGAYT A+ + FNG   P IYY +S    QLM
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPP----ERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRL---SVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG----SEDVKLK----FEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIV-LKEQTGS----------------------------DDEDESSEQTFMYYVNDGVYGSFNCILY-DHAHV-------KPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLM 417          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: AZIN2 (antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:29957])

HSP 1 Score: 216.083 bits (549), Expect = 8.695e-64
Identity = 138/422 (32.70%), Postives = 215/422 (50.95%), Query Frame = 3
Query:  132 GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLS 1394
             FF  DLG IV +H  + K  PRV P+++VKC     V+ +L +LG+ F CA++AE+E+V +  IP+    +II  NP K    + YA+  GI+L SFD+  EL ++ +  P AK++L IA   T +       + KFG        LLE A     +VVG+SFH G  C D  A+++++  +  V ++    G    ++++GGGF G            ++ +EEI S +N+ L+ Y+PE  G  I A  GR+Y+  A+T+A  +I K+ +             L   H+ T    SE          EE    +   +Y LD+GVYG FN ++F +   T   IL       K S +   Y S ++GP  D  DC+   + +P+L   +WL++ +MGAYT    + F G  + +I Y +S
Sbjct:   40 AFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPA---SKIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIA---TDDSHSLSCLSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFPG--------TEGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLDQPGR---EAPLPPPHIATCA-ASEPS-----PPAEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPT--PILQ-----KKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMS 431          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: AZIN2 (antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:29957])

HSP 1 Score: 214.542 bits (545), Expect = 2.555e-63
Identity = 136/422 (32.23%), Postives = 214/422 (50.71%), Query Frame = 3
Query:  132 GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLS 1394
             FF  DLG IV +H  + K  PRV P+++VKC     V+ +L +LG+ F CA++AE+E+V +  IP+    +II  NP K    + YA+  GI+L SFD+  EL ++ +  P AK++L IA   T +       + KFG        LLE A     +VVG+SFH G  C D  A+++++  +  V ++    G    ++++GGGF G            ++ +EEI S +N+ L+ Y+PE  G  I A  GR+Y+  A+T+A  +I K+          +V +D                    P + EE    +   +Y LD+GVYG FN ++F +   T   IL       K S +   Y S ++GP  D  DC+   + +P+L   +WL++ +MGAYT    + F G  + +I Y +S
Sbjct:   40 AFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPAS---KIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIA---TDDSHSLSCLSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFPGT--------EGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKK----------EVLLD-------------------QPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPT--PILQ-----KKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMS 411          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: AZIN2 (antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:29957])

HSP 1 Score: 214.542 bits (545), Expect = 2.555e-63
Identity = 136/422 (32.23%), Postives = 214/422 (50.71%), Query Frame = 3
Query:  132 GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLS 1394
             FF  DLG IV +H  + K  PRV P+++VKC     V+ +L +LG+ F CA++AE+E+V +  IP+    +II  NP K    + YA+  GI+L SFD+  EL ++ +  P AK++L IA   T +       + KFG        LLE A     +VVG+SFH G  C D  A+++++  +  V ++    G    ++++GGGF G            ++ +EEI S +N+ L+ Y+PE  G  I A  GR+Y+  A+T+A  +I K+          +V +D                    P + EE    +   +Y LD+GVYG FN ++F +   T   IL       K S +   Y S ++GP  D  DC+   + +P+L   +WL++ +MGAYT    + F G  + +I Y +S
Sbjct:   40 AFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPAS---KIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIA---TDDSHSLSCLSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFPGT--------EGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKK----------EVLLD-------------------QPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPT--PILQ-----KKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMS 411          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: odc-1 (Ornithine decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:P41931])

HSP 1 Score: 227.254 bits (578), Expect = 4.008e-69
Identity = 141/423 (33.33%), Postives = 219/423 (51.77%), Query Frame = 3
Query:  135 FFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQ-FHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEE 1400
            F  VDL  I+ +   WK+  P +EP+++VKC  D  +I IL  LG  FDCAS+ EI++V+ T  S E  RII+ NP K R  + +A +  +++ +FD+  EL ++ ++ P A+++LRIA S   +         KFGA      P LL+ A     +VVGISFH G  C+D SA+  A++ +  + ++ E  GF   II++GGGF G          +    +E+I   + + L++++P+ N  ++IA PGR +  G ++L   +I       ++  ASK+  D +    H                         GY+Y ++DGVYGSFN ++F         + D   N        +++ S I+GPTCD+ D +     MP++   EWL + DMGAYT A+ T FNG   P   Y +SEE
Sbjct:   42 FMLVDLDKIIERFQLWKRELPMIEPFYAVKCNTDLVLIRILASLGCGFDCASKDEIDIVMGTGVSAE--RIIYANPCKTRSFIAHAMDRDVKMMTFDNPEELLKIAKLHPNAEMILRIAVS---DPTATCPLNLKFGADPIIAAPQLLKTASEEGINVVGISFHVGSGCNDASAYRNALQHAKNLCEIGEGLGFKMDIIDMGGGFPGA---------EHHNPFEKIAETIRDALDEFFPDTN-KRLIAEPGRFFAAGPFSLVANII-----HATEVPASKITKDPKDCADH-------------------------GYMYYINDGVYGSFNCILFDHAHPIGSPLFDTDRN--------EKFMSTIWGPTCDSLDLVEDKKLMPKMNVGEWLYYPDMGAYTLAAATTFNGFSKPVPMYVMSEE 411          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: F53F10.2 (pep chromosome:WBcel235:I:3832239:3834124:1 gene:WBGene00018764.1 transcript:F53F10.2a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53F10.2)

HSP 1 Score: 102.834 bits (255), Expect = 2.656e-23
Identity = 98/424 (23.11%), Postives = 178/424 (41.98%), Query Frame = 3
Query:  135 FFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINIL-NRLGVNFDCASQAEIEMV-LNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEE 1400
            FF +D+  I  +    + + PRV P ++V C  D  +  +L N + VNF+ ++ AE+E+V +N  PS    R +F +    RK +  A   G      +S  ++  +    P+A+++L +    +  +         FG    +I  +L+ A  +  +V GI    G+     +     +   +  + + E    D K + +     G   +           +   C+ LNN ++  +  E+     A+ GR  +  A+TL T VIGKR ++                    ++ ++          N++F     G++Y  +DGVYGSF           L   LD + +     ++ + +   I GPT D  D     ++  +LR  EWL+W  MGA+T    ++ +    P +YYY  +E
Sbjct:   57 FFVMDVAAIERRLEALRVMLPRVRPNYAVACNADPVLARVLSNNIDVNFEVSNTAELELVSMNVEPS----RAVFCSQLMTRKAIKNAVLAGCSTFVVESEKQVTDVMNASPEAEIILAVCLPYSTGEV-------PFGCSVDEIEEILDMAHLLGANVTGIYLELGLR----ATLEDYITSVHDARSIFETA--DQKFLTLRRVCFGNLSVPTGADGAVNNEFMSFCNSLNNVIDDLF--ESNIDFSASIGRFLVTNAFTLCTNVIGKRAMD--------------------AKFIT----------NDDF-DDGVGFVYQTNDGVYGSFGCKQMD--IKPLCKPLDVEND-----SEEQLHFGTILGPTLDGTDVAQRLMKSRQLRVGEWLVWEQMGAFTIPVDSEHS---VPPVYYYSGKE 420          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: F53F10.2 (pep chromosome:WBcel235:I:3831117:3834124:1 gene:WBGene00018764.1 transcript:F53F10.2a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53F10.2)

HSP 1 Score: 102.834 bits (255), Expect = 2.656e-23
Identity = 98/424 (23.11%), Postives = 178/424 (41.98%), Query Frame = 3
Query:  135 FFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINIL-NRLGVNFDCASQAEIEMV-LNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEE 1400
            FF +D+  I  +    + + PRV P ++V C  D  +  +L N + VNF+ ++ AE+E+V +N  PS    R +F +    RK +  A   G      +S  ++  +    P+A+++L +    +  +         FG    +I  +L+ A  +  +V GI    G+     +     +   +  + + E    D K + +     G   +           +   C+ LNN ++  +  E+     A+ GR  +  A+TL T VIGKR ++                    ++ ++          N++F     G++Y  +DGVYGSF           L   LD + +     ++ + +   I GPT D  D     ++  +LR  EWL+W  MGA+T    ++ +    P +YYY  +E
Sbjct:   57 FFVMDVAAIERRLEALRVMLPRVRPNYAVACNADPVLARVLSNNIDVNFEVSNTAELELVSMNVEPS----RAVFCSQLMTRKAIKNAVLAGCSTFVVESEKQVTDVMNASPEAEIILAVCLPYSTGEV-------PFGCSVDEIEEILDMAHLLGANVTGIYLELGLR----ATLEDYITSVHDARSIFETA--DQKFLTLRRVCFGNLSVPTGADGAVNNEFMSFCNSLNNVIDDLF--ESNIDFSASIGRFLVTNAFTLCTNVIGKRAMD--------------------AKFIT----------NDDF-DDGVGFVYQTNDGVYGSFGCKQMD--IKPLCKPLDVEND-----SEEQLHFGTILGPTLDGTDVAQRLMKSRQLRVGEWLVWEQMGAFTIPVDSEHS---VPPVYYYSGKE 420          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: F53F10.2 (pep chromosome:WBcel235:I:3830562:3834120:1 gene:WBGene00018764.1 transcript:F53F10.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53F10.2)

HSP 1 Score: 102.834 bits (255), Expect = 2.656e-23
Identity = 98/424 (23.11%), Postives = 178/424 (41.98%), Query Frame = 3
Query:  135 FFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINIL-NRLGVNFDCASQAEIEMV-LNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEE 1400
            FF +D+  I  +    + + PRV P ++V C  D  +  +L N + VNF+ ++ AE+E+V +N  PS    R +F +    RK +  A   G      +S  ++  +    P+A+++L +    +  +         FG    +I  +L+ A  +  +V GI    G+     +     +   +  + + E    D K + +     G   +           +   C+ LNN ++  +  E+     A+ GR  +  A+TL T VIGKR ++                    ++ ++          N++F     G++Y  +DGVYGSF           L   LD + +     ++ + +   I GPT D  D     ++  +LR  EWL+W  MGA+T    ++ +    P +YYY  +E
Sbjct:   57 FFVMDVAAIERRLEALRVMLPRVRPNYAVACNADPVLARVLSNNIDVNFEVSNTAELELVSMNVEPS----RAVFCSQLMTRKAIKNAVLAGCSTFVVESEKQVTDVMNASPEAEIILAVCLPYSTGEV-------PFGCSVDEIEEILDMAHLLGANVTGIYLELGLR----ATLEDYITSVHDARSIFETA--DQKFLTLRRVCFGNLSVPTGADGAVNNEFMSFCNSLNNVIDDLF--ESNIDFSASIGRFLVTNAFTLCTNVIGKRAMD--------------------AKFIT----------NDDF-DDGVGFVYQTNDGVYGSFGCKQMD--IKPLCKPLDVEND-----SEEQLHFGTILGPTLDGTDVAQRLMKSRQLRVGEWLVWEQMGAFTIPVDSEHS---VPPVYYYSGKE 420          
BLAST of Ornithine decarboxylase vs. Ensembl Fly
Match: Odc1 (gene:FBgn0013307 transcript:FBtr0088863)

HSP 1 Score: 187.193 bits (474), Expect = 5.327e-54
Identity = 123/416 (29.57%), Postives = 199/416 (47.84%), Query Frame = 3
Query:  144 VDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFH-KIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYY 1388
             DL  +  +   W+KL PR++P+++VKC  D  V+ +L +LG  FDCAS+ E+++VL    S E  RIIF NP +    + YA    +   + D+  E+ +L   +P + L++R   S  KE Q  L   +KFG         L+  A S++  V G SFH G  C +  A+ +A++K+  + K     G+D   ++IGGGF G           +++ +E+I   +N  +++++P+E  + IIA PGR ++  A TL  ++  KR +    N A K++                                    +Y L+DGVYGSFN +++          LD   +L          KS I+GP+CD  D +   + +P L   + L + +MGAYT    + FNG   P   Y+
Sbjct:   36 CDLSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDVSPE--RIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRF-KSEAKEAQCPLG--DKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPG----------SDDVKFEKIAESVNTSVQRHFPDERVH-IIAEPGRFFVAAACTLVCKIHAKREIR---NEAGKLDT----------------------------------VMYYLNDGVYGSFNCILYDHQVVIAEHYLDNAESL-------PHLKSLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYF 391          
BLAST of Ornithine decarboxylase vs. Ensembl Fly
Match: Odc2 (gene:FBgn0013308 transcript:FBtr0088864)

HSP 1 Score: 157.918 bits (398), Expect = 3.922e-43
Identity = 118/416 (28.37%), Postives = 196/416 (47.12%), Query Frame = 3
Query:  147 DLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNT-EKFGAQ-FHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYY 1388
            DL  +  +   W KL PR+EP+++VKC  D  V+  L  LG  FDCAS+ E+++VL    S E  RIIF +P +    + YA    +   + D+  E+ +L++ +P + L++R  +    E ++AL    +K+G         L+  A ++   V G SFH G  C +  A+ +A+EK+  + K+ E  G   +++++GGGF G   I +E       ++EEI   +N  +E  +P++   +II+ PGR ++  AYTL  +V  KR +   D                                      K    +Y L+DG++G+F  + +          LD   +L K        KS I+GP+CD  D +   + +P L   + L + +MGAYT    + FNG   P   ++
Sbjct:   37 DLSSLERKLRLWHKLMPRIEPHYAVKCNDDPVVVKFLADLGTGFDCASKNELKLVLGLGVSPE--RIIFAHPCRPASHLRYAKEQQVVNGTVDNEYEIYKLRKHYPDSNLIVRFKS----EAKKALCPLGDKYGCDAEADAAALMLLAKALGLKVTGTSFHVGSGCSEVEAYDRAIEKAENIFKVGEMIGHKMELLDVGGGFPG---IDDE-------MFEEIAQSVNTSVELRFPDKR-IRIISEPGRFFVEAAYTLICKVHAKREVRSKDG-------------------------------------KLDTMMYYLNDGIFGAFAGMFYYPEEVAPELYLDEAESLPK-------LKSVIWGPSCDAMDKI-SDLLLPNLNPGDLLGFRNMGAYTMPIASPFNGFDVPETRFF 390          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: odc1 (ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GENE-010816-1])

HSP 1 Score: 266.929 bits (681), Expect = 1.356e-83
Identity = 150/432 (34.72%), Postives = 234/432 (54.17%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG ++ +HLRW ++ PR+ P+++VKC   + V+  L  LG  FDCAS+ EI++V +     +  RII+ NP K    + YAS  G+++ +FDS  EL ++ +    AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DV+G+SFH G  C D   +S+A+  +  V  +    G++  +++IGGGF G    S + K K    +EEI + +N  L+KY+P ++G +IIA PGR+Y+  AYTLA  +I K+ +   + SAS                             EE V  +   +Y ++DGVYGSFN +++ D+   L  +        K   D + Y   I+GPTCD  D +     +P+++  +WL++ +MGAYT A+ + FNG   P+IYY +S    Q M
Sbjct:   35 DDKDAFYVADLGDVLKKHLRWLRVLPRITPFYAVKCNDSRAVVTTLASLGAGFDCASKTEIQIVQSV--GVDPSRIIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHENAKLVLRIATDDSKAVCRL---SVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARYVFDIGAELGYNMSLLDIGGGFPG----SEDTKLK----FEEIAAVINPALDKYFPVDSGVRIIAEPGRYYVASAYTLAVNIIAKKVI-MKEQSAS---------------------------DEEEDVSNDRTLMYYVNDGVYGSFNCILY-DHAHVLPTLH------KKPKPDERMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIYYIMSRTAWQCM 418          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: odc1 (ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GENE-010816-1])

HSP 1 Score: 266.929 bits (681), Expect = 1.356e-83
Identity = 150/432 (34.72%), Postives = 234/432 (54.17%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG ++ +HLRW ++ PR+ P+++VKC   + V+  L  LG  FDCAS+ EI++V +     +  RII+ NP K    + YAS  G+++ +FDS  EL ++ +    AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DV+G+SFH G  C D   +S+A+  +  V  +    G++  +++IGGGF G    S + K K    +EEI + +N  L+KY+P ++G +IIA PGR+Y+  AYTLA  +I K+ +   + SAS                             EE V  +   +Y ++DGVYGSFN +++ D+   L  +        K   D + Y   I+GPTCD  D +     +P+++  +WL++ +MGAYT A+ + FNG   P+IYY +S    Q M
Sbjct:   35 DDKDAFYVADLGDVLKKHLRWLRVLPRITPFYAVKCNDSRAVVTTLASLGAGFDCASKTEIQIVQSV--GVDPSRIIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHENAKLVLRIATDDSKAVCRL---SVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARYVFDIGAELGYNMSLLDIGGGFPG----SEDTKLK----FEEIAAVINPALDKYFPVDSGVRIIAEPGRYYVASAYTLAVNIIAKKVI-MKEQSAS---------------------------DEEEDVSNDRTLMYYVNDGVYGSFNCILY-DHAHVLPTLH------KKPKPDERMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIYYIMSRTAWQCM 418          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: odc1 (ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GENE-010816-1])

HSP 1 Score: 266.929 bits (681), Expect = 1.356e-83
Identity = 150/432 (34.72%), Postives = 234/432 (54.17%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG ++ +HLRW ++ PR+ P+++VKC   + V+  L  LG  FDCAS+ EI++V +     +  RII+ NP K    + YAS  G+++ +FDS  EL ++ +    AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DV+G+SFH G  C D   +S+A+  +  V  +    G++  +++IGGGF G    S + K K    +EEI + +N  L+KY+P ++G +IIA PGR+Y+  AYTLA  +I K+ +   + SAS                             EE V  +   +Y ++DGVYGSFN +++ D+   L  +        K   D + Y   I+GPTCD  D +     +P+++  +WL++ +MGAYT A+ + FNG   P+IYY +S    Q M
Sbjct:   35 DDKDAFYVADLGDVLKKHLRWLRVLPRITPFYAVKCNDSRAVVTTLASLGAGFDCASKTEIQIVQSV--GVDPSRIIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHENAKLVLRIATDDSKAVCRL---SVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARYVFDIGAELGYNMSLLDIGGGFPG----SEDTKLK----FEEIAAVINPALDKYFPVDSGVRIIAEPGRYYVASAYTLAVNIIAKKVI-MKEQSAS---------------------------DEEEDVSNDRTLMYYVNDGVYGSFNCILY-DHAHVLPTLH------KKPKPDERMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIYYIMSRTAWQCM 418          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: azin1b (antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-030121-1])

HSP 1 Score: 185.652 bits (470), Expect = 6.300e-53
Identity = 126/429 (29.37%), Postives = 202/429 (47.09%), Query Frame = 3
Query:  129 HGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHE--KHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYS--NDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
            + F   DLG ++ QH+ WK   P V P++ V C     VI +L+ LGV F CA++AE  +VL    SH+     II +   K    + +A+  GI     ++  EL ++ +  P+AKL+L+++   T+ Q    S T   G        LLE A  +   V G++F     C D  A++ A+  +  +  + +  GFD  I++IGGGF G            E   +++ S +   LE Y+P E+G  IIA PG  ++   +TLA  VIGK+                   +LHTS    ++ S   P+           ++Y ++DGVYGSF   +F +   T         +++K S   D   + S ++GP+CD  D +     +PEL   +WL++ +MGA        F+    P +YY +S +D
Sbjct:   38 NAFVVADLGALMRQHVVWKTTMPLVRPFYPVSCNSSPVVIELLSALGVGFVCANKAETTLVL----SHDVPPENIILSGVCKQLSLIKHAAKTGINFLLCENEAELRKIARAHPEAKLLLQVS---TEAQIEEASVT--IGCSLKGCRHLLELAKELNVSVAGVTFQVPASCKDPQAYTHALSDARCIFDMGKELGFDMNILDIGGGFSGS-----------EFQLKQVHSVIRPLLEAYFPSESGVSIIAEPGNFFVFSCFTLAVNVIGKKA---------------AYRNLHTSTH-DKLTSSDAPE-----------FVYYMNDGVYGSFMGRLFGNIIST--------PSVHKMSLTLDEPVFSSSLWGPSCDPLDQVVERCLLPELAVGDWLVFSNMGASGQEGPATFSDTDQPPVYYTISTDD 411          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: azin1b (antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-030121-1])

HSP 1 Score: 185.652 bits (470), Expect = 6.300e-53
Identity = 126/429 (29.37%), Postives = 202/429 (47.09%), Query Frame = 3
Query:  129 HGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHE--KHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYS--NDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
            + F   DLG ++ QH+ WK   P V P++ V C     VI +L+ LGV F CA++AE  +VL    SH+     II +   K    + +A+  GI     ++  EL ++ +  P+AKL+L+++   T+ Q    S T   G        LLE A  +   V G++F     C D  A++ A+  +  +  + +  GFD  I++IGGGF G            E   +++ S +   LE Y+P E+G  IIA PG  ++   +TLA  VIGK+                   +LHTS    ++ S   P+           ++Y ++DGVYGSF   +F +   T         +++K S   D   + S ++GP+CD  D +     +PEL   +WL++ +MGA        F+    P +YY +S +D
Sbjct:   38 NAFVVADLGALMRQHVVWKTTMPLVRPFYPVSCNSSPVVIELLSALGVGFVCANKAETTLVL----SHDVPPENIILSGVCKQLSLIKHAAKTGINFLLCENEAELRKIARAHPEAKLLLQVS---TEAQIEEASVT--IGCSLKGCRHLLELAKELNVSVAGVTFQVPASCKDPQAYTHALSDARCIFDMGKELGFDMNILDIGGGFSGS-----------EFQLKQVHSVIRPLLEAYFPSESGVSIIAEPGNFFVFSCFTLAVNVIGKKA---------------AYRNLHTSTH-DKLTSSDAPE-----------FVYYMNDGVYGSFMGRLFGNIIST--------PSVHKMSLTLDEPVFSSSLWGPSCDPLDQVVERCLLPELAVGDWLVFSNMGASGQEGPATFSDTDQPPVYYTISTDD 411          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: dym (dymeclin [Source:Xenbase;Acc:XB-GENE-5729291])

HSP 1 Score: 270.781 bits (691), Expect = 6.920e-85
Identity = 158/432 (36.57%), Postives = 234/432 (54.17%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG IV +H+RW K  PRV P+++VKC   + ++  L+ LG  FDCAS+ EI++V +   S E  RII+ NP K    + YA++ G+E  +FDS  EL ++ +  P AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  D++G+SFH G  C D   + +AV  +  V  +    GF+  +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++G  IIA PGR+Y+  A+TLA  +I K           KV V+ QS                    +EE    +   +Y ++DGVYGSFN ++F D+      +        K   D   Y S I+GPTCD  D +    ++PEL+  +W+++ +MGAYT A+ + FNG   P +YY +S    QLM
Sbjct:   35 DDKDAFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQLVQSIGVSSE--RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPG----SEDVKLK----FEEITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAK-----------KVMVNEQSG-----------------SDDEEDAANDKTLMYYVNDGVYGSFNCILF-DHAHVKPVL------TKKPKPDESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVMSRPHWQLM 418          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: dym (dymeclin [Source:Xenbase;Acc:XB-GENE-5729291])

HSP 1 Score: 270.011 bits (689), Expect = 1.292e-84
Identity = 158/432 (36.57%), Postives = 234/432 (54.17%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG IV +H+RW K  PRV P+++VKC   + ++  L+ LG  FDCAS+ EI++V +   S E  RII+ NP K    + YA++ G+E  +FDS  EL ++ +  P AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  D++G+SFH G  C D   + +AV  +  V  +    GF+  +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++G  IIA PGR+Y+  A+TLA  +I K           KV V+ QS                    +EE    +   +Y ++DGVYGSFN ++F D+      +        K   D   Y S I+GPTCD  D +    ++PEL+  +W+++ +MGAYT A+ + FNG   P +YY +S    QLM
Sbjct:   35 DDKDAFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQLVQSIGVSSE--RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPG----SEDVKLK----FEEITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAK-----------KVMVNEQSG-----------------SDDEEDAANDKTLMYYVNDGVYGSFNCILF-DHAHVKPVL------TKKPKPDESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVMSRPHWQLM 418          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: dym (dymeclin [Source:Xenbase;Acc:XB-GENE-5729291])

HSP 1 Score: 266.544 bits (680), Expect = 1.269e-83
Identity = 155/426 (36.38%), Postives = 231/426 (54.23%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSE 1397
            D    F+  DLG IV +H+RW K  PRV P+++VKC   + ++  L+ LG  FDCAS+ EI++V +   S E  RII+ NP K    + YA++ G+E  +FDS  EL ++ +  P AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  D++G+SFH G  C D   + +AV  +  V  +    GF+  +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++G  IIA PGR+Y+  A+TLA  +I K           KV V+ QS                    +EE    +   +Y ++DGVYGSFN ++F D+      +        K   D   Y S I+GPTCD  D +    ++PEL+  +W+++ +MGAYT A+ + FNG   P +YY +S 
Sbjct:   35 DDKDAFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQLVQSIGVSSE--RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPG----SEDVKLK----FEEITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAK-----------KVMVNEQSG-----------------SDDEEDAANDKTLMYYVNDGVYGSFNCILF-DHAHVKPVL------TKKPKPDESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVMSR 412          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: slc20a2 (solute carrier family 20 (phosphate transporter), member 2 [Source:Xenbase;Acc:XB-GENE-1015057])

HSP 1 Score: 246.899 bits (629), Expect = 7.687e-76
Identity = 142/420 (33.81%), Postives = 230/420 (54.76%), Query Frame = 3
Query:  132 GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYL 1391
             FF  DLG +V +HLR+ K  PRV+P+++VKC   + V+ IL  LG  FDCAS+ EIE+V +   + E  RII+ NP K    + +A+  G+++ +FD+  EL ++ +  P A+++LRIA  ++K   R    + KFGA       LLE A ++  DV+G+SFH G  C D  A+++A+  +  V ++   +G++  +++IGGGF G            +I +EE+   +N  L+ Y+PE +  +IIA PGR+Y+  A++LA  +I K+ +   ++S S                            ++E    N   +Y ++DGVYGSFN L+F D+      IL       K S D   Y S ++GPTCD  D +  ++ +PE    +WL++ +MGAYT A+ ++FNG     ++Y +
Sbjct:   38 AFFVADLGDVVKKHLRFLKALPRVKPFYAVKCNSSRGVVKILAELGAGFDCASKTEIELVQDIGVTPE--RIIYANPCKQISQIKFAAKTGVQMMTFDNEVELSKVSRNHPNARMVLRIATDDSKSSARL---SVKFGAPLKSCRRLLEMAKNLSVDVIGVSFHVGSGCTDSKAYTQAIADARLVFEMASEFGYNMWLLDIGGGFPG--------TEDSKIRFEEMAGVINPALDLYFPEGSDVQIIAEPGRYYVTSAFSLAVNIIAKKEV-LMEHSGS----------------------------DDEENGPNKNIMYYVNDGVYGSFNCLVF-DHAHP-KPILH-----KKPSPDQPLYTSSLWGPTCDGLDQIAENLLLPEHHVGDWLLFENMGAYTIAASSNFNGFQQSPVHYAM 408          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: cstf2 (cleavage stimulation factor, 3' pre-RNA, subunit 2 [Source:Xenbase;Acc:XB-GENE-979047])

HSP 1 Score: 213.001 bits (541), Expect = 2.305e-63
Identity = 132/425 (31.06%), Postives = 216/425 (50.82%), Query Frame = 3
Query:  126 GH--GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYL 1391
            GH   F+  DLG I  +H R+ K  PRV+P+++VKC    +V+ +L  LG  FDCAS  EI+MVL   +P+ +   I++ NP K    + YA+  G+   +FD   EL ++    P+A+++LRI A++ ++   ALS+  K+GA   +   LL+ A ++   V+G+SFH G  C +  ++ KA+E + +V ++ +  G+  ++++IGGGF G S             +EE    +   L +Y+P     +II+ PGR+Y+  A+T+A  +I K+ +   D ++ +                                     + YIL+DGVYG+F         F L+        L     D K + S ++GPTC   D L     +PEL T +W+I+ +MGAY+ +  T FNG   P +Y+ L
Sbjct:   28 GHQDAFYVADLGDIKQKHWRFMKELPRVKPFYAVKCNSTNEVLQMLATLGTGFDCASMGEIDMVLRMGVPAAD---IVYANPCKQVSHIKYAAAHGVCKMTFDCEAELFKIAAFHPKAEMILRI-ATDDRDAWCALSS--KYGALVEQCEDLLKTAKNLNIQVIGVSFHTGSGCKNTHSFCKAIEDARKVFEIGKKLGYQMRLLDIGGGFSGNSEFRPT--------FEEFADVIRQSLNQYFPNNKEVEIISEPGRYYVESAFTVALNIITKKEVYEKDGNSRR------------------------------------KFSYILNDGVYGTF-------LDFYLVKEKQKLKPLLGKVCDQKLFPSNLWGPTCTNVDKLVNEFYLPELETGDWVIFPNMGAYSISMSTTFNGFPQPKVYFVL 395          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Odc1 (ornithine decarboxylase, structural 1 [Source:MGI Symbol;Acc:MGI:97402])

HSP 1 Score: 267.314 bits (682), Expect = 8.762e-84
Identity = 153/434 (35.25%), Postives = 234/434 (53.92%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSN-DTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG I+ +HLRW K  PRV P+++VKC   + +++ L  +G  FDCAS+ EI++V    +P+    R+I+ NP K    + YA++ G+++ +FDS  EL ++ +  P+AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DV+G+SFH G  C D   + +AV  +  V  +    GF   +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++G +IIA PGR+Y+  A+TLA  +I K+ +                                 P  ++E       ++Y ++DGVYGSFN +++ D+          K  L K    D K Y S I+GPTCD  D +     +PE+   +W+++ +MGAYT A+ + FNG   PNIYY +S    QLM
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPA---ERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPG----SEDTKLK----FEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKE-----------------------------QPGSDDEDESNEQTFMYYVNDGVYGSFNCILY-DHAHV-------KALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMWQLM 417          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Azin2 (antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:2442093])

HSP 1 Score: 211.075 bits (536), Expect = 3.042e-62
Identity = 130/422 (30.81%), Postives = 214/422 (50.71%), Query Frame = 3
Query:  132 GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLS 1394
             FF  DLG +V +H  + K  PRV P+++V C     V+ +L  LG+ F CA++AE+E+V +  +P+    +II  NP K    + YA+  G+ L SFD+  EL ++ +  P AK++L IA   T++       + +FGA       LLE A     +VVG+SFH G  C D  A+++++  +  V ++ E  G    I+++GGGF G            ++ +EE+ S +N+ L+ Y+PE  G  I+A  GR+Y+  A+T+A  ++ KR  E  D ++                   E Q+   PK            +Y LD+GVYG FN ++F +   T            K S D   Y S ++GP  +  DC+   + +P+L+  +WL++ +MGAYT  +++   G  +  + Y +S
Sbjct:   40 AFFVADLGAVVRKHFCFLKHLPRVRPFYAVGCNSSLGVLKVLAELGLGFSCANKAEMELVQHIGVPA---SKIICANPCKQVAQIKYAAKHGVRLLSFDNEVELAKVVKSHPSAKMVLCIA---TQDSHSLNHLSLRFGASLKSCRHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFQMGEELGHTMNILDLGGGFPG--------LEGAKVRFEEMASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKR--EVLDQAS------------------REEQTGAAPKS----------IVYYLDEGVYGVFNSVLFDNTCPT-------PALQKKPSADQPLYSSSLWGPAVEGCDCVAEGLWLPQLQVGDWLVFDNMGAYTVDTKSLLGGTQARRVTYAMS 410          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Azin2 (antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:2442093])

HSP 1 Score: 211.075 bits (536), Expect = 3.042e-62
Identity = 130/422 (30.81%), Postives = 214/422 (50.71%), Query Frame = 3
Query:  132 GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLS 1394
             FF  DLG +V +H  + K  PRV P+++V C     V+ +L  LG+ F CA++AE+E+V +  +P+    +II  NP K    + YA+  G+ L SFD+  EL ++ +  P AK++L IA   T++       + +FGA       LLE A     +VVG+SFH G  C D  A+++++  +  V ++ E  G    I+++GGGF G            ++ +EE+ S +N+ L+ Y+PE  G  I+A  GR+Y+  A+T+A  ++ KR  E  D ++                   E Q+   PK            +Y LD+GVYG FN ++F +   T            K S D   Y S ++GP  +  DC+   + +P+L+  +WL++ +MGAYT  +++   G  +  + Y +S
Sbjct:   40 AFFVADLGAVVRKHFCFLKHLPRVRPFYAVGCNSSLGVLKVLAELGLGFSCANKAEMELVQHIGVPA---SKIICANPCKQVAQIKYAAKHGVRLLSFDNEVELAKVVKSHPSAKMVLCIA---TQDSHSLNHLSLRFGASLKSCRHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFQMGEELGHTMNILDLGGGFPG--------LEGAKVRFEEMASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKR--EVLDQAS------------------REEQTGAAPKS----------IVYYLDEGVYGVFNSVLFDNTCPT-------PALQKKPSADQPLYSSSLWGPAVEGCDCVAEGLWLPQLQVGDWLVFDNMGAYTVDTKSLLGGTQARRVTYAMS 410          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Ldc1 (leucine decarboxylase 1 [Source:MGI Symbol;Acc:MGI:2685699])

HSP 1 Score: 207.608 bits (527), Expect = 3.104e-61
Identity = 131/431 (30.39%), Postives = 210/431 (48.72%), Query Frame = 3
Query:  132 GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMV--LNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPS-IEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
             F   DL  +V +H  + +  PRV+P+++VKC  +  V+ +L  LG  FDCASQ E+E V  L   PS    RIIF NP K    + +A+  G++L +FD+  EL +L +  P+A+L+LRI    T + Q       KFGA       LL+ A  +   VVG SFH G  C    ++ +A+   ++V ++    G    ++++GGGF G  V  +E K      +EE+   +N  L +Y+PEE G ++IA PGR Y     T A  +I K           K ++D                    P  + +         Y L++G YG F + +        + +        ++ ++   +   +YGPTCD +D LF + +++PEL   +WLI+ DMGAY+++  + FNG     +Y  +S +   L+
Sbjct:   51 AFMVADLDVLVSRHRTFLQALPRVQPFYAVKCNSNPWVLLVLAALGTGFDCASQGELEQVLGLGVAPS----RIIFANPCKAVSHIQFAARCGVQLLTFDNEEELIKLARYHPRARLVLRI---QTLDSQSTFPLHTKFGAHLEACGHLLQVARELGLAVVGASFHVGSDCHTPESYRQAIADCHRVFEMGCKAGHHMSLLDLGGGFPG--VKGSEAK------FEEVARVINTALAQYFPEETGIEVIAEPGRFYAGSVCTAAVNIIVK-----------KSSLD--------------------PGGHRKLA-------YYLNEGHYGVFRLFLRDPVPRIPIVV-------KEFPSEPPLFPCTLYGPTCDAYDRLFSTEVQLPELDVGDWLIFPDMGAYSSSMSSTFNGFPIATVYDAMSPQLRSLL 421          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Azin1 (antizyme inhibitor 1 [Source:MGI Symbol;Acc:MGI:1859169])

HSP 1 Score: 200.29 bits (508), Expect = 3.265e-58
Identity = 127/425 (29.88%), Postives = 206/425 (48.47%), Query Frame = 3
Query:  129 HGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
            + FF  DLG IV +H +W+ +  +++P+++VKC     V+ IL  LG  F C+S+ E+ +V     S E   IIFT+P K    + YA+ VG+ + + D+  EL ++ +  P AK++L IA   T++         KFG        LLE A  +   ++G+ FH    C ++  +  A+  +  V  +   +GF   +++IGGGF G            EI  EE+   ++  L+ Y+PE +G +II+ PG +Y+  A+TLA  +I K+ +E                     +  S V+  G              ++Y ++DGVYGSF   +  D    L  I +      KY  D   + S ++GP+CD  D +  S  +PEL   +WLI+ +MGA +    + FN    P IY+ +S  D
Sbjct:   38 NAFFVGDLGKIVKKHSQWQTVVAQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPE--NIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIA---TEDNIGGEDGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTGT-----------EIQLEEVNHVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVE-------------------NDKFSSGVEKNG---------SDEPAFVYYMNDGVYGSFASKLSED----LNTIPEVH---KKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSD 411          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P27120|DCOR1_XENLA (Ornithine decarboxylase 1 OS=Xenopus laevis OX=8355 GN=odc1-a PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 6.770e-85
Identity = 159/432 (36.81%), Postives = 235/432 (54.40%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  D G IV +H+RW K  PRV P+++VKC   + ++  L+ LG  FDCAS+ EI++V +   S E  RII+ NP K    + YA++ G+E  +FDS  EL ++ +  P AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  D++G+SFH G  C D   + +AV  +  V  +    GF+  +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++G KIIA PGR+Y+  ++TLA  +I K           KV V+ QS                    +EE    +   +Y ++DGVYGSFN ++F D+      +        K   D K Y S I+GPTCD  D +    E+PEL+  +W+++ +MGAYT A+ + FNG   P +YY +S    QLM
Sbjct:   35 DDKDAFYVADFGDIVKKHVRWFKALPRVTPFYAVKCNDGKAIVKTLSILGAGFDCASKTEIQLVQSIGVSPE--RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPG----SEDVKLK----FEEITSVINPALDKYFPADSGVKIIAEPGRYYVASSFTLAVNIIAK-----------KVMVNEQSG-----------------SDDEEDAANDKTLMYYVNDGVYGSFNCILF-DHAHVKPVLT------KKPKPDEKFYSSSIWGPTCDGLDRIVERFELPELQVGDWMLFENMGAYTVAAASTFNGFQRPTLYYVMSRPHWQLM 418          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P00860|DCOR_MOUSE (Ornithine decarboxylase OS=Mus musculus OX=10090 GN=Odc1 PE=1 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 6.129e-83
Identity = 153/434 (35.25%), Postives = 234/434 (53.92%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSN-DTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG I+ +HLRW K  PRV P+++VKC   + +++ L  +G  FDCAS+ EI++V    +P+    R+I+ NP K    + YA++ G+++ +FDS  EL ++ +  P+AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DV+G+SFH G  C D   + +AV  +  V  +    GF   +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++G +IIA PGR+Y+  A+TLA  +I K+ +                                 P  ++E       ++Y ++DGVYGSFN +++ D+          K  L K    D K Y S I+GPTCD  D +     +PE+   +W+++ +MGAYT A+ + FNG   PNIYY +S    QLM
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPA---ERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPG----SEDTKLK----FEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKE-----------------------------QPGSDDEDESNEQTFMYYVNDGVYGSFNCILY-DHAHV-------KALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMWQLM 417          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P27119|DCOR_MUSPA (Ornithine decarboxylase OS=Mus pahari OX=10093 GN=Odc1 PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 3.140e-82
Identity = 157/435 (36.09%), Postives = 234/435 (53.79%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMV--LNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSN-DTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG I+ +HLRW K  PRV P+++VKC   + +++ L   G  FDCAS+ EI++V  L   P     RII+ NP K    + YA++ G+++ +FDS  EL ++ +  P+AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DV+G+SFH G  C D   + +AV  +  V  +    GF   +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++G +IIA PGR+Y+  A+TLA  +I K                         + V + Q    P  ++E       ++Y ++DGVYGSFN +++ D+          K  L K    D K Y S I+GPTCD  D +     +PE+   +W+++ +MGAYT A+ + FNG   PNIYY +S    QLM
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAATGTGFDCASKTEIQLVQGLGVPP----ERIIYANPCKQVSQIKYAASSGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMGTEVGFSMYLLDIGGGFPG----SEDTKLK----FEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAK-------------------------KTVWKEQ----PGSDDEDESNEQTFMYYVNDGVYGSFNCILY-DHAHV-------KALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMWQLM 417          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P27117|DCOR_BOVIN (Ornithine decarboxylase OS=Bos taurus OX=9913 GN=ODC1 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 5.832e-82
Identity = 156/435 (35.86%), Postives = 236/435 (54.25%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMV--LNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSN-DTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG I+ +HLRW K  PRV P+++VKC   + ++  L  +G  FDCAS+ EI++V  L   P     RII+ NP K    + YA+N G+++ +FDS  EL ++ +  P+AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DV+G+SFH G  C D   + +A+  +  V  +    GF+  +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++G +IIA PGR+Y+  A+TLA  +I K+                         LV + Q+      ++E    +  ++Y ++DGVYGSFN +++ D+          K  L K    D K Y S I+GPTCD  D +     +PE+   +W+++ +MGAYT A+ + FNG   P IYY +S    QLM
Sbjct:   35 DDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRTIVKTLAAIGTGFDCASKTEIQLVQSLGVPP----ERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELDIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNMYLLDIGGGFPG----SEDVKLK----FEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKK-------------------------LVLKEQT----GSDDEEESTDRTFMYYVNDGVYGSFNCILY-DHAHV-------KPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPTWQLM 417          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P09057|DCOR_RAT (Ornithine decarboxylase OS=Rattus norvegicus OX=10116 GN=Odc1 PE=1 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 1.625e-81
Identity = 154/435 (35.40%), Postives = 235/435 (54.02%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMV--LNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSN-DTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG ++ +HLRW K  PRV P+++VKC   + +++ L  +G  FDCAS+ EI++V  L   P     RII+ NP K    + YA++ G+++ +FDS  EL ++ +  P+AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DV+G+SFH G  C D   + +AV  +  V  +    GF   +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++G +IIA PGR+Y+  A+TLA  +I K+ + + + + S                            ++E        +Y ++DGVYGSFN +++ D+          K  L K    D K Y S I+GPTCD  D +     +PE+   +W+++ +MGAYT A+ + FNG   PNIYY +S    QLM
Sbjct:   35 DDKDAFYVADLGDVLKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPP----ERIIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMGTEVGFSMYLLDIGGGFPG----SEDTKLK----FEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTV-WKEQTGS----------------------------DDEDESNEQTLMYYVNDGVYGSFNCILY-DHAHV-------KALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCSLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRSMWQLM 417          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A1L8G533 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=odc1 PE=3 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 3.511e-83
Identity = 162/432 (37.50%), Postives = 235/432 (54.40%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG IV +HLRW K  PRV P+++VKC   + V+  L+ LG  FDCAS+ EI++V +   S E  RII+ NP K    + YA++ G+E  +FDS  EL ++ +  P AKL+LRIA  ++K   R    + KFGA      VLLE+A  +  D++G+SFH G  C D   + +AV  +  V  +    GF+  +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++  KIIA PGR+Y+  A+TLA  +I K           KV V+ QS                    +EE    +   +Y ++DGVYGSFN ++F D+      +        K   D K Y S I+GPTCD  D +    E+PEL+  +W+++ +MGAYT A+ + FNG   P ++Y +S    QLM
Sbjct:   35 DDKDAFYVADLGDIVKKHLRWFKALPRVAPFYAVKCNDSKAVVKTLSILGAGFDCASKTEIQLVQSIGVSPE--RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDSKAVCRL---SVKFGATLKTSRVLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMYLLDIGGGFPG----SEDVKLK----FEEITSVINPALDKYFPTDSAVKIIAEPGRYYVASAFTLAVNIIAK-----------KVMVNEQSG-----------------SDDEEDAANDKTLMYYVNDGVYGSFNCILF-DHAHVKPVLT------KKPKPDEKFYSSSIWGPTCDGLDRIVERFELPELQVGDWMLYENMGAYTVAASSTFNGFQRPTLHYVMSRPHWQLM 418          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: Q7ZY28 (Odc1-prov protein OS=Xenopus laevis OX=8355 GN=odc1 PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 4.256e-83
Identity = 160/432 (37.04%), Postives = 236/432 (54.63%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG IV +H+RW K  PRV P+++VKC   + ++  L+ LG  FDCAS+ EI++V +   S E  RII+ NP K    + YA++ G+E  +FDS  EL ++ +  P AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  D++G+SFH G  C D   + +AV  +  V  +    GF+  +++IGGGF G    S + K K    +EEI S +N  L+KY+P ++G KIIA PGR+Y+  ++TLA  +I K           KV V+ QS                    +EE    +   +Y ++DGVYGSFN ++F D+      +        K   D K Y S I+GPTCD  D +    E+PEL+  +W+++ +MGAYT A+ + FNG   P +YY +S    QLM
Sbjct:   35 DDKDAFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDGKAIVKTLSILGAGFDCASKTEIQLVQSIGVSPE--RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPG----SEDVKLK----FEEITSVINPALDKYFPADSGVKIIAEPGRYYVASSFTLAVNIIAK-----------KVMVNEQSG-----------------SDDEEDAANDKTLMYYVNDGVYGSFNCILF-DHAHVKPVLT------KKPKPDEKFYSSSIWGPTCDGLDRIVERFELPELQVGDWMLFENMGAYTVAAASTFNGFQRPTLYYVMSRPHWQLM 418          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: B3S1G3 (Uncharacterized protein OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_27475 PE=3 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 1.082e-82
Identity = 152/428 (35.51%), Postives = 234/428 (54.67%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEE 1400
            D    F+ V++G I+ +H  W  L PRVEP+++VKC  D+ V+  L+ LG+ FDCAS AEI+ VL   +P     +I++ NP K    + +A+   + + +FD+  EL ++KQ+ P AKL+LR+   ++K   R     +K+GA    +P LL+ A ++  +VVGISFH G  C D SA+S AVE +       ++ GF   I++IGGGF G          +  + +EEI + LN  L K++P E+G +IIA PGR+Y+  A+ LA  VI KR +   DN+ +                           Q ++   +N  Y+Y ++DGVYGSFN L++ D+       L          ++ ++Y S I+GPTCD  DC+     +PEL   +W+ + DMGAYT A+ ++FNG   P  YY + E+
Sbjct:   13 DKDDPFYIVNVGNILKKHKTWLSLLPRVEPFYAVKCNDDRNVLATLSALGIGFDCASMAEIKAVLKLGVPP---SKIVYANPCKQASHLKFAAKREVSMMTFDNEPELHKVKQLHPTAKLILRLLTDDSKSLCRL---GQKYGAPLKTVPNLLQVARNLDLNVVGISFHVGSGCYDASAFSSAVEIAKTAFDYGKSMGFQFDILDIGGGFPGSP--------RATVSFEEISATLNKALNKHFPVESGVRIIAEPGRYYVASAFNLAVNVIAKRQVN-DDNTQA---------------------------QGKQHAYRNQKYMYYVNDGVYGSFNCLLY-DHAIVYPKTLG--------RDNEQQYSSSIWGPTCDGLDCVMKECMLPELDVGDWMYFEDMGAYTAAAASNFNGFQKPLAYYVIEEK 389          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A401S0J4 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0002307 PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.629e-82
Identity = 156/432 (36.11%), Postives = 242/432 (56.02%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D    F+  DLG +V +H+RW+++ PRV P+++VKC  D+ V+  L  LG  FDCAS+ EI+MV +     EK  II+ NP K    + YA+  G+++ +FDS  EL ++ +  P AKL+LRIAA ++K   R    + KFGA      +LLE+A  +  D++G+SFH G  C D   +++A+  +  V  L   YG++  +++IGGGF G    S + K K    +EEI + +N  L+KY+P ++G ++IA PGR Y+  +YTLA  +I K           KV +  QSN                   ++E  + +   +Y ++DGVYGSFN +++ D+   +  +L       K  +D K Y + I+GPTCD  D +     MPEL+  +W+++ +MGAYT A+ + FNG   P I+Y +S    QLM
Sbjct:   62 DDKDAFYVADLGDVVKKHMRWQRVLPRVAPFYAVKCNDDKAVVKTLATLGAGFDCASKTEIQMVQSLDVPVEK--IIYANPCKQLSQIKYAATHGVQMMTFDSEVELMKVARGHPSAKLVLRIAADDSKAICRL---SVKFGATLKTSRLLLERAKELGIDIIGVSFHVGSGCTDAQTYAQAIADARFVFDLGVEYGYNMYLLDIGGGFPG----SEDTKLK----FEEIAAVINPALDKYFPIDSGVQVIAEPGRFYVASSYTLAVNIIAK-----------KVVLTEQSN-------------------SDEDDECDRTVMYYVNDGVYGSFNCILY-DHAHVIPVLL------KKQKSDEKLYLTSIWGPTCDGLDRIVERCSMPELQVGDWMVFENMGAYTVAAASTFNGFQRPQIFYVMSRPMWQLM 443          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A369S905 (Ornithine decarboxylase OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_004520 PE=3 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 3.632e-82
Identity = 155/430 (36.05%), Postives = 235/430 (54.65%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKK--NSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEE 1400
            D    F+ V++G I+ +H  W  L PRVEP+++VKC  D+ V+  L+ LG+ FDCAS AEI+ VL   +P     +I++ NP K    + +A+   + + +FD+  EL ++KQ+ P AKL+LR+   ++K   R     +K+GA    +P LL+ A ++  +VVGISFH G  C D SA+S AVE +       ++ GF   I++IGGGF G          +  + +EEI + LN  L K++P E+G +IIA PGR+Y+  A+ LA  VI KR +   +  A   NVD ++                        VKK     Y+Y ++DGVYGSFN L++ D+       L          ++ ++Y S I+GPTCD  DC+     +PEL   +W+ + DMGAYT A+ ++FNG   P  YY + E+
Sbjct:   32 DKDDPFYIVNVGNILKKHKTWLSLLPRVEPFYAVKCNDDRNVLATLSALGIGFDCASMAEIKAVLKLGVPP---SKIVYANPCKQASHLKFAAKREVSMMTFDNEPELHKVKQLHPTAKLILRLLTDDSKSLCRL---GQKYGAPLKTVPNLLQVARNLDLNVVGISFHVGSGCYDASAFSSAVEIAKTAFDYGKSMGFQFDILDIGGGFPGSP--------RATVSFEEISATLNKALNKHFPVESGVRIIAEPGRYYVASAFNLAVNVIAKRQVNDDNTQAQDRNVDNKN------------------------VKKALTQKYMYYVNDGVYGSFNCLLY-DHAIVYPKTLG--------RDNEQQYSSSIWGPTCDGLDCVMKECMLPELDVGDWMYFEDMGAYTAAAASNFNGFQKPLAYYVIEEK 414          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: odc1 (ornithine decarboxylase 1 [Source:NCBI gene;Acc:103026254])

HSP 1 Score: 256.914 bits (655), Expect = 7.420e-80
Identity = 149/428 (34.81%), Postives = 232/428 (54.21%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMV--LNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSE 1397
            D    F+  DLG ++ +HLRW ++ PRV P+++VKC   + V+  L  LG  FDCAS+ EI++V  L   PS    RII+ NP K    + YAS  G+++ +FDS  EL ++ +    AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  DV+G+SFH G  C D   +S+A+  +  V  +    G++  +++IGGGF G    S++ K K    +E+I + +N  L+KY+P ++G KIIA PGR+Y+  AYTLA  +I K+ +   + S S    D +       RL                       +Y ++DGVYGSFN +++ D+   +  +        K   D   Y   I+GPTCD  D +     +P+++  +WL++ +MGAYT A+ + FNG   P+I+Y +S 
Sbjct:   35 DDKDAFYVADLGDVLKKHLRWARVLPRVTPFYAVKCNDSRTVVKTLASLGAGFDCASKTEIQIVQSLGVDPS----RIIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHDNAKLVLRIATDDSKAVCRL---SVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARCVFDMGAELGYNMTLLDIGGGFPG----SDDSKLK----FEDITAVINPALDKYFPADSGVKIIAEPGRYYVASAYTLAVNIIAKKVI-MKEQSGS----DEEDEGTSDRRL-----------------------MYYVNDGVYGSFNCILY-DHAHVMPVLH------KKPKPDECMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIHYIMSR 412          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: ENSAMXT00000043561.1 (antizyme inhibitor 1-like [Source:NCBI gene;Acc:111189228])

HSP 1 Score: 186.422 bits (472), Expect = 1.630e-53
Identity = 124/426 (29.11%), Postives = 195/426 (45.77%), Query Frame = 3
Query:  129 HGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLN-TIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
            + F   +LG ++ QH+ W+ + P V P++ VK      VI +L  LGV F C+++AEI +VLN  +P      II +   K    + +A+  GI     D+  EL ++ +  P AKL+L+++     E+      +  FG        LLE +  +  DVVG+ F     C D   ++ A+  +  V  +    GF+ +I++IGGGF G            E   ++I + +   LE Y+P  +G ++IA PG  Y+  ++TL   VIGK+             V   S H+ T  L         P    EF       LY L+DGVYGSF   +  +       I   K +    + D   + S ++GP+CD  D +     +PEL   +WLI+ +MGA         N    P +YY +S +D
Sbjct:   38 NAFVVANLGALMQQHVLWQSMLPMVRPFYPVKYNSSPAVIEVLAALGVGFVCSNKAEISLVLNHDVP---PENIILSGVCKQLSHIKHATKNGINYLVCDNEAELCKIARAHPNAKLLLQLSTEAQTEEA-----SMAFGCSLKSCRHLLETSKELGVDVVGVMFQVPASCRDPQVYTHALSDARCVFDMGAEIGFNMEILDIGGGFSGS-----------EFQLKQIHAAIRPLLEAYFPVMSGVRVIAEPGTFYVSSSFTLVVNVIGKK-------------VAAGSLHVETKDLT--------PSDEPEF-------LYYLNDGVYGSFMGKLLGN------TIPSPKVHKMSLAADEPMFPSSLWGPSCDALDQVVEHCLLPELTVGDWLIFNNMGASGQEESAAINNSDKPPVYYTISTDD 410          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: azin1b (antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-030121-1])

HSP 1 Score: 186.422 bits (472), Expect = 2.323e-53
Identity = 124/426 (29.11%), Postives = 195/426 (45.77%), Query Frame = 3
Query:  129 HGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLN-TIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
            + F   +LG ++ QH+ W+ + P V P++ VK      VI +L  LGV F C+++AEI +VLN  +P      II +   K    + +A+  GI     D+  EL ++ +  P AKL+L+++     E+      +  FG        LLE +  +  DVVG+ F     C D   ++ A+  +  V  +    GF+ +I++IGGGF G            E   ++I + +   LE Y+P  +G ++IA PG  Y+  ++TL   VIGK+             V   S H+ T  L         P    EF       LY L+DGVYGSF   +  +       I   K +    + D   + S ++GP+CD  D +     +PEL   +WLI+ +MGA         N    P +YY +S +D
Sbjct:   38 NAFVVANLGALMQQHVLWQSMLPMVRPFYPVKYNSSPAVIEVLAALGVGFVCSNKAEISLVLNHDVP---PENIILSGVCKQLSHIKHATKNGINYLVCDNEAELCKIARAHPNAKLLLQLSTEAQTEEA-----SMAFGCSLKSCRHLLETSKELGVDVVGVMFQVPASCRDPQVYTHALSDARCVFDMGAEIGFNMEILDIGGGFSGS-----------EFQLKQIHAAIRPLLEAYFPVMSGVRVIAEPGTFYVSSSFTLVVNVIGKK-------------VAAGSLHVETKDLT--------PSDEPEF-------LYYLNDGVYGSFMGKLLGN------TIPSPKVHKMSLAADEPMFPSSLWGPSCDALDQVVEHCLLPELTVGDWLIFNNMGASGQEESAAINNSDKPPVYYTISTDD 410          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: azin1 (Astyanax mexicanus antizyme inhibitor 1 (azin1), mRNA. [Source:RefSeq mRNA;Acc:NM_001292031])

HSP 1 Score: 162.54 bits (410), Expect = 2.246e-44
Identity = 115/428 (26.87%), Postives = 195/428 (45.56%), Query Frame = 3
Query:  129 HGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLN-TIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIW--------GDMGAYTNASRTDFNGIVSPNIYY 1385
            + FF  DLG I+ Q +RWK    +V P++ +KC     VI IL  LG  F C+S+ E+E+V +  + S +   II     K    + YA+ +G++L   DS  EL ++ +   +AKL+L++      E++     +  FG        +LE A  +   V G+ FH    C +  A++ AV  +  V  + E  GF   I++IGGGF G            E   E++   L   L+ Y+P   G  +IA PG +Y+  A++LA  +I K+ +  S ++    + +L  N                             + Y ++DGV+GSF   +  D +  + ++   K      S +   + S ++GP+ D  D +  S  +PEL   +WL++        G MGA+ +  R   + ++S   +Y
Sbjct:   38 NAFFVADLGAIIWQQIRWKSRMEQVRPFYVLKCNSSPVVIEILAALGTGFICSSKHELELVKSFGVLSQD---IILGGMCKQLSLIKYAAKLGVQLLVCDSEAELRKIARCHSKAKLLLQVTTGGCCEREE---TSMPFGLTLKDCRHMLECAKELSLHVAGVKFHIPSCCAEPQAFTHAVSDARCVFDMGEELGFVMNILDIGGGFDGT-----------EAQLEKVNRALKPMLDVYFPPSTGVSVIAEPGAYYVSAAFSLAVSIISKKIV--SRDAGQHPDDELSGN-------------------------DEPEFQYYMNDGVFGSFAYKLL-DESVPVPSLHKEK------SLEEPLFSSSLWGPSSDGLDQVVESCLLPELSVGDWLVFSHSGANSLGAMGAHADGHRPPVHYVISAGDWY 414          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 257.684 bits (657), Expect = 6.596e-81
Identity = 143/431 (33.18%), Postives = 226/431 (52.44%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-IPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNS-GYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDE 1406
            D  + F+  DLG +V +H RW +  P V P+++VKC  +  V+  L  +G  FDCAS+ E+ +VL   +P+    RII+ NP K    + YA+  G+   +FD+  EL+++ +  P A+L+LRI A ++K   R    + KFGA       LLE+A  +  DV+G+SFH G  C +   ++ A+  +  V  +  ++G+   +++IGGGF G            ++ +EEI   LN  LE+Y+P E+G ++IA PGR Y+  A+ LA  +I K+               +  N L                 NEE  + +   Y+Y ++DGVYGSFN ++F       LA         K   D   +++ ++GPTCD  DC+   +++PEL   +WLI+  MGAYT A+ + FNG   P ++Y +S ED 
Sbjct:   36 DEKNAFYVADLGDVVQKHARWLEHLPLVSPFYAVKCNDELPVLRALAAMGAGFDCASKNEMALVLGLGVPA---ERIIYANPCKQVSHIKYAARHGVHTMTFDNEAELEKVARNHPHARLVLRIMADDSKAVCRL---SVKFGASLKSCRHLLERARQLGVDVIGVSFHVGSGCMEAETFALAIADARCVFDMAVDFGYCLSLLDIGGGFPGSP--------DAKVTFEEIAGVLNGALERYFPAESGVRVIAEPGRFYVASAFMLAVGIIAKKA--------------VVQNSL----------------DNEEASRDDQPAYMYYVNDGVYGSFNCILFDHANVLPLA-------HRKVDLDEPLFETSVWGPTCDGLDCVLECVQLPELHLGDWLIFQHMGAYTLAAASTFNGFQKPVVHYVMSSEDR 415          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 250.366 bits (638), Expect = 1.929e-78
Identity = 143/428 (33.41%), Postives = 226/428 (52.80%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
            D    F+ VDLG IV +HLRW    PRV P+++VKC   Q ++  L  LG  FDCAS+AEI +V +   S +  RII+ NP K    + YA+  G++L +FD+  EL ++ ++ P A+L+LRIA  ++K   +    + KFGA       LLE A  +   VVG+SFH G  C D  A+++A+  + QV       G    +++IGGGF G +        + +I +EEI + +N+ L+ ++P   G  II+ PGR+Y++ A TLAT VI K+           VN          + +++     G P            ++Y ++DG +GSFN + F +     +A       L +   +   ++S ++GPTCD  DC+    ++ EL   +WL++ +MGAYT    + FNG   PNI+Y + + +
Sbjct:   37 DEKDAFYVVDLGDIVRKHLRWLGALPRVRPFYAVKCNNTQTIVQTLATLGTGFDCASKAEIALVQSLGVSAD--RIIYANPCKQASHVRYAAEHGVDLMTFDNDAELHKIARVNPNARLVLRIATDDSKSVYKM---SRKFGASVESSHQLLETAQGLGLLVVGVSFHVGSCCQDGVAYTEAIANARQVFNNAAELGLSLTLLDIGGGFPGHN-------GESKITFEEIAAVVNSALDTHFPAGCGVNIISEPGRYYVMSALTLATNVIAKKTF---------VN--------PLADVLTSATGEGQPV-----------HMYYINDGNFGSFNFVFFKEKFTPPVA-------LKRVDPEEPVFESSVWGPTCDGLDCVMERTQLLELHVGDWLLFRNMGAYTLTLSSGFNGFPLPNIHYMIGDAE 417          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 247.669 bits (631), Expect = 7.197e-78
Identity = 142/425 (33.41%), Postives = 234/425 (55.06%), Query Frame = 3
Query:  132 GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYL-EFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
             F+ VDLG IV +HLRW    PRV P+++VKC   Q +++IL  LG  FDCAS+ EI +V +   S +  RII+ NP K    + YA+  G++L +FDS  EL ++ ++ P A+L+LRI  ++++   R +SN  KFG        LLE A  +   VVG+SFH G +C++  A+++++  + +V  +  + G    +++IGGGF G     NE  R     ++EI + +N+ L+ ++P   G  II+ PGR+Y++ A+TLAT VIGK+ + ++S  S                    +  SVG P            Y+Y ++DG++GSF  ++         A       L     +    +S ++GP+CD +DC+   + +PE+  ++WL++ +MGAYT A  T+FNG   P ++Y + + +
Sbjct:    4 AFYVVDLGDIVRKHLRWLSTLPRVRPFYAVKCNSTQTIVHILATLGAGFDCASKEEIALVQSIGVSAD--RIIYANPCKQASHLRYAAKYGVDLMTFDSDAELHKIARINPNARLVLRILTNDSRSVYR-MSN--KFGVSPESSRELLETAFGLGLLVVGVSFHVGSICNEPEAFAQSIADARRVFNIAADLGVKLTLLDIGGGFPGY----NEHVRNN---FDEIAAVVNSALDTHFPAGCGVNIISEPGRYYVMSAFTLATNVIGKKTVWKYSAQS-------------------DDNDSVGEPV-----------YMYYMNDGIHGSFQHVIHDIEEVVTEA-------LKPVGPEEPVLESSLWGPSCDGYDCVVKRMPLPEMHVDDWLLFRNMGAYTLAMSTEFNGFRRPMLHYVIRKTE 379          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 247.284 bits (630), Expect = 6.777e-77
Identity = 141/428 (32.94%), Postives = 224/428 (52.34%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
            D    F+ VDLG IV +HLRW    PRV P++++KC   Q +++ L  LG  FDCAS+AEI +V +   S +  RII+ NP K    + YA+  G+ L +FD+  EL +  ++ P AK++LRI   ++K   R    + KFGA       LLE A ++  DVVG+SFH G  C D   +++++  +  +  +    GF+  +++IGGGF G            ++ ++EI + +N  L+ Y+P+  G  IIA PGR+Y+  A+TLA  +I K+   FS  SA+                             EE V     ++Y ++DGVYGSFN ++F       +              +   ++S ++GPTCD  D +   +++PEL   +WL++ +MGAYT A+ ++FNG   P ++Y +   D
Sbjct:   34 DEKDAFYVVDLGDIVRKHLRWLGTLPRVRPFYAIKCNSTQTIVHTLATLGAGFDCASKAEIALVQSLGVSAD--RIIYANPCKQASHVRYAAEHGVNLMTFDNDAELHKAARINPNAKMVLRIVTDDSKSICRF---SMKFGASLKASRHLLETARNLGVDVVGVSFHVGSGCQDAQTYAQSIADARVLFNIAAEMGFNMNLLDIGGGFPGSDT-------NAKLTFDEIAAVVNPALDLYFPKGCGVNIIAEPGRYYVTSAFTLAVNIIAKK--TFSKASANG---------------------------GEEPV-----HMYYVNDGVYGSFNCILFDHVQPDPIV-------YKHVEPEEPVFESSLWGPTCDGLDRVVERMQLPELHVGDWLLFRNMGAYTMAAASNFNGFPKPPLHYVIRNAD 408          
BLAST of Ornithine decarboxylase vs. Ensembl Yeast
Match: SPE1 (Ornithine decarboxylase; catalyzes the first step in polyamine biosynthesis; degraded in a proteasome-dependent manner in the presence of excess polyamines; deletion decreases lifespan, and increases necrotic cell death and ROS generation [Source:SGD;Acc:S000001667])

HSP 1 Score: 210.69 bits (535), Expect = 6.048e-63
Identity = 141/447 (31.54%), Postives = 225/447 (50.34%), Query Frame = 3
Query:  129 HGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQV-KKLMENYGFDP-KIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMF------------------SDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMP-ELRTEEWLIWGDMGAYTNASRTDFNGI-VSPNIYYYLSEED 1403
            + FF  DLG +      W K  PR++P+++VKC PD +V+++L  LGVNFDCAS+ EI+ VL+   S +  RI++ NP K    + YA++  +  ++FD+V EL ++K+  P+++L+LRIA  ++  Q R    + K+G +   + VLL+    +  ++ G+SFH G    D+++  KAV  +  V  K    YG  P KI+++GGGF  +S             ++E  + L   LE+++P   G  IIA PGR+++  A+TLA+ VI KR L                                   +NE  +  N        DGVYG+ N ++F                   D+  T  A+LD+   +NK  ++   YK  I+GPTCD  DC+     M  ++   +W  +  +GAYT+++ T FNG   + +I Y  SE D
Sbjct:   85 NSFFICDLGEVKRLFNNWVKELPRIKPFYAVKCNPDTKVLSLLAELGVNFDCASKVEIDRVLSMNISPD--RIVYANPCKVASFIRYAASKNVMKSTFDNVEELHKIKKFHPESQLLLRIATDDSTAQCRL---STKYGCEMENVDVLLKAIKELGLNLAGVSFHVGSGASDFTSLYKAVRDARTVFDKAANEYGLPPLKILDVGGGFQFES-------------FKESTAVLRLALEEFFPVGCGVDIIAEPGRYFVATAFTLASHVIAKRKL----------------------------------SENEAMIYTN--------DGVYGNMNCILFDHQEPHPRTLYHNLEFHYDDFEST-TAVLDS---INKTRSEYP-YKVSIWGPTCDGLDCIAKEYYMKHDVIVGDWFYFPALGAYTSSAATQFNGFEQTADIVYIDSELD 466          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO44188 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWL7])

HSP 1 Score: 257.299 bits (656), Expect = 5.536e-81
Identity = 147/423 (34.75%), Postives = 236/423 (55.79%), Query Frame = 3
Query:  132 GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEE 1400
             F+ VDL  +V +H +W +L PRVEP++++KC  D  V+ +L  LG+ FDCAS+ EI+ +L    S +K  I++ NP K    + YAS   + +T+FD+  EL ++K+++P A+L+LRI   ++K   +      KFGA   +   LL+ A  +  +VVG+SFH G  C D SA++ AV  +  V  L   +GF+  +++IGGGF G             I +EEIC+ +N  LE+++P  +G +IIA PGR+Y   ++TLA  V  +R                    + +S +++E   V  P+ N      N G++Y ++DGVYGSFN L+F   T   + + ++ G           Y++ I+GPTCD+ DC+  ++ +P++   EWL +  MGAYT ++ + FNG   P  +Y  +EE
Sbjct:   39 AFYIVDLADVVLKHKKWVQLLPRVEPFYAMKCNNDPAVLKLLAGLGLGFDCASKGEIQTILGLGVSPKK--IVYANPCKQASHIKYASQHDVAMTTFDNEMELHKIKKLYPDAQLILRIRTDDSKSLCQL---GIKFGAPLKQCRHLLKVAQDLGLNVVGVSFHVGSGCFDASAYATAVIAARSVFNLAVQFGFNCTLLDIGGGFPGDP--------NAAITFEEICTTINPLLEEHFPPSSGVRIIAEPGRYYSSSSFTLAVNVYSRR-------------------EVQSSSVLAE--DVTAPENN-----GNQGFMYYVNDGVYGSFNCLIFDHATVEAIPVKESSGQ--------PLYQTSIWGPTCDSMDCITKNMMLPKVEVGEWLFFKYMGAYTQSAASTFNGFKKPTKFYLCTEE 414          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO26406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC36])

HSP 1 Score: 162.155 bits (409), Expect = 1.507e-46
Identity = 89/231 (38.53%), Postives = 133/231 (57.58%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEIC 812
            D    F+  DLG IV +H+RW K  PRV P+++VKC   + ++  L+ LG  FDCAS+ EI++V +   S E  RII+ NP K    + YA++ G+E  +FDS  EL ++ +  P AKL+LRIA  ++K   R    + KFGA      +LLE+A  +  D++G+SFH G  C D   + +AV  +  V  +    GF+  +++IGGGF G    S + K K    +EE+C
Sbjct:   35 DDKDAFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQLVQSIGVSSE--RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDSKAVCRL---SVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPG----SEDVKLK----FEEVC 252          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO28248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T706])

HSP 1 Score: 112.849 bits (281), Expect = 2.427e-29
Identity = 67/197 (34.01%), Postives = 100/197 (50.76%), Query Frame = 3
Query:  807 ICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSE 1397
            I S +N  L+KY+P ++G  IIA PGR+Y+  A+TLA  +I K           KV V+ QS                    +EE    +   +Y ++DGVYGSFN ++F D+      +        K   D   Y S I+GPTCD  D +    ++PEL+  +W+++ +MGAYT A+ + FNG   P +YY +S 
Sbjct:    2 ITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAK-----------KVMVNEQSG-----------------SDDEEDAANDKTLMYYVNDGVYGSFNCILF-DHAHVKPVLT------KKPKPDESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVMSR 163          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO25932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDC0])

HSP 1 Score: 60.4622 bits (145), Expect = 9.592e-11
Identity = 48/186 (25.81%), Postives = 85/186 (45.70%), Query Frame = 3
Query:  213 FSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQ----AKLMLRIAASNTKEQQRALSN---TEKFGAQFHKIPVLLEKALSMK-FDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGF 746
            ++VK   +  V+N+L+RLG  FD  S  E+E VL      +  RI+F+   K   ++  A  VGI   + +S  EL+R+ Q+  +    A++  R+           +S      KFG    +   + + A S+    VVG+  H G    + + +  A+E+   +   +   G   K +++GGG 
Sbjct:    1 YAVKANSNLAVLNVLSRLGAGFDIVSVGELERVLRA--GAKPERIVFSGVGKQPAEIRRALEVGILCFNVESEAELERVNQVAGECGKTAEISFRVNPDVDAGTHPYISTGLKENKFGIAIAEAKRIYQHAASLPHIHVVGMDCHIGSQLTELAPFMDALERLLGLIDELAEVGITIKHLDLGGGL 184          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO28678 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5T4])

HSP 1 Score: 46.9802 bits (110), Expect = 7.694e-6
Identity = 47/215 (21.86%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  126 GHGFFKVDLGYIVHQHLRWKKLFPRVEPY---FSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRI-----AASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGF 746
            G   +  D   I  Q+ R    F +V+     ++VK   +  ++ + ++LG   D  S+ E+++ L    + E   IIFT      +++   + +G+++ + D++  L+   Q  P+  + +RI     A  N+K     + +  KFG   +++P +     +    + GI  H G    D   + +A E  + V        F    I+ G GF
Sbjct:   14 GSPLYVYDTEKISSQYHRIIHAFSKVKSVKINYAVKALSNINILKLFHQLGAGLDTVSEQEVQLGLTAGVAPE--NIIFTPNGVSLEEIEEVAKLGVQI-NIDNLSILELFGQKHPEIPVCIRINPHVMAGGNSKISVGHIDS--KFGISIYQVPHIKRIVENTGMHINGIHMHTGSDILDIDTFIRATEILFNVASQFNTLDF----IDFGSGF 219          
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Match: odc1 (ornithine decarboxylase 1 [Source:NCBI gene;Acc:101170722])

HSP 1 Score: 256.914 bits (655), Expect = 6.613e-80
Identity = 150/426 (35.21%), Postives = 226/426 (53.05%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSD-YTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLS 1394
            D    F+  DLG ++ +HLRW +  PRV P+++VKC   + V+  L  LG  FDCAS+ EI++V  ++  H  +RII+ NP K    M YAS  G+E+ +FDS  EL ++ +    AKL+LRIA  ++K   R    + KFGA       LLE+A  +  DVVG+SFH G  C D   + KA+  +  V  + E  GF   +++IGGGF G            E+ +EEI + +N  L+KY+P ++G +IIA PGR Y+  AYTL   +I K           KV +D ++                 P   E+    N   +Y ++DGVYGSFN +++   + + +L          K   D   Y   I+GPTCD  D +     +P+++  +WL++ +MGAYT A+ + FNG   P+I+Y +S
Sbjct:   34 DDRDAFYVCDLGDVLKKHLRWTRALPRVTPFYAVKCNDSRAVVMTLASLGTGFDCASKTEIQLV-QSLGVH-PNRIIYANPCKQVSQMKYASAHGVEMMTFDSEVELMKVARYHDNAKLVLRIATDDSKAVCRL---SVKFGAPIKACRGLLERAKELGLDVVGVSFHVGSGCTDAGTFVKAIADARCVFDMGEELGFQMDLLDIGGGFPGS--------EDTELSFEEITATINPALDKYFPVDSGVRIIAEPGRFYVASAYTLVVNIIAK-----------KVIIDEEA-----------------PIDEED----NKTLMYYVNDGVYGSFNCILYDHAHCYPVLH--------KKPKPDETMYSCSIWGPTCDGLDRIVEQCCLPDMQVGDWLVFKNMGAYTVAASSTFNGFQRPDIHYVMS 406          
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Match: azin1b (antizyme inhibitor 1 [Source:NCBI gene;Acc:101162142])

HSP 1 Score: 186.422 bits (472), Expect = 2.431e-53
Identity = 129/428 (30.14%), Postives = 207/428 (48.36%), Query Frame = 3
Query:  132 GFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVL-NTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWS-AWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYS--NDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
             F   DLG ++ QH  W+ + PRV PY+ VKC     VI +L  LG+ F CA++AE+ +VL + +P      II ++ FK    + YA+   I+    ++  EL ++ ++ P AKL+L++    T E Q A  N+  FG        LLEKA  +  DVVG +FH    C+D   A++ A+  +  V  +  + GF+  I++IGGGF G            E   +++ S +N  L+ Y+P+ +G +++A PG  Y+  A++LA  +IGK+    S N  S+                      G  K+  EF       LY +++GVYG F        +  LL    A  +L+K++   D   Y S ++GP+ D  D +     +PEL   +WLI+ +MG          +  +   +YY +S  D
Sbjct:   39 AFVVGDLGALMQQHACWQSVVPRVLPYYPVKCNSSPVVIEVLASLGLGFVCANKAEVGLVLEHGVP---PENIILSSGFKQLAHIKYAAKNNIQHLVCENEAELSKIARLHPSAKLLLQL----TTESQAA-ENSMAFGFSLKNCRHLLEKAKDLGIDVVGAAFHIPSSCEDLQPAYTHALSDARCVFDMGLDLGFNMHILDIGGGFTGS-----------EFQLKQVESAINTLLDAYFPQLSGVQVLAQPGNFYVASAFSLAVNIIGKKIKTQSWNCLSQ----------------------GEKKEGTEF-------LYYMNEGVYGPF--------SHKLLGHPIAAPSLHKHAFCADEAVYPSSLWGPSLDQLDQVVEHCLLPELSVADWLIFSNMGTCGLEDLNCLSSSIDFPVYYIISTSD 410          
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Match: azin1a (antizyme inhibitor 1 [Source:NCBI gene;Acc:101166413])

HSP 1 Score: 166.007 bits (419), Expect = 1.460e-45
Identity = 118/431 (27.38%), Postives = 203/431 (47.10%), Query Frame = 3
Query:  129 HGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIA--ASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNA----SRTDFNGIVSPNIYYYLSEED 1403
            + FF  DLG ++ QH+RW+   P + PY++V+C     VI +L  LG  F C++++++E+VL+   S E   II++   K    + YA+  GI+L   D+  EL ++ +  P AKL+L+++  ASN +E       +  FG        LL++A  +   VVG+  +    C+D   + +A+  +  +  L    GF+  I++IGGGF+G            E   + I S + + ++ Y+P  +G  +IA PG  ++  A+TLA  VI K+ +          +   Q     +     E+Q                   Y+L++GVYGSF+    S  + T +    A     K   D   + S ++GP+ D  D +     +PEL   +WL++   GA++      + TD      P I+Y++   D
Sbjct:   38 NAFFVADLGAVMRQHVRWRTRMPLIRPYYAVRCNSSPAVIELLASLGSGFTCSNKSDLELVLSHGVSPED--IIYSGVCKQVSHIKYAATNGIDLLVCDNEAELRKISRCHPGAKLLLQVSTEASNPEE-----GTSVTFGCSLKDSRCLLQRAKELGVQVVGVRSNISSSCEDDQVYLRAISDARCIYDLGAEMGFNVNILDIGGGFNGA-----------EAQLDLIHSAVMSVVDLYFPSSSGVSLIAEPGSFFVSSAFTLAVSVISKKVV--------ARDAKDQEREEPSPDEEPEIQ-------------------YVLNEGVYGSFS----SKLSETPIG---APSVHKKTLVDAPLFSSSLWGPSGDDLDQVVEHCLLPELHIGDWLVFKHAGAFSLGQPLLASTDSP---PPPIFYFIFSRD 413          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000055750.1 (SMESG000055750.1)

HSP 1 Score: 903.279 bits (2333), Expect = 0.000e+0
Identity = 429/432 (99.31%), Postives = 430/432 (99.54%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            +AGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNEC RKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFV KNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM
Sbjct:   17 EAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECTRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASKVNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVIKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 448          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000041045.1 (SMESG000041045.1)

HSP 1 Score: 388.267 bits (996), Expect = 3.104e-130
Identity = 198/456 (43.42%), Postives = 290/456 (63.60%), Query Frame = 3
Query:  120 DAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNT-----------IPSHEK---HRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSAS---KVNVDLQSNHLHTSRL-------VSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLM 1415
            D+   FF+V+LG+IV Q LRW+KL PRV P+++VKCQPD +V+ +L  LG  FDCASQ E+E+ +N            I +  K     IIF NPFKF++DM++A + GI+ T+FDS GEL RLK+ WP AKL++R++       +  L   +KFG   + I  LL+KA  ++FD+ G+SFH G MC+D+SAW   VE   +V  L+   G++P +++IGGG+ G S +  + + K +  +E++C +LN+ L+ YY +   + II+ PG  ++ GAYTLAT+VIGKR +E S+ S       ++  Q   +    L        S + S+   K  +E V     Y+YILDDGVYGSFN+L F ++ F L+ IL+   ++  + +D K Y SK+YGPTCDT DC+ P+  +PE+   +WL+W DMGAYTNASR+DFNGI  PN YYY+S ED++++
Sbjct:   46 DSQQTFFEVNLGHIVKQFLRWRKLLPRVRPFYAVKCQPDPKVLELLASLGAGFDCASQEEMELAINNCRKAYNSINIDIETSNKIIADNIIFANPFKFKQDMVFAGSYGIQKTTFDSEGELYRLKRYWPSAKLLIRVSTRKKFSAKCQLG--DKFGVNSNNIEKLLKKAKELEFDIAGVSFHVGNMCEDFSAWPDTVEYCAEVMDLITKLGYNPTLLDIGGGYPGLSSVITDFEVKLQEDFEKMCIELNSALDTYYSDR--FTIISEPGTFFVHGAYTLATEVIGKRQIEESEYSQEFYIDQSIPSQDRTVKIGSLDAVMFENPSNLHSI---KVLDEPVDDFKRYIYILDDGVYGSFNVLQFMEFKFLLIGILNPNASIKNFISDEKCYVSKLYGPTCDTLDCISPASNLPEMDVGDWLVWVDMGAYTNASRSDFNGITKPNSYYYISNEDKEII 494          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000004820.1 (SMESG000004820.1)

HSP 1 Score: 357.836 bits (917), Expect = 1.972e-118
Identity = 179/445 (40.22%), Postives = 270/445 (60.67%), Query Frame = 3
Query:  135 FFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIP---SHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFS-------------DNSASKVNVDLQSNH------LHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
            F+++DLG I HQ +RWK L PRV+P+F+VKCQPD +VI++L  LG  FDCAS+ EI+ V++T+    +     IIF NPFKF+KD++YAS+ G+   +FD+  EL +L Q WP  +L+LR++          L N  KFGA   ++P LL++A+ +  +VVG+SFH G  C++  A+ + V    QV +L    GF+P I++IGGGF G S I+  C   +++ +EE+C+ LN+ L+ Y+PEE+ Y+IIA PGR+++ GAYTL TQVIG R L+ +             DN  +  NV+  S        L +   VSE+ S    K ++  +    GY Y+++DGVY SFN ++F         I   +G   + + +T+ Y S IYGPTCD FDC+     +P++    W++W +MGAYT A+ + FNGI     +Y++ +ED
Sbjct:   42 FYQIDLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGVLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWPSVQLILRLSTQRAYAATCVLGN--KFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSIN--CDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKPELYIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQED 482          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000015241.1 (SMESG000015241.1)

HSP 1 Score: 354.755 bits (909), Expect = 2.808e-117
Identity = 178/445 (40.00%), Postives = 270/445 (60.67%), Query Frame = 3
Query:  135 FFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIP---SHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFS-------------DNSASKVNVDLQSNH------LHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
            F++++LG I HQ +RWK L PRV+P+F+VKCQPD +VI++L  LG  FDCAS+ EI+ V++T+    +     IIF NPFKF+KD++YAS+ G+   +FD+  EL +L Q WP  +L+LR++          L N  KFGA   ++P LL++A+ +  +VVG+SFH G  C++  A+ + V    QV +L    GF+P I++IGGGF G S I+ +  ++ +  +EE+C+ LN+ L+ Y+PEE+ Y+IIA PGR+++ GAYTL TQVIG R L+ +             DN  +  NV+  S        L +   VSE+ S    K ++  V    GY Y+++DGVY SFN ++F         I   +G   + + +T+ Y S IYGPTCD FDC+     +P++    W++W +MGAYT A+ + FNGI     +Y++ +ED
Sbjct:   42 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGILGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWPSVQLILRLSTQRAYAATCVLGN--KFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINGDLAKQMQ--FEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKPKVYIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQED 482          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000004848.1 (SMESG000004848.1)

HSP 1 Score: 354.755 bits (909), Expect = 3.638e-117
Identity = 178/445 (40.00%), Postives = 270/445 (60.67%), Query Frame = 3
Query:  135 FFKVDLGYIVHQHLRWKKLFPRVEPYFSVKCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIP---SHEKHRIIFTNPFKFRKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRALSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVEKSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDLNNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFS-------------DNSASKVNVDLQSNH------LHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSFNILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPSIEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEED 1403
            F++++LG I HQ +RWK L PRV+P+F+VKCQPD +VI++L  LG  FDCAS+ EI+ V++T+    +     IIF NPFKF+KD++YAS+ G+   +FD+  EL +L Q WP  +L+LR++          L N  KFGA   ++P LL++A+ +  +VVG+SFH G  C++  A+ + V    QV +L    GF+P I++IGGGF G S I+ +  ++ +  +EE+C+ LN+ L+ Y+PEE+ Y+IIA PGR+++ GAYTL TQVIG R L+ +             DN  +  NV+  S        L +   VSE+ S    K ++  V    GY Y+++DGVY SFN ++F         I   +G   + + +T+ Y S IYGPTCD FDC+     +P++    W++W +MGAYT A+ + FNGI     +Y++ +ED
Sbjct:   42 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGILGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGN--KFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINGDLAKQMQ--FEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKPKVYIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQED 482          
The following BLAST results are available for this feature:
BLAST of Ornithine decarboxylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ODC11.590e-8135.40ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:... [more]
ODC11.590e-8135.40ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:... [more]
AZIN28.695e-6432.70antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN22.555e-6332.23antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN22.555e-6332.23antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
odc-14.008e-6933.33Ornithine decarboxylase [Source:UniProtKB/Swiss-P... [more]
F53F10.22.656e-2323.11pep chromosome:WBcel235:I:3832239:3834124:1 gene:W... [more]
F53F10.22.656e-2323.11pep chromosome:WBcel235:I:3831117:3834124:1 gene:W... [more]
F53F10.22.656e-2323.11pep chromosome:WBcel235:I:3830562:3834120:1 gene:W... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Odc15.327e-5429.57gene:FBgn0013307 transcript:FBtr0088863[more]
Odc23.922e-4328.37gene:FBgn0013308 transcript:FBtr0088864[more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
odc11.356e-8334.72ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
odc11.356e-8334.72ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
odc11.356e-8334.72ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
azin1b6.300e-5329.37antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
azin1b6.300e-5329.37antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dym6.920e-8536.57dymeclin [Source:Xenbase;Acc:XB-GENE-5729291][more]
dym1.292e-8436.57dymeclin [Source:Xenbase;Acc:XB-GENE-5729291][more]
dym1.269e-8336.38dymeclin [Source:Xenbase;Acc:XB-GENE-5729291][more]
slc20a27.687e-7633.81solute carrier family 20 (phosphate transporter), ... [more]
cstf22.305e-6331.06cleavage stimulation factor, 3' pre-RNA, subunit 2... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Odc18.762e-8435.25ornithine decarboxylase, structural 1 [Source:MGI ... [more]
Azin23.042e-6230.81antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:24... [more]
Azin23.042e-6230.81antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:24... [more]
Ldc13.104e-6130.39leucine decarboxylase 1 [Source:MGI Symbol;Acc:MGI... [more]
Azin13.265e-5829.88antizyme inhibitor 1 [Source:MGI Symbol;Acc:MGI:18... [more]
back to top
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27120|DCOR1_XENLA6.770e-8536.81Ornithine decarboxylase 1 OS=Xenopus laevis OX=835... [more]
sp|P00860|DCOR_MOUSE6.129e-8335.25Ornithine decarboxylase OS=Mus musculus OX=10090 G... [more]
sp|P27119|DCOR_MUSPA3.140e-8236.09Ornithine decarboxylase OS=Mus pahari OX=10093 GN=... [more]
sp|P27117|DCOR_BOVIN5.832e-8235.86Ornithine decarboxylase OS=Bos taurus OX=9913 GN=O... [more]
sp|P09057|DCOR_RAT1.625e-8135.40Ornithine decarboxylase OS=Rattus norvegicus OX=10... [more]
back to top
BLAST of Ornithine decarboxylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L8G5333.511e-8337.50Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
Q7ZY284.256e-8337.04Odc1-prov protein OS=Xenopus laevis OX=8355 GN=odc... [more]
B3S1G31.082e-8235.51Uncharacterized protein OS=Trichoplax adhaerens OX... [more]
A0A401S0J41.629e-8236.11Uncharacterized protein OS=Chiloscyllium punctatum... [more]
A0A369S9053.632e-8236.05Ornithine decarboxylase OS=Trichoplax sp. H2 OX=28... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
odc17.420e-8034.81ornithine decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000043561.11.630e-5329.11antizyme inhibitor 1-like [Source:NCBI gene;Acc:11... [more]
azin1b2.323e-5329.11antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
azin12.246e-4426.87Astyanax mexicanus antizyme inhibitor 1 (azin1), m... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
AZIN16.596e-8133.18antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN11.929e-7833.41antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN17.197e-7833.41antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN16.777e-7732.94antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SPE16.048e-6331.54Ornithine decarboxylase; catalyzes the first step ... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441885.536e-8134.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264061.507e-4638.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282482.427e-2934.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259329.592e-1125.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286787.694e-621.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
odc16.613e-8035.21ornithine decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
azin1b2.431e-5330.14antizyme inhibitor 1 [Source:NCBI gene;Acc:1011621... [more]
azin1a1.460e-4527.38antizyme inhibitor 1 [Source:NCBI gene;Acc:1011664... [more]
back to top
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055750.10.000e+099.31SMESG000055750.1[more]
SMESG000041045.13.104e-13043.42SMESG000041045.1[more]
SMESG000004820.11.972e-11840.22SMESG000004820.1[more]
SMESG000015241.12.808e-11740.00SMESG000015241.1[more]
SMESG000004848.13.638e-11740.00SMESG000004848.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027207 ID=SMED30027207|Name=Ornithine decarboxylase|organism=Schmidtea mediterranea sexual|type=transcript|length=1488bp
TCTCTACTCATTAATGTTTCTGGTGTATCTTTGATTTTGATTTTGGTTTT
AGTTTTCCATTTCATTTAACAATGGCGTCATCATTGAAGATCATTTCGAA
GATCCAATCGAAAGTTAAAGATGCTGGACATGGATTTTTCAAAGTTGATC
TCGGCTACATTGTTCATCAGCATTTGAGATGGAAAAAATTGTTTCCTCGA
GTTGAACCATATTTTTCAGTCAAATGTCAACCGGATCAGCAAGTAATCAA
CATTCTCAACCGGCTTGGAGTGAATTTTGATTGCGCCAGTCAAGCGGAAA
TTGAAATGGTATTGAACACTATTCCGTCACATGAAAAACATCGAATAATA
TTTACAAATCCATTTAAATTTCGAAAAGATATGATGTATGCTTCAAATGT
TGGTATCGAATTGACCAGTTTTGACAGTGTAGGTGAACTTGACAGGTTGA
AACAAATGTGGCCCCAAGCCAAACTTATGCTGAGAATAGCAGCTAGTAAT
ACCAAAGAACAACAACGAGCATTATCTAATACCGAAAAATTTGGAGCACA
ATTTCACAAAATACCGGTCCTATTGGAAAAGGCACTATCAATGAAATTCG
ATGTTGTGGGCATAAGTTTCCACGCCGGTATCATGTGTGATGATTGGTCG
GCATGGTCGAAAGCTGTGGAGAAATCGTATCAAGTAAAGAAATTAATGGA
AAACTACGGGTTTGATCCCAAAATTATCAATATTGGCGGAGGATTTCACG
GAAAAAGCGTAATATCTAATGAATGCAAGCGGAAAGAAGAAATCCTTTAT
GAAGAAATTTGTTCAGATTTGAACAATGATCTTGAAAAGTATTATCCTGA
GGAAAACGGTTATAAAATCATCGCCACTCCAGGAAGGCATTACATTATTG
GGGCATATACTCTTGCCACACAAGTAATCGGCAAACGTTACTTGGAGTTC
AGTGACAATTCAGCAAGCAAAGTAAACGTTGATCTTCAGTCCAACCATCT
GCATACTTCCAGACTTGTAAGTGAAGTGCAATCAGTTGGAATGCCAAAGC
AAAATGAAGAGTTCGTTAAAAAGAATAGTGGTTACTTATACATACTTGAT
GACGGAGTCTATGGCTCTTTCAACATTCTTATGTTTTCAGACTATACCTT
CACTTTATTAGCTATTCTAGATGCAAAAGGCAATTTGAATAAATACTCAA
ACGATACAAAAAGATACAAATCAAAAATCTATGGGCCTACGTGTGATACA
TTTGATTGTTTGTTTCCTTCGATCGAAATGCCAGAACTAAGAACAGAAGA
ATGGCTAATATGGGGAGACATGGGAGCCTACACAAATGCTTCGAGGACCG
ACTTCAATGGCATCGTGTCCCCAAATATATATTATTACTTATCAGAAGAA
GATGAACAATTAATGATAGAACAATCTCAAATAGAACAATCTATTACAAT
TTAAACACCAATTGCTATTTGCTAATACACAGATCGGA
back to top

protein sequence of SMED30027207-orf-1

>SMED30027207-orf-1 ID=SMED30027207-orf-1|Name=SMED30027207-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=461bp
MASSLKIISKIQSKVKDAGHGFFKVDLGYIVHQHLRWKKLFPRVEPYFSV
KCQPDQQVINILNRLGVNFDCASQAEIEMVLNTIPSHEKHRIIFTNPFKF
RKDMMYASNVGIELTSFDSVGELDRLKQMWPQAKLMLRIAASNTKEQQRA
LSNTEKFGAQFHKIPVLLEKALSMKFDVVGISFHAGIMCDDWSAWSKAVE
KSYQVKKLMENYGFDPKIINIGGGFHGKSVISNECKRKEEILYEEICSDL
NNDLEKYYPEENGYKIIATPGRHYIIGAYTLATQVIGKRYLEFSDNSASK
VNVDLQSNHLHTSRLVSEVQSVGMPKQNEEFVKKNSGYLYILDDGVYGSF
NILMFSDYTFTLLAILDAKGNLNKYSNDTKRYKSKIYGPTCDTFDCLFPS
IEMPELRTEEWLIWGDMGAYTNASRTDFNGIVSPNIYYYLSEEDEQLMIE
QSQIEQSITI*
back to top
Aliases
The feature 'Ornithine decarboxylase' has the following synonyms
Synonym
H.63.4c
odc-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042176regulation of protein catabolic process
GO:0006596polyamine biosynthetic process
GO:0033387putrescine biosynthetic process from ornithine
Vocabulary: molecular function
TermDefinition
GO:0042803protein homodimerization activity
GO:0003824catalytic activity
GO:0004586ornithine decarboxylase activity
GO:0016829lyase activity
GO:0016831carboxy-lyase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR022643De-COase2_C
IPR029066PLP-binding_barrel
IPR022644De-COase2_N
IPR000183Orn/DAP/Arg_de-COase
IPR002433Orn_de-COase
IPR009006Ala_racemase/Decarboxylase_C
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002433Ornithine decarboxylasePRINTSPR01182ORNDCRBXLASEcoord: 20..44
score: 37.73
coord: 344..357
score: 52.14
coord: 92..116
score: 32.93
coord: 405..418
score: 37.14
coord: 46..73
score: 46.31
coord: 122..144
score: 33.04
coord: 385..395
score: 57.58
IPR002433Ornithine decarboxylasePANTHERPTHR11482ARGININE/DIAMINOPIMELATE/ORNITHINE DECARBOXYLASEcoord: 16..449
IPR000183Ornithine/DAP/Arg decarboxylasePRINTSPR01179ODADCRBXLASEcoord: 68..80
score: 45.67
coord: 266..285
score: 37.58
coord: 175..188
score: 35.83
coord: 418..431
score: 43.19
coord: 48..66
score: 30.92
IPR022643Orn/DAP/Arg decarboxylase 2, C-terminalPFAMPF00278Orn_DAP_Arg_deCcoord: 315..418
e-value: 1.0E-11
score: 44.9
IPR009006Alanine racemase/group IV decarboxylase, C-terminalGENE3DG3DSA:2.40.37.10coord: 20..440
e-value: 1.1E-107
score: 362.0
IPR009006Alanine racemase/group IV decarboxylase, C-terminalSUPERFAMILYSSF50621Alanine racemase C-terminal domain-likecoord: 252..447
IPR022644Orn/DAP/Arg decarboxylase 2, N-terminalPFAMPF02784Orn_Arg_deC_Ncoord: 28..274
e-value: 3.1E-57
score: 193.8
IPR029066PLP-binding barrelGENE3DG3DSA:3.20.20.10coord: 30..274
e-value: 1.1E-107
score: 362.0
IPR029066PLP-binding barrelSUPERFAMILYSSF51419PLP-binding barrelcoord: 26..276
NoneNo IPR availableCDDcd00622PLPDE_III_ODCcoord: 19..439
e-value: 3.4552E-122
score: 358.73