Progestin and adipoQ receptor family member 6

Overview
NameProgestin and adipoQ receptor family member 6
Smed IDSMED30027202
Length (bp)1137
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Progestin and adipoQ receptor family member 6 (SMED30027202) t-SNE clustered cells

Violin plots show distribution of expression levels for Progestin and adipoQ receptor family member 6 (SMED30027202) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Progestin and adipoQ receptor family member 6 (SMED30027202) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Progestin and adipoQ receptor family member 6 (SMED30027202) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027202

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027202 SmedASXL_006336SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027202 dd_Smed_v4_14141_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027202 dd_Smed_v4_14141_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027202 dd_Smed_v6_14141_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027202 dd_Smed_v4_14141_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30027202 dd_Smed_v4_14141_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Human
Match: PAQR6 (progestin and adipoQ receptor family member 6 [Source:HGNC Symbol;Acc:HGNC:30132])

HSP 1 Score: 167.162 bits (422), Expect = 7.956e-48
Identity = 107/334 (32.04%), Postives = 164/334 (49.10%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQT--ASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKNAP 1077
            K+   L   QVP  F E  I SGYR P SS   C+ S F  TNETVNIWTH +P  YF+   ++      FR + Y++   +  +   +     S  AH F++MS   RH+C+  DY A+S+++ G    + AYS+P SW+    ++ F      ++   CT    LSC +RF    +    K+LR  AF YP L    P+ +R   C+   +        ++   T+  Y +F ++L    + SH PER+ PG FD +GHSHQLFH+   + T+FQ++ + +D+ +R+  L +         T A  +     N+L    F + L       P
Sbjct:    5 KLPQLLQVHQVPRVFWEDGIMSGYRRPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLWRLLALAGGPGFRAEPYHWPLLVFLLPACLYPFA-SCCAHTFSSMSPRMRHICYFLDYGALSLYSLGCAFPYAAYSMPASWLHGHLHQFFVPA-AALNSFLCTG---LSCYSRFLELESPGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCG-----QEALSTSHGYHLFCALLTGFLFASHLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLATQEPALGLAGTVATLVLAAAGNLLIIAAFTATLLRAPSTCP 328          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Human
Match: PAQR6 (progestin and adipoQ receptor family member 6 [Source:HGNC Symbol;Acc:HGNC:30132])

HSP 1 Score: 162.155 bits (409), Expect = 5.282e-46
Identity = 104/325 (32.00%), Postives = 161/325 (49.54%), Query Frame = 1
Query:  109 QVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQT--ASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKNAP 1077
            QV + F E  I SGYR P SS   C+ S F  TNETVNIWTH +P  YF+   ++      FR + Y++   +  +   +     S  AH F++MS   RH+C+  DY A+S+++ G    + AYS+P SW+    ++ F      ++   CT    LSC +RF    +    K+LR  AF YP L    P+ +R   C+   +        ++   T+  Y +F ++L    + SH PER+ PG FD +GHSHQLFH+   + T+FQ++ + +D+ +R+  L +         T A  +     N+L    F + L       P
Sbjct:   11 QVHQVFWEDGIMSGYRRPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLWRLLALAGGPGFRAEPYHWPLLVFLLPACLYPFA-SCCAHTFSSMSPRMRHICYFLDYGALSLYSLGCAFPYAAYSMPASWLHGHLHQFFVPA-AALNSFLCTG---LSCYSRFLELESPGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCG-----QEALSTSHGYHLFCALLTGFLFASHLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLATQEPALGLAGTVATLVLAAAGNLLIIAAFTATLLRAPSTCP 325          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Human
Match: PAQR6 (progestin and adipoQ receptor family member 6 [Source:HGNC Symbol;Acc:HGNC:30132])

HSP 1 Score: 157.147 bits (396), Expect = 2.898e-44
Identity = 99/313 (31.63%), Postives = 155/313 (49.52%), Query Frame = 1
Query:  145 SGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQT--ASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKNAP 1077
            SGYR P SS   C+ S F  TNETVNIWTH +P  YF+   ++      FR + Y++   +  +   +     S  AH F++MS   RH+C+  DY A+S+++ G    + AYS+P SW+    ++ F      ++   CT    LSC +RF    +    K+LR  AF YP L    P+ +R   C+   +        ++   T+  Y +F ++L    + SH PER+ PG FD +GHSHQLFH+   + T+FQ++ + +D+ +R+  L +         T A  +     N+L    F + L       P
Sbjct:    2 SGYRRPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLWRLLALAGGPGFRAEPYHWPLLVFLLPACLYPFA-SCCAHTFSSMSPRMRHICYFLDYGALSLYSLGCAFPYAAYSMPASWLHGHLHQFFVPA-AALNSFLCTG---LSCYSRFLELESPGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCG-----QEALSTSHGYHLFCALLTGFLFASHLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLATQEPALGLAGTVATLVLAAAGNLLIIAAFTATLLRAPSTCP 304          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Human
Match: PAQR5 (progestin and adipoQ receptor family member 5 [Source:HGNC Symbol;Acc:HGNC:29645])

HSP 1 Score: 155.992 bits (393), Expect = 8.127e-44
Identity = 109/318 (34.28%), Postives = 181/318 (56.92%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQL 1053
            +Q+P+ F E  I  GYR+P+SS + CI SLF  TNET+NIWTHL+P  +F   FV+ ++  + + D+ Y  P ++Y+ T  +Y L+SS AH F++MS  ARH+C+  DY AV++ + G+ +A+ AY+ P + +  T    F + Y+ +++++  +S  LSC +RF      R  K++R  AF YP      P+ +R    ++F       +  +++  +     +  ++LA   Y +H PER+ PG FD +GHSHQLFHV   + T+ Q++ I  D   RK  L + +K  +F       +  +I ++   +YF + L
Sbjct:   13 DQIPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFAWRFVTALYMTDIKNDS-YSWPMLVYMCTSCVYPLVSSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALMCTT----FHDYYVALAVLNTILSTGLSCYSRFLEIQKPRLCKVIRVLAFAYPYTWDSLPIFYRL---FLFPG-----ESAQNEATSYHQKHMIMTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHMQMEAILLDKTLRKEWLLATSKPFSFSQIAGAILLCIIFSLSNIIYFSAAL 317          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Human
Match: PAQR5 (progestin and adipoQ receptor family member 5 [Source:HGNC Symbol;Acc:HGNC:29645])

HSP 1 Score: 155.992 bits (393), Expect = 8.127e-44
Identity = 109/318 (34.28%), Postives = 181/318 (56.92%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQL 1053
            +Q+P+ F E  I  GYR+P+SS + CI SLF  TNET+NIWTHL+P  +F   FV+ ++  + + D+ Y  P ++Y+ T  +Y L+SS AH F++MS  ARH+C+  DY AV++ + G+ +A+ AY+ P + +  T    F + Y+ +++++  +S  LSC +RF      R  K++R  AF YP      P+ +R    ++F       +  +++  +     +  ++LA   Y +H PER+ PG FD +GHSHQLFHV   + T+ Q++ I  D   RK  L + +K  +F       +  +I ++   +YF + L
Sbjct:   13 DQIPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFAWRFVTALYMTDIKNDS-YSWPMLVYMCTSCVYPLVSSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALMCTT----FHDYYVALAVLNTILSTGLSCYSRFLEIQKPRLCKVIRVLAFAYPYTWDSLPIFYRL---FLFPG-----ESAQNEATSYHQKHMIMTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHMQMEAILLDKTLRKEWLLATSKPFSFSQIAGAILLCIIFSLSNIIYFSAAL 317          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Celegans
Match: K11C4.2 (pep chromosome:WBcel235:V:6895078:6896922:1 gene:WBGene00019643.1 transcript:K11C4.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K11C4.2)

HSP 1 Score: 75.8702 bits (185), Expect = 3.551e-15
Identity = 72/264 (27.27%), Postives = 116/264 (43.94%), Query Frame = 1
Query:   97 LNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICF-VSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKL-LRF-SAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHV 879
            L +EQVP   +   + SGYR      S   +S F   NE  N+WTH IPAI  +  + + EI     R         +I    + +  + SSLAHL ++ S+      F+ D++ +++     GL  Y+ S  +S I K          ++      T      C        ++R++ LR  S F+  C + I P+ +R+        +  +  D     ++     + FS    +F  +H PER  PG FDI+G+ HQLFH+
Sbjct:    3 LRDEQVPLLLKRKHVVSGYRPLNQPPSFYFRSAFSSHNEVFNVWTHFIPAIILLFAYLIPEILAPLPRVP------VLILQVGIFLLLIASSLAHLMHSRSELDHVFWFLIDFSGIALFGITIGLQRYSSSDDMSLIMKIIYVPLLLVVVLGGQYFST------CYLFVYKPHYKRRMELRMGSCFLLACWLYI-PLHYRY-------QSEGSGGDAALPLHSRAFQWLVFS---GIFMGAHIPERFAPGVFDIVGYGHQLFHL 243          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 53.5286 bits (127), Expect = 1.142e-7
Identity = 74/287 (25.78%), Postives = 125/287 (43.55%), Query Frame = 1
Query:   97 LNEEQVPEHFRE-PFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIP--AIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFI---CDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNR 939
            L  E +PE  ++  F+  G+R P  SFS C KS++    ET NIWTHLI   A +F+ C+     +L    ++  +   +++        L   L+  F+T+S  + +V  I    DY  +S+   G+ + +  Y        +   KI    YI +  +    ++V+S   +F  + FR   +R + F+      + P +      YI  + +++     D+ +   +   F  +L    Y +  PER +PG  DI   SHQLFH    I  +     I    F R
Sbjct:   62 LKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACW-----FLTRPDNHIQFQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYC----RREPKI---TYIAMVSVLGIGAIVVSLWDKFSESRFRP--IRAAVFVGMGCSGVIPTIH-----YIITDGVHSL--FADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFAR 327          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 50.0618 bits (118), Expect = 1.481e-6
Identity = 74/287 (25.78%), Postives = 125/287 (43.55%), Query Frame = 1
Query:   97 LNEEQVPEHFRE-PFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIP--AIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFI---CDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNR 939
            L  E +PE  ++  F+  G+R P  SFS C KS++    ET NIWTHLI   A +F+ C+     +L    ++  +   +++        L   L+  F+T+S  + +V  I    DY  +S+   G+ + +  Y        +   KI    YI +  +    ++V+S   +F  + FR   +R + F+      + P +      YI  + +++     D+ +   +   F  +L    Y +  PER +PG  DI   SHQLFH    I  +     I    F R
Sbjct:  161 LKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACW-----FLTRPDNHIQFQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYC----RREPKI---TYIAMVSVLGIGAIVVSLWDKFSESRFR--PIRAAVFVGMGCSGVIPTIH-----YIITDGVHSL--FADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFAR 426          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 50.0618 bits (118), Expect = 1.481e-6
Identity = 74/287 (25.78%), Postives = 125/287 (43.55%), Query Frame = 1
Query:   97 LNEEQVPEHFRE-PFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIP--AIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFI---CDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNR 939
            L  E +PE  ++  F+  G+R P  SFS C KS++    ET NIWTHLI   A +F+ C+     +L    ++  +   +++        L   L+  F+T+S  + +V  I    DY  +S+   G+ + +  Y        +   KI    YI +  +    ++V+S   +F  + FR   +R + F+      + P +      YI  + +++     D+ +   +   F  +L    Y +  PER +PG  DI   SHQLFH    I  +     I    F R
Sbjct:  161 LKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACW-----FLTRPDNHIQFQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYC----RREPKI---TYIAMVSVLGIGAIVVSLWDKFSESRFR--PIRAAVFVGMGCSGVIPTIH-----YIITDGVHSL--FADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFAR 426          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 50.0618 bits (118), Expect = 1.481e-6
Identity = 74/287 (25.78%), Postives = 125/287 (43.55%), Query Frame = 1
Query:   97 LNEEQVPEHFRE-PFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIP--AIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFI---CDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNR 939
            L  E +PE  ++  F+  G+R P  SFS C KS++    ET NIWTHLI   A +F+ C+     +L    ++  +   +++        L   L+  F+T+S  + +V  I    DY  +S+   G+ + +  Y        +   KI    YI +  +    ++V+S   +F  + FR   +R + F+      + P +      YI  + +++     D+ +   +   F  +L    Y +  PER +PG  DI   SHQLFH    I  +     I    F R
Sbjct:  161 LKYEHLPEWLQDNEFLRHGHRPPLPSFSECFKSIWSLHTETGNIWTHLIGCVAFFFLACW-----FLTRPDNHIQFQEKVVFSFFFAGAVLCLGLSFAFHTLSCHSVNVVKIFCKLDYMGISLLIIGSFIPWIYYGFYC----RREPKI---TYIAMVSVLGIGAIVVSLWDKFSESRFR--PIRAAVFVGMGCSGVIPTIH-----YIITDGVHSL--FADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFAR 426          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Fly
Match: CG7530 (gene:FBgn0038256 transcript:FBtr0333277)

HSP 1 Score: 53.1434 bits (126), Expect = 1.788e-7
Identity = 25/61 (40.98%), Postives = 37/61 (60.66%), Query Frame = 1
Query:   79 NKIHYSLNEEQVPEHFR-EPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFI 258
            +K  +  N +  P H +  P+I  GYR    S  +C++S+F+ TNET+NIW+HL   I FI
Sbjct:   61 SKFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFI 121          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Fly
Match: CG7530 (gene:FBgn0038256 transcript:FBtr0083021)

HSP 1 Score: 52.7582 bits (125), Expect = 2.172e-7
Identity = 25/61 (40.98%), Postives = 37/61 (60.66%), Query Frame = 1
Query:   79 NKIHYSLNEEQVPEHFR-EPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFI 258
            +K  +  N +  P H +  P+I  GYR    S  +C++S+F+ TNET+NIW+HL   I FI
Sbjct:   71 SKFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFI 131          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Fly
Match: CG7530 (gene:FBgn0038256 transcript:FBtr0083019)

HSP 1 Score: 52.7582 bits (125), Expect = 2.172e-7
Identity = 25/61 (40.98%), Postives = 37/61 (60.66%), Query Frame = 1
Query:   79 NKIHYSLNEEQVPEHFR-EPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFI 258
            +K  +  N +  P H +  P+I  GYR    S  +C++S+F+ TNET+NIW+HL   I FI
Sbjct:   71 SKFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFI 131          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Fly
Match: CG7530 (gene:FBgn0038256 transcript:FBtr0083020)

HSP 1 Score: 52.7582 bits (125), Expect = 2.172e-7
Identity = 25/61 (40.98%), Postives = 37/61 (60.66%), Query Frame = 1
Query:   79 NKIHYSLNEEQVPEHFR-EPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFI 258
            +K  +  N +  P H +  P+I  GYR    S  +C++S+F+ TNET+NIW+HL   I FI
Sbjct:   71 SKFKWLCNFDDAPSHLKFNPYIRRGYRTFLPSTKMCLQSIFWWTNETINIWSHLAGCILFI 131          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0084284)

HSP 1 Score: 49.2914 bits (116), Expect = 3.145e-6
Identity = 59/242 (24.38%), Postives = 92/242 (38.02%), Query Frame = 1
Query:  136 FIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNW-IYQIFFSILAVMFYISHFPERIYPGYFDILGH 858
            F++ G+R P  SF  C KS+F    ET NIWTHL+  I FI   +  I   +          +  +    ++    S   H  +  S     +    DY  +++   G+ + +  Y     +  K         Y+ +  I   +S+V+S   +F   + R   LR   FM   L  + P +   +    F     A+          W I      IL  + Y    PER +PG FDI G 
Sbjct:   96 FLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQPKVI-------YLSVVSILGILSIVVSLWDKFSEPALRP--LRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRAS--------LGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQ 320          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Zebrafish
Match: paqr6 (progestin and adipoQ receptor family member VI [Source:ZFIN;Acc:ZDB-GENE-090714-1])

HSP 1 Score: 182.57 bits (462), Expect = 3.726e-54
Identity = 116/309 (37.54%), Postives = 167/309 (54.05%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASF--RRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCK-DDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNI 1023
             QVP+ FRE  I SGYR+PRSS   CI S F  TNETVNIWTH +P  YF+  F      L+F  D+Y +   +  +   +     SS AH F+TMS  ARH+C+  DY A+S+++ G  +++ +Y++P SW+    N     +++ I I +      +SC TRF    F  + K+LR SAF+ P L    P+ +R L C            C   +   +  Y + F+ L    + SH PER+ PG FD +GHSHQLFH+   + T+FQ++   SD+ +RK  L SY+ LP F  T       V+ N+
Sbjct:   13 HQVPKVFREDGIMSGYRHPRSSALDCILSSFQMTNETVNIWTHFLPTWYFLWRFSVLCSSLDFVTDSYTWPLLVYMLLICLYPFT-SSCAHTFSTMSAEARHICYFFDYGALSLYSLGCAISYGSYAMPDSWV----NSWLHQHFVTIGICNSLFCTSMSCYTRFIELQFPHKSKILRTSAFVVPFLFDSFPLFYRLLSC--------CWGSCSPSEALASHSYHLLFAFLTCFLFASHLPERLAPGRFDYIGHSHQLFHICAVVGTHFQMEAALSDMASRKDWLISYSGLPTFQGTMGALALGVLLNL 308          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Zebrafish
Match: paqr6 (progestin and adipoQ receptor family member VI [Source:ZFIN;Acc:ZDB-GENE-090714-1])

HSP 1 Score: 170.244 bits (430), Expect = 1.080e-49
Identity = 109/296 (36.82%), Postives = 159/296 (53.72%), Query Frame = 1
Query:  145 SGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASF--RRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCK-DDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNI 1023
            SGYR+PRSS   CI S F  TNETVNIWTH +P  YF+  F      L+F  D+Y +   +  +   +     SS AH F+TMS  ARH+C+  DY A+S+++ G  +++ +Y++P SW+    N     +++ I I +      +SC TRF    F  + K+LR SAF+ P L    P+ +R L C            C   +   +  Y + F+ L    + SH PER+ PG FD +GHSHQLFH+   + T+FQ++   SD+ +RK  L SY+ LP F  T       V+ N+
Sbjct:    2 SGYRHPRSSALDCILSSFQMTNETVNIWTHFLPTWYFLWRFSVLCSSLDFVTDSYTWPLLVYMLLICLYPFT-SSCAHTFSTMSAEARHICYFFDYGALSLYSLGCAISYGSYAMPDSWV----NSWLHQHFVTIGICNSLFCTSMSCYTRFIELQFPHKSKILRTSAFVVPFLFDSFPLFYRLLSC--------CWGSCSPSEALASHSYHLLFAFLTCFLFASHLPERLAPGRFDYIGHSHQLFHICAVVGTHFQMEAALSDMASRKDWLISYSGLPTFQGTMGALALGVLLNL 284          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Zebrafish
Match: paqr5b (progestin and adipoQ receptor family member Vb [Source:NCBI gene;Acc:100007661])

HSP 1 Score: 168.703 bits (426), Expect = 9.520e-49
Identity = 108/313 (34.50%), Postives = 170/313 (54.31%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTN-WIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVV 1011
            K+    N  QVP+ F E  I SGYR+PRSS + C+ SLF  TNET+N+WTH +P  YF+   ++ +  +   ++  Y  P ++++ +  +Y L SS AH F++MS  ARH+C+  DY A+S ++ G+ +++ AY  P +W+  +    F   YI +++ +  +S  L+C +RF      R  K+LR  AF YP L    P+ +R   C          + C D+   +  +     + L    + +H PER+ PG FD +GHSHQLFHV   I T+FQ+K I  D+  R+  L +     +F+NT    +  V
Sbjct:    6 KLQRVFNVHQVPKAFHEDGIISGYRHPRSSATECVWSLFQLTNETLNVWTHFLPTWYFLWKLMT-VLLMEDVWNEAYTWPLLVFLFSCCVYPLASSCAHTFSSMSTRARHICYFFDYGALSFYSLGSAISYSAYVFPDAWLSSS----FHAYYISVAVFNTVLSTSLACYSRFSERQCPRMSKVLRILAFAYPYLFDNIPLFYRLFVC--------VGEGCTDNEANSVHVQHTLLAFLTSFLFATHLPERLAPGRFDYIGHSHQLFHVCAIIGTHFQMKAIEMDMGLRRSQLLASAPAISFNNTIGAALLCV 305          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Zebrafish
Match: paqr5a (progestin and adipoQ receptor family member Va [Source:NCBI gene;Acc:393156])

HSP 1 Score: 159.844 bits (403), Expect = 3.330e-45
Identity = 120/356 (33.71%), Postives = 181/356 (50.84%), Query Frame = 1
Query:   70 LNRNKIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTR-------FQTASFRR----------KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQ-IFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNI----LFSVYFISQLRYKMKN 1071
            LN  K+       QVP+ F E  I SGYR+P SS   C+ SLF  TNET+NIWTH +P  +F+   ++ +  L   + + +  P+++++ +  +Y L SS AH F+TMS+ ARH+CF  DY A+S ++ G+ + + +YS P  W+    N  F  NY+ I++++  +S  L+C +R       +   S +R          K LR  AF+YP L    P+ +R   C        A + C  +      YQ    +      + +H PER+ PG FD +GHSHQLFHV   I TYFQ+  I  D+  RK  L ++     F NT     F V+  +    +FS+   S    K K+
Sbjct:    2 LNLIKLPQVFTINQVPKVFHEDGIISGYRHPCSSAKDCVLSLFQLTNETLNIWTHFLPTWFFLWKLLTVVLVLE-DWRDPFIWPFLVFLLSCCVYPLASSCAHTFSTMSERARHICFFFDYGALSFYSLGSAIIYSSYSFPDKWV----NGTFHLNYVSIAVVNSIISTALACYSRLGLPFLEYNCHSIKRPSGKLDQKLCKCLRIIAFVYPYLFDNIPLFYRIFVC--------AGEGCTVNEANTVHYQHTSLAFFTGFLFATHLPERLAPGSFDYIGHSHQLFHVFAIIGTYFQMTAIELDMAARKQWLHAHLPPVTFLNTVGAAFFSVVSGLCIVYVFSLSLFSTRGVKNKS 344          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Zebrafish
Match: paqr5b (progestin and adipoQ receptor family member Vb [Source:NCBI gene;Acc:100007661])

HSP 1 Score: 159.073 bits (401), Expect = 6.090e-45
Identity = 108/328 (32.93%), Postives = 172/328 (52.44%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRF------------QTASFRR-----KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTN-WIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVV 1011
            K+    N  QVP+ F E  I SGYR+PRSS + C+ SLF  TNET+N+WTH +P  YF+   ++ +  +   ++  Y  P ++++ +  +Y L SS AH F++MS  ARH+C+  DY A+S ++ G+ +++ AY  P +W+  +    F   YI +++ +  +S  L+C +R             +  S R+     K+LR  AF YP L    P+ +R   C          + C D+   +  +     + L    + +H PER+ PG FD +GHSHQLFHV   I T+FQ+K I  D+  R+  L +     +F+NT    +  V
Sbjct:    6 KLQRVFNVHQVPKAFHEDGIISGYRHPRSSATECVWSLFQLTNETLNVWTHFLPTWYFLWKLMT-VLLMEDVWNEAYTWPLLVFLFSCCVYPLASSCAHTFSSMSTRARHICYFFDYGALSFYSLGSAISYSAYVFPDAWLSSS----FHAYYISVAVFNTVLSTSLACYSRLGLPLLHYSHDIVERFSERQCPRMSKVLRILAFAYPYLFDNIPLFYRLFVC--------VGEGCTDNEANSVHVQHTLLAFLTSFLFATHLPERLAPGRFDYIGHSHQLFHVCAIIGTHFQMKAIEMDMGLRRSQLLASAPAISFNNTIGAALLCV 320          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Xenopus
Match: hspa1l (heat shock protein family A (Hsp70) member 1 like [Source:Xenbase;Acc:XB-GENE-6045069])

HSP 1 Score: 169.088 bits (427), Expect = 1.273e-48
Identity = 120/344 (34.88%), Postives = 176/344 (51.16%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRF----------------QTASFR-RKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYK 1062
            K+   L  +QVP+ F E  I  GYR+P SS + CI SLF  TNETVNIWTH IP  YF+   +S   Y  F +D+ +  P ++Y  +  IY L+S+ AH F+ MS  ARH+CF  DY AVS+++ G  +A+ AY  P  W+  T    F   Y+  ++++  +   L+C +R                 + A  R  K+LR +AF YP L    P+ +R   C       NA            I+    + L    + +H PER+ PG FD +GHSHQLFHV G + TY Q++++  D+  RK  L   + +P+F NT   +   +I + +    F   L +K
Sbjct:    6 KLPRLLTIQQVPKVFHEDSIICGYRSPCSSATACILSLFQMTNETVNIWTHFIPTWYFLWKMLS-FLYSGF-WDDPFLWPLLVYQLSCCIYPLMSTCAHTFSVMSTKARHICFFLDYGAVSLYSLGAAIAYSAYVFPDRWVGGT----FHRWYVFCAVMNTGICTALACYSRLGVPVLHYNQLVIERIPEVARPRLSKVLRTTAFAYPYLFDSIPLFYRLFLCSGSGCAQNAALPMH-------IWHSILAFLTAFLFATHLPERLAPGCFDYVGHSHQLFHVCGILGTYIQMEVLIKDMNLRKKWLMDKDNIPSFSNTLGAWGLGMIMSFIVIACFSLALYWK 336          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Xenopus
Match: hspa1l (heat shock protein family A (Hsp70) member 1 like [Source:Xenbase;Acc:XB-GENE-6045069])

HSP 1 Score: 168.703 bits (426), Expect = 2.917e-48
Identity = 120/344 (34.88%), Postives = 176/344 (51.16%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRF----------------QTASFR-RKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYK 1062
            K+   L  +QVP+ F E  I  GYR+P SS + CI SLF  TNETVNIWTH IP  YF+   +S   Y  F +D+ +  P ++Y  +  IY L+S+ AH F+ MS  ARH+CF  DY AVS+++ G  +A+ AY  P  W+  T    F   Y+  ++++  +   L+C +R                 + A  R  K+LR +AF YP L    P+ +R   C       NA            I+    + L    + +H PER+ PG FD +GHSHQLFHV G + TY Q++++  D+  RK  L   + +P+F NT   +   +I + +    F   L +K
Sbjct:   30 KLPRLLTIQQVPKVFHEDSIICGYRSPCSSATACILSLFQMTNETVNIWTHFIPTWYFLWKMLS-FLYSGF-WDDPFLWPLLVYQLSCCIYPLMSTCAHTFSVMSTKARHICFFLDYGAVSLYSLGAAIAYSAYVFPDRWVGGT----FHRWYVFCAVMNTGICTALACYSRLGVPVLHYNQLVIERIPEVARPRLSKVLRTTAFAYPYLFDSIPLFYRLFLCSGSGCAQNAALPMH-------IWHSILAFLTAFLFATHLPERLAPGCFDYVGHSHQLFHVCGILGTYIQMEVLIKDMNLRKKWLMDKDNIPSFSNTLGAWGLGMIMSFIVIACFSLALYWK 360          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Xenopus
Match: hspa1l (heat shock protein family A (Hsp70) member 1 like [Source:Xenbase;Acc:XB-GENE-6045069])

HSP 1 Score: 167.548 bits (423), Expect = 3.156e-48
Identity = 114/318 (35.85%), Postives = 168/318 (52.83%), Query Frame = 1
Query:  124 FREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKN 1071
            F E  I  GYR+P SS + CI SLF  TNETVNIWTH IP  YF+   +S   Y  F +D+ +  P ++Y  +  IY L+S+ AH F+ MS  ARH+CF  DY AVS+++ G  +A+ AY  P  W+  T    F   Y+  ++++  +   L+C +R    +  R  K+LR +AF YP L    P+ +R   C       NA            I+    + L    + +H PER+ PG FD +GHSHQLFHV G + TY Q++++  D+  RK  L   + +P+F NT   +   +I + +    F   L +K + 
Sbjct:   13 FHEDSIICGYRSPCSSATACILSLFQMTNETVNIWTHFIPTWYFLWKMLS-FLYSGF-WDDPFLWPLLVYQLSCCIYPLMSTCAHTFSVMSTKARHICFFLDYGAVSLYSLGAAIAYSAYVFPDRWVGGT----FHRWYVFCAVMNTGICTALACYSRIPEVARPRLSKVLRTTAFAYPYLFDSIPLFYRLFLCSGSGCAQNAALPMH-------IWHSILAFLTAFLFATHLPERLAPGCFDYVGHSHQLFHVCGILGTYIQMEVLIKDMNLRKKWLMDKDNIPSFSNTLGAWGLGMIMSFIVIACFSLALYWKPQT 317          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Xenopus
Match: hspa1l (heat shock protein family A (Hsp70) member 1 like [Source:Xenbase;Acc:XB-GENE-6045069])

HSP 1 Score: 160.229 bits (404), Expect = 2.307e-45
Identity = 113/330 (34.24%), Postives = 170/330 (51.52%), Query Frame = 1
Query:  124 FREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRF----------------QTASFR-RKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYK 1062
            F E  I  GYR+P SS + CI SLF  TNETVNIWTH IP  YF+   +S   Y  F +D+ +  P ++Y  +  IY L+S+ AH F+ MS  ARH+CF  DY AVS+++ G  +A+ AY  P  W+  T    F   Y+  ++++  +   L+C +R                 + A  R  K+LR +AF YP L    P+ +R   C       + +   ++      I+    + L    + +H PER+ PG FD +GHSHQLFHV G + TY Q++++  D+  RK  L   + +P+F NT   +   +I + +    F   L +K
Sbjct:   13 FHEDSIICGYRSPCSSATACILSLFQMTNETVNIWTHFIPTWYFLWKMLS-FLYSGF-WDDPFLWPLLVYQLSCCIYPLMSTCAHTFSVMSTKARHICFFLDYGAVSLYSLGAAIAYSAYVFPDRWVGGT----FHRWYVFCAVMNTGICTALACYSRLGVPVLHYNQLVIERIPEVARPRLSKVLRTTAFAYPYLFDSIPLFYRLFLC-------SGSGCAQNAALPMHIWHSILAFLTAFLFATHLPERLAPGCFDYVGHSHQLFHVCGILGTYIQMEVLIKDMNLRKKWLMDKDNIPSFSNTLGAWGLGMIMSFIVIACFSLALYWK 329          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Xenopus
Match: PAQR6 (progestin and adipoQ receptor family member VI [Source:NCBI gene;Acc:100494988])

HSP 1 Score: 120.168 bits (300), Expect = 2.295e-30
Identity = 89/252 (35.32%), Postives = 133/252 (52.78%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILG 855
             Q+P  F E  I SGYR+P+SS   C+ S F  TNETVNIWTH +P  YF+  F+     L+F + + Y  P ++Y+  + +Y   SS AH F++MS  ARH+C+  DY A+S+++ G+   + AY +P  WI    ++ F       +   CT    LSC +RF      +  K+LR  AF++P +    P+ FR ++C  F    N  +  +  F       + F+ L    + SH PER+ PG FD  G
Sbjct:   13 HQMPRVFWEDGIISGYRHPKSSALDCLLSSFQMTNETVNIWTHFLPTWYFLWRFLLLSHTLDF-WGHSYNWPLLVYMMLICLYPFTSSFAHTFSSMSAHARHICYFLDYGALSLYSLGSAFIYSAYIMPDRWINSALHRYFV-PIAAFNTFICT---GLSCYSRFLEVDQPQLSKVLRTVAFVHPFMFDNIPLFFRLIFC--FGEDCNWNEAVRLHF-----THLSFAFLTGFLFASHLPERLAPGRFDYFG 252          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Mouse
Match: Paqr6 (progestin and adipoQ receptor family member VI [Source:MGI Symbol;Acc:MGI:1916207])

HSP 1 Score: 166.392 bits (420), Expect = 8.390e-48
Identity = 108/327 (33.03%), Postives = 163/327 (49.85%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFR--RKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDC-KDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQL 1053
            K+   L   QVP  F E  I SGYR P SS   C+ S F  TNETVNIWTH +P  YF+   ++ +    FR D Y+    +  +   +     S  AH F++MS  ARH+C+  DY A+S+++ G    + AYS+P SW+    +++F      ++   CT    LSC +RF    +    K LR +AF YP L    P+ +R   C+           C +D   +N  Y +  ++L+   + +  PER+ PG FD +GHSHQLFH+   + T+FQ++ + +D+ +R+  L           T A     VI N+     F + L
Sbjct:    5 KMPQLLRVHQVPRVFWEEGIMSGYRCPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLWRLLA-LGSPGFRADPYHLPLLVFLLPACLYPFA-SCCAHTFSSMSPRARHICYFLDYGALSLYSLGCAFPYAAYSMPASWLHSRLHQLFVPA-AALNSFLCTG---LSCYSRFPELEYPGFSKALRTAAFAYPFLFDNLPLFYRLRLCW------GGAHSCGRDALSSNHGYHLLCALLSGFLFAARLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLAVQEPTLGLGATVATLSLAVIGNLFIIAAFTASL 319          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Mouse
Match: Paqr5 (progestin and adipoQ receptor family member V [Source:MGI Symbol;Acc:MGI:1921340])

HSP 1 Score: 157.918 bits (398), Expect = 9.952e-45
Identity = 111/318 (34.91%), Postives = 181/318 (56.92%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQL 1053
            +QVP+ F E  I  GYR+P+SS + CI SLF  TNET+NIWTHL+P  +F+  F++ ++  + + D+ Y  P ++Y+ T  +Y L SS AH F++MS  ARH+C+  DY AV++ + G+ +A+ AY+ P + +  T    F   Y+ +++++  +S  LSC +RF      R  KLLR  AF YP      P+ +R    ++F       +  +++        +  ++LA  FY +H PER+ PG FD +GHSHQLFHV   + T+ Q++ I  D   R+  L + ++  +F    A  +  +I ++   +YF + L
Sbjct:   13 DQVPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFVWRFMTALYVTDIQNDS-YSWPMLVYMCTSCVYPLASSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALVCST----FHECYVALAVLNTILSTGLSCYSRFLELQKPRLCKLLRVLAFAYPYTWDSLPIFYRL---FLFPG-----ESSRNEAMLYHQKHMGMTLLASFFYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHLQMEAILLDKTLRREWLLATSRPFSFPQIAAAMLLCIIFSLSNIIYFSAAL 317          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Mouse
Match: Paqr5 (progestin and adipoQ receptor family member V [Source:MGI Symbol;Acc:MGI:1921340])

HSP 1 Score: 153.295 bits (386), Expect = 5.332e-43
Identity = 105/316 (33.23%), Postives = 173/316 (54.75%), Query Frame = 1
Query:  112 VPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQL 1053
            +P  F E  I  GYR+P+SS + CI SLF  TNET+NIWTHL+P  +F+  F++ ++  + + D+Y +   +    + V     SS AH F++MS  ARH+C+  DY AV++ + G+ +A+ AY+ P + +  T    F   Y+ +++++  +S  LSC +RF      R  KLLR  AF YP      P+ +R    ++F       +  +++        +  ++LA  FY +H PER+ PG FD +GHSHQLFHV   + T+ Q++ I  D   R+  L + ++  +F    A  +  +I ++   +YF + L
Sbjct:    1 MPRVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFVWRFMTALYVTDIQNDSYSWPMLVYMCTSCVYPLA-SSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALVCST----FHECYVALAVLNTILSTGLSCYSRFLELQKPRLCKLLRVLAFAYPYTWDSLPIFYRL---FLFPG-----ESSRNEAMLYHQKHMGMTLLASFFYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHLQMEAILLDKTLRREWLLATSRPFSFPQIAAAMLLCIIFSLSNIIYFSAAL 303          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Mouse
Match: Paqr8 (progestin and adipoQ receptor family member VIII [Source:MGI Symbol;Acc:MGI:1921479])

HSP 1 Score: 97.4413 bits (241), Expect = 3.988e-22
Identity = 87/334 (26.05%), Postives = 161/334 (48.20%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRF---QTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNR-KVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKN 1071
            K+  ++ E  VP+ FREP+I++GYR     +     SLF   NE VN+WTHL+ A+  ++ F + +     ++ + +  P +++I + + Y   S LAHL  + S+ + +  +  DY  VS++ +G+ LA + YS   +W E     +F   ++  +     +S    C  ++   +     RK+ +        ++ ISPV  R   C++          C++        QI F +++  F+    PE+ +PG  DI+GH HQ+FH   ++ T  Q++ I  D   R ++ L+ +  L  +    + F  +  C    S    + LR+K+K+
Sbjct:   32 KMPCTVPETDVPQLFREPYIHAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYE-----LFWIFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFVLDISPVAHRVALCHL--------AGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAILLDYQGRHEIFLQRHGPLSVYSACLS-FFVLAAC----SAATATLLRHKVKD 347          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Mouse
Match: Paqr8 (progestin and adipoQ receptor family member VIII [Source:MGI Symbol;Acc:MGI:1921479])

HSP 1 Score: 97.4413 bits (241), Expect = 3.988e-22
Identity = 87/334 (26.05%), Postives = 161/334 (48.20%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRF---QTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNR-KVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKN 1071
            K+  ++ E  VP+ FREP+I++GYR     +     SLF   NE VN+WTHL+ A+  ++ F + +     ++ + +  P +++I + + Y   S LAHL  + S+ + +  +  DY  VS++ +G+ LA + YS   +W E     +F   ++  +     +S    C  ++   +     RK+ +        ++ ISPV  R   C++          C++        QI F +++  F+    PE+ +PG  DI+GH HQ+FH   ++ T  Q++ I  D   R ++ L+ +  L  +    + F  +  C    S    + LR+K+K+
Sbjct:   32 KMPCTVPETDVPQLFREPYIHAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYE-----LFWIFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFVLDISPVAHRVALCHL--------AGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAILLDYQGRHEIFLQRHGPLSVYSACLS-FFVLAAC----SAATATLLRHKVKD 347          
BLAST of Progestin and adipoQ receptor family member 6 vs. UniProt/SwissProt
Match: sp|Q6TCH4|PAQR6_HUMAN (Membrane progestin receptor delta OS=Homo sapiens OX=9606 GN=PAQR6 PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 3.821e-47
Identity = 107/334 (32.04%), Postives = 164/334 (49.10%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQT--ASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKNAP 1077
            K+   L   QVP  F E  I SGYR P SS   C+ S F  TNETVNIWTH +P  YF+   ++      FR + Y++   +  +   +     S  AH F++MS   RH+C+  DY A+S+++ G    + AYS+P SW+    ++ F      ++   CT    LSC +RF    +    K+LR  AF YP L    P+ +R   C+   +        ++   T+  Y +F ++L    + SH PER+ PG FD +GHSHQLFH+   + T+FQ++ + +D+ +R+  L +         T A  +     N+L    F + L       P
Sbjct:    5 KLPQLLQVHQVPRVFWEDGIMSGYRRPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLWRLLALAGGPGFRAEPYHWPLLVFLLPACLYPFA-SCCAHTFSSMSPRMRHICYFLDYGALSLYSLGCAFPYAAYSMPASWLHGHLHQFFVPA-AALNSFLCTG---LSCYSRFLELESPGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCG-----QEALSTSHGYHLFCALLTGFLFASHLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLATQEPALGLAGTVATLVLAAAGNLLIIAAFTATLLRAPSTCP 328          
BLAST of Progestin and adipoQ receptor family member 6 vs. UniProt/SwissProt
Match: sp|Q6TCG5|PAQR6_MOUSE (Membrane progestin receptor delta OS=Mus musculus OX=10090 GN=Paqr6 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 5.869e-47
Identity = 108/327 (33.03%), Postives = 163/327 (49.85%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFR--RKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDC-KDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQL 1053
            K+   L   QVP  F E  I SGYR P SS   C+ S F  TNETVNIWTH +P  YF+   ++ +    FR D Y+    +  +   +     S  AH F++MS  ARH+C+  DY A+S+++ G    + AYS+P SW+    +++F      ++   CT    LSC +RF    +    K LR +AF YP L    P+ +R   C+           C +D   +N  Y +  ++L+   + +  PER+ PG FD +GHSHQLFH+   + T+FQ++ + +D+ +R+  L           T A     VI N+     F + L
Sbjct:    5 KMPQLLRVHQVPRVFWEEGIMSGYRCPTSSALDCVLSSFQMTNETVNIWTHFLPTWYFLWRLLA-LGSPGFRADPYHLPLLVFLLPACLYPFA-SCCAHTFSSMSPRARHICYFLDYGALSLYSLGCAFPYAAYSMPASWLHSRLHQLFVPA-AALNSFLCTG---LSCYSRFPELEYPGFSKALRTAAFAYPFLFDNLPLFYRLRLCW------GGAHSCGRDALSSNHGYHLLCALLSGFLFAARLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLAVQEPTLGLGATVATLSLAVIGNLFIIAAFTASL 319          
BLAST of Progestin and adipoQ receptor family member 6 vs. UniProt/SwissProt
Match: sp|Q7ZVH1|MPRGA_DANRE (Membrane progestin receptor gamma-A OS=Danio rerio OX=7955 GN=paqr5a PE=2 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 2.514e-44
Identity = 120/356 (33.71%), Postives = 181/356 (50.84%), Query Frame = 1
Query:   70 LNRNKIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTR-------FQTASFRR----------KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQ-IFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNI----LFSVYFISQLRYKMKN 1071
            LN  K+       QVP+ F E  I SGYR+P SS   C+ SLF  TNET+NIWTH +P  +F+   ++ +  L   + + +  P+++++ +  +Y L SS AH F+TMS+ ARH+CF  DY A+S ++ G+ + + +YS P  W+    N  F  NY+ I++++  +S  L+C +R       +   S +R          K LR  AF+YP L    P+ +R   C        A + C  +      YQ    +      + +H PER+ PG FD +GHSHQLFHV   I TYFQ+  I  D+  RK  L ++     F NT     F V+  +    +FS+   S    K K+
Sbjct:    2 LNLIKLPQVFTINQVPKVFHEDGIISGYRHPCSSAKDCVLSLFQLTNETLNIWTHFLPTWFFLWKLLTVVLVLE-DWRDPFIWPFLVFLLSCCVYPLASSCAHTFSTMSERARHICFFFDYGALSFYSLGSAIIYSSYSFPDKWV----NGTFHLNYVSIAVVNSIISTALACYSRLGLPFLEYNCHSIKRPSGKLDQKLCKCLRIIAFVYPYLFDNIPLFYRIFVC--------AGEGCTVNEANTVHYQHTSLAFFTGFLFATHLPERLAPGSFDYIGHSHQLFHVFAIIGTYFQMTAIELDMAARKQWLHAHLPPVTFLNTVGAAFFSVVSGLCIVYVFSLSLFSTRGVKNKS 344          
BLAST of Progestin and adipoQ receptor family member 6 vs. UniProt/SwissProt
Match: sp|Q6DC77|MPRGB_DANRE (Membrane progestin receptor gamma-B OS=Danio rerio OX=7955 GN=paqr5b PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 4.597e-44
Identity = 108/328 (32.93%), Postives = 172/328 (52.44%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRF------------QTASFRR-----KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTN-WIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVV 1011
            K+    N  QVP+ F E  I SGYR+PRSS + C+ SLF  TNET+N+WTH +P  YF+   ++ +  +   ++  Y  P ++++ +  +Y L SS AH F++MS  ARH+C+  DY A+S ++ G+ +++ AY  P +W+  +    F   YI +++ +  +S  L+C +R             +  S R+     K+LR  AF YP L    P+ +R   C          + C D+   +  +     + L    + +H PER+ PG FD +GHSHQLFHV   I T+FQ+K I  D+  R+  L +     +F+NT    +  V
Sbjct:    6 KLQRVFNVHQVPKAFHEDGIISGYRHPRSSATECVWSLFQLTNETLNVWTHFLPTWYFLWKLMT-VLLMEDVWNEAYTWPLLVFLFSCCVYPLASSCAHTFSSMSTRARHICYFFDYGALSFYSLGSAISYSAYVFPDAWLSSS----FHAYYISVAVFNTVLSTSLACYSRLGLPLLHYSHDIVERFSERQCPRMSKVLRILAFAYPYLFDNIPLFYRLFVC--------VGEGCTDNEANSVHVQHTLLAFLTSFLFATHLPERLAPGRFDYIGHSHQLFHVCAIIGTHFQMKAIEMDMGLRRSQLLASAPAISFNNTIGAALLCV 320          
BLAST of Progestin and adipoQ receptor family member 6 vs. UniProt/SwissProt
Match: sp|Q9DCU0|PAQR5_MOUSE (Membrane progestin receptor gamma OS=Mus musculus OX=10090 GN=Paqr5 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 6.961e-44
Identity = 111/318 (34.91%), Postives = 181/318 (56.92%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQL 1053
            +QVP+ F E  I  GYR+P+SS + CI SLF  TNET+NIWTHL+P  +F+  F++ ++  + + D+ Y  P ++Y+ T  +Y L SS AH F++MS  ARH+C+  DY AV++ + G+ +A+ AY+ P + +  T    F   Y+ +++++  +S  LSC +RF      R  KLLR  AF YP      P+ +R    ++F       +  +++        +  ++LA  FY +H PER+ PG FD +GHSHQLFHV   + T+ Q++ I  D   R+  L + ++  +F    A  +  +I ++   +YF + L
Sbjct:   13 DQVPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFVWRFMTALYVTDIQNDS-YSWPMLVYMCTSCVYPLASSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALVCST----FHECYVALAVLNTILSTGLSCYSRFLELQKPRLCKLLRVLAFAYPYTWDSLPIFYRL---FLFPG-----ESSRNEAMLYHQKHMGMTLLASFFYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHLQMEAILLDKTLRREWLLATSRPFSFPQIAAAMLLCIIFSLSNIIYFSAAL 317          
BLAST of Progestin and adipoQ receptor family member 6 vs. TrEMBL
Match: A0A2T7PRF1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02973 PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 7.311e-55
Identity = 109/307 (35.50%), Postives = 173/307 (56.35%), Query Frame = 1
Query:  100 NEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICN 1020
            +++++PEHF E FI  GYR+P+SS   C+ SLF  TNET+N WTH +P+ YF+         L+F+ D Y +       A  +     S++AH FNTMS+ ARHVCF  DY+A+S+ + G  +++YAY  P   +          NY+  + +   +    SC TRF   S  R++LR SAF  P +   SP++FRFL+C          D+ +   +T  + Q+ F++ A   Y +H PER+ PG+FDI+GHSHQLFHV   +    Q++ +  D+  RK +++ + +L +F ++      +++ N
Sbjct:  138 HKDEMPEHFHEHFIERGYRHPKSSAWQCVLSLFDATNETLNFWTHFLPSWYFMWVLKGLAETLDFQHDPYTWPLLCYMFACCIFPLA-SAVAHTFNTMSEKARHVCFFLDYSALSLFSFGVAMSYYAYCFPSGLV----GSWLARNYVSGAGVFAILCTTASCMTRFMRPSVLRQVLRLSAFAMPYIFNSSPIIFRFLFC--------TEDERQLASHTLHVRQVVFAVAAAFLYATHLPERLKPGHFDIVGHSHQLFHVATILGVKDQLQAVLLDMQERKAVVQHWTRL-DFASSVGAMSLILLIN 430          
BLAST of Progestin and adipoQ receptor family member 6 vs. TrEMBL
Match: A0A433SJI5 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_023014 PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.898e-54
Identity = 121/315 (38.41%), Postives = 176/315 (55.87%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKI--FTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNAT--------------DDCKDDFYTNWIY--QIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAP 996
            +QVPEHF E +I  GYR P+SS S C+ SLF PTNET+NIWTH +P  YF+         ++F  D+ Y    + Y+     + L S++AHLFN +S+ ARHVCF  DY+A+S+ + G  +A+ AYS P S++   S  +  + +NY+ I+  +  +S +L+C TRF T S   K +R  AF  P      P+L+R    Y++  +L+ +              DD      ++ ++  Q  F  LA  +Y +HFPER+ PG FDI+GHSHQLFHV G +    Q+K I  D  +R+  LE    LP+   T  P
Sbjct:   20 DQVPEHFHEHYILRGYRQPKSSVSQCLLSLFDPTNETINIWTHFLPTCYFVYVTFQLWAVIDFAGDS-YSWALLCYLFVCCAFPLASAVAHLFNVVSEQARHVCFFLDYSALSLFSFGAAVAYRAYSFPSSFLLSRSPVLVWYCDNYVTIAAFNAVLSTLLTCQTRFLTPSPTHKAMRLGAFAIPYFYDNIPILYRICLPYVWPGSLSESHSHGQGHAQLQGDQDDPSLSLGSHNLHARQFMFIGLAAFWYATHFPERLLPGMFDIVGHSHQLFHVCGILAVMDQLKAILLDFHHRRNFLEGL--LPDQHTTLLP 331          
BLAST of Progestin and adipoQ receptor family member 6 vs. TrEMBL
Match: A0A210QIU7 (Membrane progestin receptor gamma-B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04663 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.208e-54
Identity = 117/322 (36.34%), Postives = 180/322 (55.90%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKN 1071
             QVPEHF E FI  GYR+P S+   C+ S+F  TNET+N WTH +P+ YF+         L+F+ ++ Y  P + Y+   VI+ L S+ AH FNTMSD  RH CF  DY A+S+ + G  +A+ AYS P ++++      F +N++ I+ I+  VS++ SC TRF   SF R  +R  +F +P L    P+++R ++C        + ++C          Q  F+  A + + +HFPER YP  FDI GHSHQLFHV   + T  Q++ I  D+ +R+ LL+     P+  ++      V+  N++    F  +LR  +K+
Sbjct:   36 HQVPEHFHEHFIIRGYRHPNSTAKQCLLSVFDATNETLNFWTHFLPSCYFLWVLKGLSETLDFK-NDPYTWPLLAYMFGAVIFPLASATAHTFNTMSDEMRHFCFFLDYGALSVFSLGGVIAYRAYSFPSAFVDT----WFGHNFVRIATINSLVSIIFSCQTRFMKLSFFRTFIRLGSFGFPYLYNSLPIMYRLMFC--------SPEECALPSQYQHARQFIFAFSAAVLFATHFPERFYPAKFDIFGHSHQLFHVASILGTMDQMQAILHDMVDRRALLQDSWWFPSLSDSVGVLGAVMAINVITIGLFSLRLRNFVKS 344          
BLAST of Progestin and adipoQ receptor family member 6 vs. TrEMBL
Match: R7TGY4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_89889 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.513e-53
Identity = 112/318 (35.22%), Postives = 183/318 (57.55%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVIC--NILFSVYFISQL 1053
             ++P  F E +I+ GYR+PRSS   C++S F+  NETVN WTH IPA++++   V++ +  N   D  Y  P + Y+ ++ ++   S+LAHLFNT+S+ ARH+CF  DY A+SI   GT +A++AYS P++ I      +    Y+++++++  +S VLSC TRF     R+K+ R  +F  P L  + PV +R ++  + D +L              + Q  F+ L+ + Y SH PER+ PG FDI+G SHQLFHV   + T+  +  +R D+  R+ L++++        +Y+  + V +   N++   YF  QL
Sbjct:   11 SEIPSFFHELYIHRGYRHPRSSVRSCLRSCFYLHNETVNFWTHFIPAVFYLFVLVTDCYQYNLLLD-AYGLPMLAYLISMTLFPTASALAHLFNTISEKARHMCFFLDYFALSIFGIGTAIAYHAYSFPVALISTWWQHL----YLLVAVVNALLSFVLSCRTRFLDHGLRKKMFRILSFAVPYLFDVLPVCYRAIHGDVVDFSLGGMH--------YHVRQSVFAFLSALIYSSHLPERLSPGRFDIIGQSHQLFHVVSVMGTHDLMTGMRMDMLQRRQLMDAHQP------SYSILLMVAVVGFNLVILYYFWMQL 309          
BLAST of Progestin and adipoQ receptor family member 6 vs. TrEMBL
Match: A0A1U7SC13 (membrane progestin receptor delta isoform X2 OS=Alligator sinensis OX=38654 GN=PAQR6 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.334e-52
Identity = 118/326 (36.20%), Postives = 180/326 (55.21%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKNAP 1077
             QVP  F E  I SGYR+P+SS   CI S F  TNETVNIWTH +P  YF+  F++    L+F  D  Y+ P+++Y+  V +Y   SS AH F+TMS  ARH+C+  DY A+S+++ G    + AY++P +W+    N  F + ++ ++ ++  V   LSC +RF    F R  K+LR +AF+YP +    P+ +R L+C+         D    +    + Y +FF++L    + SH PER+ PG FD +GHSHQLFH+   + T+FQ++ + +DV  R+  L +    P F +T+       + N      F + L      AP
Sbjct:   13 HQVPRIFWEDGIMSGYRHPKSSALDCILSSFQMTNETVNIWTHFLPTWYFVWRFLALSSSLDFCQD-AYHWPFLVYLLLVCLYPFTSSCAHTFSTMSPHARHICYFLDYGALSLYSLGCAFTYGAYAMPDAWV----NSAFHHCFVPVAALNSFVCTTLSCYSRFLELEFPRLSKVLRTTAFVYPFVYDNVPLFYRLLFCF-------GDDRAWTEAVAGYCYHLFFALLTGFLFASHLPERLAPGRFDYIGHSHQLFHICAVVGTHFQLEAVLADVCGRQAWLGARAPAPTFAHTFGTVGAAALGNGAIIAAFTAALLRVPAAAP 326          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Cavefish
Match: paqr5b (membrane progestin receptor gamma-B-like [Source:NCBI gene;Acc:103040532])

HSP 1 Score: 179.104 bits (453), Expect = 8.510e-53
Identity = 112/316 (35.44%), Postives = 174/316 (55.06%), Query Frame = 1
Query:   70 LNRNKIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVV 1011
            L+  K+    N  QVP+ F+E  I SGYR+PRSS + C+ SLF  TNET+N+WTH +P  YF+   ++ +   +  +++ Y  P ++Y+ +  +Y L SS AH F+TMS  ARH+CF  DY A+S ++ G+ + + AY +P  W+    N  F   YI I++ +  +   ++C +RF  +   +  K+LR SAF YP L    P+ +R   C     T+N  +          +Y    + L    + +H PER+ PG FD +GHSHQLFHV G I T+FQ++ I  D+  R+  L+ +     F NT    +  +
Sbjct:    2 LSLIKLPRVFNVHQVPKAFQEDSIISGYRHPRSSATDCVLSLFQLTNETLNVWTHFLPTWYFLWKLLTVVCMQDV-WNDAYTWPLLVYLLSCCVYPLASSCAHTFSTMSTRARHICFFFDYGALSFYSLGSAITYSAYVMPDGWV----NSTFHKYYISIAVFNTIICTAMACYSRFPESQRPKLGKVLRISAFTYPYLFDNIPLFYRIFLCAGEGCTVNEVNSVH-------VYHTLLAFLTGFLFATHLPERLAPGRFDYIGHSHQLFHVCGVIGTHFQMQAIEMDMSLRRAWLQDHAPPVTFSNTLGAALLCI 305          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Cavefish
Match: paqr5b (membrane progestin receptor gamma-B-like [Source:NCBI gene;Acc:103040532])

HSP 1 Score: 170.244 bits (430), Expect = 2.865e-49
Identity = 112/327 (34.25%), Postives = 171/327 (52.29%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQ----------TASFRR-------KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVV 1011
            K+    N  QVP+ F+E  I SGYR+PRSS + C+ SLF  TNET+N+WTH +P  YF+   ++ +   +  +++ Y  P ++Y+ +  +Y L SS AH F+TMS  ARH+CF  DY A+S ++ G+ + + AY +P  W+    N  F   YI I++ +  +   ++C +R            T  F         K+LR SAF YP L    P+ +R   C     T+N  +          +Y    + L    + +H PER+ PG FD +GHSHQLFHV G I T+FQ++ I  D+  R+  L+ +     F NT    +  +
Sbjct:    6 KLPRVFNVHQVPKAFQEDSIISGYRHPRSSATDCVLSLFQLTNETLNVWTHFLPTWYFLWKLLTVVCMQDV-WNDAYTWPLLVYLLSCCVYPLASSCAHTFSTMSTRARHICFFFDYGALSFYSLGSAITYSAYVMPDGWV----NSTFHKYYISIAVFNTIICTAMACYSRLGLPFLHYNHDITERFPESQRPKLGKVLRISAFTYPYLFDNIPLFYRIFLCAGEGCTVNEVNSVH-------VYHTLLAFLTGFLFATHLPERLAPGRFDYIGHSHQLFHVCGVIGTHFQMQAIEMDMSLRRAWLQDHAPPVTFSNTLGAALLCI 320          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Cavefish
Match: paqr6 (progestin and adipoQ receptor family member 6-like [Source:NCBI gene;Acc:111192130])

HSP 1 Score: 167.162 bits (422), Expect = 2.014e-47
Identity = 114/324 (35.19%), Postives = 174/324 (53.70%), Query Frame = 1
Query:   64 MPLN--RNKIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASF--RRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNI 1023
            +P N  R K+ +  +  QVP+ FRE  I SGYR+P+SS   CI S F  TNETVNIWTH +P  YF+  F       NF     Y  P ++Y+  + +Y  ISS AH F+TMS  ARH+C+  DY A+S+++ G  +A+ +Y +P  W+    N     +++ I+I +      +SC +RF    F  + K+LR  AF+ P +    P+++R + C  F    + T+           Y + F+ L    + SH PER+ PG FD  GHSHQLFH+   + T+FQ++ + +D+ +R   L +++  P F  T        I N+
Sbjct:   70 LPANMLRIKLPHLFDNHQVPKVFREDSIISGYRHPQSSAMDCILSSFQMTNETVNIWTHFLPTWYFLWRFFLLCTTENF-LSESYTWPLLVYMMLICLYPFISSCAHTFSTMSPEARHICYFFDYGALSLYSLGCAIAYGSYVMPECWV----NSWLHQHFVSIAIANTIFCTSMSCYSRFLELQFPHKSKILRTGAFVLPFVFDNIPLVYRLVLC--FSGHCSHTEAVSSH-----CYHLLFAFLTGFLFASHLPERLAPGRFDYFGHSHQLFHICAVVGTHFQMEAVLADMSSRHSWLIAHSPGPFFLGTLGALALAFILNM 381          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Cavefish
Match: paqr5a (membrane progestin receptor gamma-A-like [Source:NCBI gene;Acc:103038597])

HSP 1 Score: 160.999 bits (406), Expect = 6.913e-46
Identity = 109/321 (33.96%), Postives = 167/321 (52.02%), Query Frame = 1
Query:   70 LNRNKIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTR--FQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQ-IFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNI 1023
            L+  K+   L   QVP+ F E  I SGYR P SS   C+ SLF  TNET+NIWTH +P  +F+   +  +    ++ D Y +   +  ++  +     SS AH F+TMS+ ARH+CF  DY A+S ++ G+ + + +Y  P  W+    N  F   YI  + ++  +S  L+C +R   ++A+   K LR  AF +P L    P+ +R   C          + C  +  T   YQ    ++L    + +H PER+ PG FD +GHSHQLFHV   I TYFQ+  I  D+  RK  L+++++   F NT    +  V  ++
Sbjct:    2 LSLIKLPQVLTINQVPKVFHEDGIISGYRYPYSSAQDCVLSLFQLTNETLNIWTHFLPTWFFLWKLLMVLVEEEWQEDTYCWPLLVFLVSCCLYPLA-SSCAHTFSTMSERARHICFFFDYGALSFYSLGSAITYSSYVFPEKWV----NSPFHKYYIPAATLNSVISTGLACYSRSTVKSAAKLGKGLRIVAFTFPYLFDNIPLFYRMFMC--------TGEGCTVNDATAVHYQHTALALLTGFLFATHLPERLAPGSFDYIGHSHQLFHVFAIIGTYFQLTAIELDMTLRKRWLQAHSQPITFTNTVGAAILCVASSV 309          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Cavefish
Match: PAQR9 (progestin and adipoQ receptor family member 9 [Source:HGNC Symbol;Acc:HGNC:30131])

HSP 1 Score: 119.398 bits (298), Expect = 4.902e-30
Identity = 99/309 (32.04%), Postives = 144/309 (46.60%), Query Frame = 1
Query:   97 LNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRF--DNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTS------------------NKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIY---QIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLE 954
            L    VP+   E FI SGYR P  S   C+ S F PTNET N WTH +P   F   FV E+F         + ++ P   Y   V    L SS+AHL N+MS   R +CF  DY  +S +  G+ LA+Y Y  P + I K +                     F N YI  S +   V V+  CNTR +   +R  + R   F+ P  ++ +PV +R L    +    ++         T   +     F+ +++ +F IS  PER+ PG FDI GHSHQ FH    ++   ++ +I+ ++  R +LL 
Sbjct:    7 LRHTDVPQRVTENFILSGYRFPDYSLLQCLVSAFRPTNETGNFWTHFLPIFLFTFHFV-EMFEWEGAPTPGDPFFYPAWTYFIGVFYLLLASSMAHLLNSMSLIIREICFFVDYGTISAYTVGSSLAYYYYIHPQAGIPKIAVWAQNASGLQTEISALLFRAFFENLYIPCSCLIAIVCVITCCNTRQRWRKYRYAV-RTLVFLLPFFISSTPVFYRLLSPSPYPVPSSSVSSSSYPSSTMAAFFFRHCFWLVVSAVFNISKIPERLSPGKFDIWGHSHQWFHCCTFLSILDELHMIKVEI--RALLLH 311          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Sea Lamprey
Match: paqr5a (progestin and adipoQ receptor family member Va [Source:NCBI gene;Acc:393156])

HSP 1 Score: 166.777 bits (421), Expect = 1.178e-48
Identity = 120/332 (36.14%), Postives = 176/332 (53.01%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR--KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIY-QIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPN---FDNTYAPFMFVVICNI-LFSVYFISQLRYKMKNAPE 1080
             QVP+ F+E  I SGYR P+SS   CI SLF  TNET+NIWTH +PA YF+   +     L+F     Y  P + Y+ T  +Y L SSLAH F+TMS  + HVCF  DYAA+S+++ G+G+A+ AY  P  W+  T +  F     +++ + CT    L+C +RF         KL+R  AF  P L+   P+ +R L C        + + C  +    W Y  I  ++L    +  H PER+ PG FD +GHSHQLFHV+  + T+ Q++ + +D+  R+  L + N  P    F  +       V  N+ L + + ++  R    NAP 
Sbjct:   13 HQVPKAFQEDGIISGYRCPKSSAFDCILSLFHLTNETLNIWTHFLPACYFMRRLLGFSQSLDF-LGEAYTWPLLAYLFTCCLYLLASSLAHTFSTMSVRSLHVCFFFDYAALSLYSLGSGIAYAAYIFPEQWVHGTLHAYFVPT-AVMNTLLCT---SLACYSRFTELDQPHFSKLIRMLAFFCPYLLDNIPLFYRVLLC--------SGEGCSQNETFPWHYAHILLAVLTACLFSMHLPERLLPGRFDYVGHSHQLFHVSAVLGTHVQLEAVAADMGLRRAWLLT-NVGPEASYFTQSMTALGLAVGLNLGLIAAFSLAMWRTADTNAPH 330          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Sea Lamprey
Match: paqr8 (progestin and adipoQ receptor family member VIII [Source:ZFIN;Acc:ZDB-GENE-030728-3])

HSP 1 Score: 97.8265 bits (242), Expect = 2.023e-23
Identity = 76/277 (27.44%), Postives = 130/277 (46.93%), Query Frame = 1
Query:  109 QVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNR 939
            +VP  F E +I SGYR P   +     SLF   NE  N+WTHL+  +  ++  V +I  L     +    P+ +   +   Y  +S++AHLF++ S+ A +  F  DY  V+++ +G+ +  Y Y           + ++     +++ +SC      +   R    S  RKL +        +V ISP+  R          L  +    D  +   + Q+ F +L+ +F+    PE++ PG F++LGHSHQ+FHV  ++ T  QI+ +  D   R
Sbjct:    1 EVPIVFHEKYITSGYRPPGQPWRFYALSLFARHNEIANVWTHLLGTL-LVLARVGKIPELAATRADIASWPFFLLALSGAAYMALSTVAHLFHSRSELAHYGFFFLDYVGVALYQYGSAVGHYFYCAGPGGFAFLRDDVYLPTTWMLAWLSCAGCCFANLCFRMPH-SLGRKLFKVLPCAVAYVVVISPIAHR----------LVTSSPNHDPAFVFHVAQVAFFLLSAVFFTFPLPEQLKPGRFNVLGHSHQIFHVLLSLCTITQIEAVHLDFLKR 265          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Sea Lamprey
Match: adipor1b (adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2896])

HSP 1 Score: 63.5438 bits (153), Expect = 1.832e-11
Identity = 66/252 (26.19%), Postives = 110/252 (43.65%), Query Frame = 1
Query:  136 FIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXX--XXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIY--QIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHV 879
            F+  G+R P  SF  C +S+F    ET NIWTHLI    F++  V  +F  N  F        +  +     ++    S L H     S+         DY+ +++   G+ + +  YS          N      Y++   +    ++V+S   RF T  +R  +LR + F+      I P     ++  + +  + AT   +    T W++   + +S+ A + Y +  PER +PG  DI  HSHQ+FHV
Sbjct:  106 FLLQGHRPPMPSFRACFRSIFRLHTETGNIWTHLIGFFLFVVLAVIYLFRPNMSFVAPLQEKVVFGVFFMGAILCLCFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSF-------YCNPQPRLIYLVTICVLGIAAIVVSQWERFSTPQYR--VLRAAVFLSLGFSGIVPT----VHFMVVEGFMRATTAGQ----TGWLFLMGLLYSMGAAL-YAARIPERFFPGMCDIWFHSHQIFHV 339          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Yeast
Match: IZH1 (Membrane protein involved in zinc ion homeostasis; member of the four-protein IZH family; transcription is regulated directly by Zap1p, expression induced by zinc deficiency and fatty acids; deletion increases sensitivity to elevated zinc; IZH1 has a paralog, IZH4, that arose from the whole genome duplication [Source:SGD;Acc:S000002900])

HSP 1 Score: 56.6102 bits (135), Expect = 1.686e-9
Identity = 72/281 (25.62%), Postives = 124/281 (44.13%), Query Frame = 1
Query:  100 NEEQVPEHFRE-PFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAI-YFIICFVSEIFYLNFRFDNXXXXXXXXX---XXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAV--SIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRR-KLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLI 918
            N +++PE  ++   I +GY     S+  C+ SLF+  NETVNI+THL+PAI YF+       ++L   F +  ++ Y +    +       + SS  H     S+   +     DY  +   I      + ++ Y   IS+       +FT    ++    CTV V+   + +F T++FR  + + F  F +  L+ ++   F+F             +  K  F     ++  F I   + Y    PE + PG FD  G SHQ+FH+   + +   +K I
Sbjct:   42 NFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFS-----LFT-IVTLVLATFCTVCVL---HDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKF-------GIQGVLNRIKVSFV---FWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAI 303          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Yeast
Match: IZH2 (Plasma membrane receptor for plant antifungal osmotin; involved in zinc ion homeostasis, apoptosis; negatively regulates ZRT1 and other functionally divergent genes through CCCTC promoter motif (IzRE); modulates FET3 activity in iron-independent manner; affects gene expression by influencing balance of competition between Msn2p/Msn4p and Nrg1p/Nrg2p for binding to IzRE; transcription regulated by Zap1p, zinc, fatty acid levels; homolog of mammalian adiponectin receptor [Source:SGD;Acc:S000005362])

HSP 1 Score: 55.0694 bits (131), Expect = 5.960e-9
Identity = 41/114 (35.96%), Postives = 58/114 (50.88%), Query Frame = 1
Query:  565 TVSVVLSCNTRFQTASFRRKLLR-FSAFMYPC--LVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYI-------SHFPERIYPGYFDILGHSHQLFH 876
            TVS  ++C+       FR++  R + A ++ C  L +I P+ F  LYCY F            + +T    Q+F+ +L  + YI         FPE+I PG FDI GHSHQLFH
Sbjct:  187 TVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPI-FSGLYCYSFS-----------EIWTQ--IQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFH 286          

HSP 2 Score: 46.9802 bits (110), Expect = 2.355e-6
Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  106 EQVPEHFRE-PFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYF 255
            +++PE  R+  FI  GY    SSF    KSLF+  NE+VNI++HLIPA+ F
Sbjct:   43 DEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGF 93          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Nematostella
Match: EDO33000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STF9])

HSP 1 Score: 144.05 bits (362), Expect = 3.463e-40
Identity = 105/318 (33.02%), Postives = 164/318 (51.57%), Query Frame = 1
Query:   97 LNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFD--NXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFS---AFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSV 1035
            L+ E+VP  FRE FI SGYR P +S   CIKS F P NET+N WTH +P + F     S  F   F  D  + Y  P + +   +  + L+SS AHLFN+MS   RH CF CDY+A+S+++ G GL+FY YS PI        K+    YI  SI+   +S  L C +R + A+++  +   S   AF+Y CL    P  +RF+        +   D       + +     F ++A +   +  PER+ PG FD++GHSH   H+   +    Q   +  ++ +R+ +L+  +      + Y+  + ++IC +L ++
Sbjct:    1 LSAEEVPLQFREQFIISGYRRPYASARDCIKSAFGPYNETLNFWTHFVPFLLF-----SARFVWTFHRDGIDLYRLPLVSFALGICGFLLMSSCAHLFNSMSPRIRHCCFFCDYSAISVYSVGAGLSFYFYSRPIGVGVFPPPKV----YITGSILISLLSTTLCCASRHRWANYKYAIRTGSFVLAFLYNCL----PHFYRFI--------IEGADKLDPVAMSYFKRHTVFYLIAAVANTTRIPERLIPGVFDVIGHSHNFLHIFTALGVADQYTAMELEMIHREPILKHLHV-----DVYSKSLNLMICALLANI 292          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Nematostella
Match: EDO49851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV2])

HSP 1 Score: 137.887 bits (346), Expect = 1.666e-37
Identity = 103/324 (31.79%), Postives = 155/324 (47.84%), Query Frame = 1
Query:   97 LNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRK------LLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHV---TGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYF 1041
            L +  V   FREPFI SGYR P  SF  CI S F+  NET+N+W+H++  + F+   +      +  F + +  P + +   +    L+SS AHLFN MS   RH+CF  DYAA+S +    GL FY YS P      T  K+  +N + +      +S  +S  T +   + R K      LLR   F+   L    P   R +YC   D+ L    +C    +  +  Q+F+  LA +  +   PER  PG FD  G SH   H+    G I+ +  ++L  +    R++L  S   LP F N+    + V++ NI   ++F
Sbjct:   20 LGDRAVDFEFREPFIVSGYRRPGFSFKQCIHSAFYAHNETINVWSHILALVGFLYHCLPVFCLRSNPFTDPFVYPLLSFSLGISAMFLMSSSAHLFNCMSAKVRHICFFFDYAAISTYTFTAGLVFYYYSRP----TNTDLKLMNSNCLFL-----CISAAISLATTYLCCASRHKWVQHKFLLRTGTFVISWLFNTLPFTTRAIYC---DSKL----ECNTVAFAYFKRQVFYFFLAALSNVIRIPERFIPGLFDFFGQSHHFLHILCSLGAIDDFVAVELDMN--IRREILHASSTVLPTFGNSLGLMIAVLLGNIAIVIWF 325          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Nematostella
Match: EDO49996 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REZ2])

HSP 1 Score: 129.798 bits (325), Expect = 3.102e-35
Identity = 94/271 (34.69%), Postives = 142/271 (52.40%), Query Frame = 1
Query:   91 YSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLS---CNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWI-YQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTI 891
            Y   ++++PE  R P+I++ YR P  S   CI+S+F P NETVNIW+H I A  F+I   S++      FD+    P       +V+   +S+  HLFN+MS  A HVC+ CDYAA+SI    T  A + YS PIS    TS ++F  N  I  +    ++ +LS   C        +    +R SA++   L T+ P L R  +C     +  A+ +C    Y ++  Y ++F+I  V  Y +  PER++P  FD+LG SH + HV   +
Sbjct:    4 YGFTDKELPEKMRVPYIHTRYRRPCLSVEQCIESMFQPHNETVNIWSHFIAAFVFLI-HNSDLLREYRNFDDPLVAPLACCAVGIVVLFFVSACTHLFNSMSLLAYHVCYFCDYAAISICTFTTAQAMFFYSRPIS----TSWRMF--NSPIAFLGFAVMNSLLSTFTCCAVLVRRPWYHAFVRTSAYLSLGLFTVLPYLGRLAFC-----SYTASVECTTPSYIHFKRYCLYFTIAGVT-YANRIPERLFPKMFDLLGQSHHILHVLSAM 261          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Nematostella
Match: EDO27689 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8J6])

HSP 1 Score: 122.865 bits (307), Expect = 8.026e-32
Identity = 109/329 (33.13%), Postives = 149/329 (45.29%), Query Frame = 1
Query:  109 QVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLP--ISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSC-NTRFQTASFRRKL-----LRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKN 1071
             +PE FR PFI +GYR P  +   C KSL  PTNETVN+WTH++  + F++ F S +F  N  FD + Y      I    +  + SS AHL N MS  A H+ F  DYAA+ +++     AF+ YS P    ++  +S  +F            TVS ++SC  T    AS  R L     +R S FM   ++  SP  +R  Y      T  A        Y N    I   IL+    ++  PER +P  FD LG SH   H+   +           D+  R+ LL      PN  NT+  F  V   N LF VY  S+   K + 
Sbjct:   58 DIPEGFRTPFIKTGYRKPGLTMWGCFKSLIEPTNETVNVWTHVLALVLFLLRF-SNVFS-NSDFDPWCYGLVCFAIGIASLMAMSSS-AHLINCMSLSAHHIGFYLDYAAICVYSFSGSQAFFFYSRPSQTDFVLLSSPTVFL-----------TVSAIMSCLCTAVCCASRHRWLRSKYVIRTSMFMLYFIIVTSPFTYRLAYSTAESETSRAVH------YFN--RHIINYILSAFVNVTKLPERYFPRLFDFLGQSHHFLHILAALGAADAFTATNLDMKTRQDLLAGLPG-PNLWNTFGVFFTVAFTN-LFIVYLFSKALLKQEK 362          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Nematostella
Match: EDO41474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S482])

HSP 1 Score: 120.553 bits (301), Expect = 7.111e-31
Identity = 107/350 (30.57%), Postives = 158/350 (45.14%), Query Frame = 1
Query:  106 EQVPEHFREPFIYSGYRNPRSSFSL--CIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFD-NXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNN----YXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDD----FYTNWI-YQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKNAPE*LILSLTYQIISR 1119
             ++P  + EPFI SGYRNP  +FSL  C+ + F   NET+NIW+HLI  I F + F  +   L   F       P + +   + +  + S+ AHLF  +S+  RH+CF  DYAA+S+       AFY YS P      +   +F  +    Y+ IS     V+V LSC +R     FR  LLR    +   L    P + R  +C +         DC       FY +W+ Y I     + + Y +  PER  PG FD  GHSH   H+      Y+    +  D+ NR  LL      P    T+   + V++   + +  FI +   + + A E  +    Y +I R
Sbjct:   44 HELPPSYHEPFILSGYRNP-GNFSLRQCLVTAFSLHNETINIWSHLIAFIAFAVYFYYKFQALGVGFTFGPTGYPLMCFAFGICLVFISSAGAHLFCCLSEECRHICFYLDYAAISVFTLTAAQAFYFYSRP------SGKTLFIFDSPHLYLGISAFLSVVNVALSCLSRHYLRDFRF-LLRAGPNLIKILYDTWPFVARINHCTM-------ATDCNAIAVTLFYRHWLCYGI-----SGITYAAKIPERWMPGVFDFFGHSHHFLHIVTIFGNYYAFLAVSLDMTNRAELLSKLPVQPTVFTTFGMLLIVLLSGGIITWVFIYRFLQQDRGADE-YVGGTQYTVIYR 372          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Medaka
Match: paqr6 (membrane progestin receptor delta [Source:NCBI gene;Acc:101163930])

HSP 1 Score: 169.859 bits (429), Expect = 2.502e-48
Identity = 109/323 (33.75%), Postives = 174/323 (53.87%), Query Frame = 1
Query:  109 QVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASF--RRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCK-DDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMK 1068
            QVP+ FRE  I SGYR+PRSS   CI S F   NET+NIWTH +P  YF+  F      ++F  D+Y +   +  +   V     S  AH+F+TMS  +RH+C+  DY A+S+++ G  +++  Y +P  W+    N     ++I I+I +  +   +SC +RF    F  R K LR  AF+ P L    P+ +R L        L+    C   +  +N  Y + F+ L    + +H PER+ PG FD  GHSHQLFHV+  + T+FQ++ + +D+ +R+  L+++   P+F +T+   +   + N+     F + L +K +
Sbjct:   98 QVPKVFREDGIISGYRHPRSSALDCILSSFQMNNETINIWTHFLPTWYFLWRFFLLGSTMDFLSDSYAWPLLVYMLLICVYPFT-SCCAHIFSTMSPESRHICYFFDYGALSLYSLGCAISYGFYVMPDCWV----NSWIQQHFIPIAIGNSLLCTSMSCYSRFVELQFPQRSKALRTGAFVVPFLFDTVPLFYRVL--------LSCWGSCSLGEALSNHCYHLLFAFLTCFLFTAHLPERLAPGRFDYFGHSHQLFHVSAVVGTHFQMEGVLADMSSRRQWLQTHGLAPSFLSTFGALVLSFVLNLGIIAVFSALLLWKPR 407          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Medaka
Match: paqr5a (progestin and adipoQ receptor family member 5 [Source:NCBI gene;Acc:101168190])

HSP 1 Score: 166.392 bits (420), Expect = 9.355e-48
Identity = 121/358 (33.80%), Postives = 184/358 (51.40%), Query Frame = 1
Query:   82 KIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRF------------------QTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIY--QIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLP-NFDNTYAPFMFVVICN----ILFSVYFISQLRYKMKNAPE 1080
            K+   L   QVP+ F+E  I SGYR PRSS   CI+SLF  TNET+NIWTH +P  YF+   V+ +  +   + +    P ++++++  IY L SS AH F++MS  ARH+CF  DY A+S ++ G+ + + AY  P  W    +N  F   YI I++ +  +S  L+C +R                   Q+  F  K LR  AF YP L    P+ +R   C        A + C D+  TN ++   +  + L    + +H PER+ PG FD +GHSHQLFHV   + T+FQ++ +  D+  R+  L + N +P  F N+  P +  ++ N     LFS+  +S         P+
Sbjct:    6 KVPQVLTINQVPKVFQEDCIISGYRQPRSSAVDCIRSLFQLTNETLNIWTHFLPTWYFLWKLVTVVL-MQTAWQDSLTWPLLVFLSSCCIYPLASSCAHTFSSMSTRARHICFFFDYGALSFYSLGSAVVYSAYVFPDKW----TNGYFHQCYIPIAVFNAIISTTLACYSRLGFPFLQYNHDVTRRFPECQSPKF-SKFLRVVAFAYPYLFDNIPLFYRVFLC--------AGEGCTDN-ETNMLHYNHVALAFLTGFLFATHLPERLAPGSFDYIGHSHQLFHVFAILGTHFQMQAVEQDMAIRRPWLTA-NSIPITFANSMGPALVCLVLNCIIIALFSLPLLSGPGGNHGKQPK 347          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Medaka
Match: paqr6 (membrane progestin receptor delta [Source:NCBI gene;Acc:101163930])

HSP 1 Score: 161.384 bits (407), Expect = 3.261e-45
Identity = 110/341 (32.26%), Postives = 177/341 (51.91%), Query Frame = 1
Query:  109 QVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIF--------YLNFRF----------DNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASF--RRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCK-DDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMK 1068
            QVP+ FRE  I SGYR+PRSS   CI S F   NET+NIWTH +P  +    F+            Y  +RF           + Y  P ++Y+  + +Y   S  AH+F+TMS  +RH+C+  DY A+S+++ G  +++  Y +P  W+    N     ++I I+I +  +   +SC +RF    F  R K LR  AF+ P L    P+ +R L        L+    C   +  +N  Y + F+ L    + +H PER+ PG FD  GHSHQLFHV+  + T+FQ++ + +D+ +R+  L+++   P+F +T+   +   + N+     F + L +K +
Sbjct:   83 QVPKVFREDGIISGYRHPRSSALDCILSSFQMNNETINIWTHFLPTWWASPLFIKSTLKDVLRTWRYFLWRFFLLGSTMDFLSDSYAWPLLVYMLLICVYPFTSCCAHIFSTMSPESRHICYFFDYGALSLYSLGCAISYGFYVMPDCWV----NSWIQQHFIPIAIGNSLLCTSMSCYSRFVELQFPQRSKALRTGAFVVPFLFDTVPLFYRVL--------LSCWGSCSLGEALSNHCYHLLFAFLTCFLFTAHLPERLAPGRFDYFGHSHQLFHVSAVVGTHFQMEGVLADMSSRRQWLQTHGLAPSFLSTFGALVLSFVLNLGIIAVFSALLLWKPR 411          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Medaka
Match: PAQR9 (membrane progesterone receptor epsilon [Source:NCBI gene;Acc:101170991])

HSP 1 Score: 119.013 bits (297), Expect = 6.647e-30
Identity = 95/316 (30.06%), Postives = 144/316 (45.57%), Query Frame = 1
Query:   97 LNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXX--XXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTS----------------------NKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLP 972
            L    VP    E FI +GYR P  S   C+ S F PTNET N WTH +P   F   FV E+F  N    +     Y ++   + +    + SS+AHL N+MS   R VCF  DY  +S +  G+ LA+Y Y  P + +                          +  F   YI  + +   + ++  CNTR Q     R ++R   F+ P LV+ +P+ +R L         +++      F+        + + + +F IS  PER+ PG FDI GHSHQ FH    ++   ++ +I+++V  R +LL     LP
Sbjct:   10 LRHTDVPPRVIENFILTGYRFPNYSLRDCLLSAFRPTNETGNFWTHFLPVFIFAYYFV-EVFGWNGAPGSSAPFFYPLWNYFMGVFCLLMASSMAHLLNSMSLVVREVCFFVDYGTISAYTVGSSLAYYYYIHPRAGVADKGALNDTFSGVRDGGDGAALTPDLSVFFETLYIPSAFVVAIICILSCCNTR-QRWRQHRYIIRTLVFLLPFLVSSTPIFYRLLSGSPHSAASSSSSSTMSRFFYR---HCLWLLASALFNISKLPERLAPGRFDIWGHSHQWFHCCTFLSILDELHMIKAEV--RAILLHPDLVLP 318          
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Medaka
Match: paqr7b (G protein coupled progestin receptor alpha [Source:NCBI gene;Acc:100415783])

HSP 1 Score: 110.538 bits (275), Expect = 5.786e-27
Identity = 89/334 (26.65%), Postives = 158/334 (47.31%), Query Frame = 1
Query:   94 SLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRF---QTASFRRKLLRF--SAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKNAPE 1080
            ++    VP+ F+E  I++GYR    S+     +LF   NET+N+WTHL+ A+  ++ +      ++F  D +    +I+ +A     +  S+LAHL +  S+ + +  +  DY  V+++ +G+ LA Y Y      +EK  + +    ++  +     ++    C  ++   +   F  KL +   SA  Y CL  ISPV+ R   CY         + C D      +Y + F +++  F+    PE ++PG  D +G  HQ+FHV   + T  QI+ +R+D   R+ L E  +     D   A F+F   C  L + Y   ++R  + +  E
Sbjct:   36 TVKLSDVPKVFQERHIHTGYRQTDQSWRYYFLTLFQRHNETINVWTHLLAALIILVKWQEISETVDFLRDPHAQPLFIVLLAAFTYLSF-SALAHLLSAKSELSYYTFYFLDYVGVAVYQYGSALAHYYYV-----VEKELHTMVRGFFLPSAAFLAWLTCFGCCYGKYAGPELPKFAHKLFQVVPSALAY-CL-DISPVVHRIYSCY--------REGCSDPMVVYHVYHVIFFLISAYFFCCPHPESLFPGKCDFIGQGHQIFHVFVVVCTLMQIEALRTDFTVRRPLYERLHGDLAHDAV-ALFIFTTCCCALTAFYVRKRVRSSLHDKEE 352          
BLAST of Progestin and adipoQ receptor family member 6 vs. Planmine SMEST
Match: SMESG000044081.1 (SMESG000044081.1)

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 339/339 (100.00%), Postives = 339/339 (100.00%), Query Frame = 1
Query:   64 MPLNRNKIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKNAPE 1080
            MPLNRNKIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNYYYTPYIIYIATVVIYTLISSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYIIISIISCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKNAPE
Sbjct:    1 MPLNRNKIHYSLNEEQVPEHFREPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRFDNYYYTPYIIYIATVVIYTLISSLAHLFNTMSDWARHVCFICDYAAVSIHAHGTGLAFYAYSLPISWIEKTSNKIFTNNYIIISIISCTVSVVLSCNTRFQTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTYFQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQLRYKMKNAPE 339          
BLAST of Progestin and adipoQ receptor family member 6 vs. Planmine SMEST
Match: SMESG000021251.1 (SMESG000021251.1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.670e-11
Identity = 81/289 (28.03%), Postives = 129/289 (44.64%), Query Frame = 1
Query:   73 NRNKIHYSLNEEQ------VPEHFR-EPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFI-ICFVSEIFYLNFRFDNXXXXXXXXXXXXXXXXXXXSSLA-HLFNTMSDWARHVCFICDYAAVSIHAHGTGLA--FYAYSLPISWIEKTSNKIFTNNYXXXXXXXCTVSVVL-SCNTRFQT-ASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDFYTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTY 900
            N + I YS+  E+      +P + +  PFI SGYR   +    CIKS+F  +NE+VNIWTHLI  I FI    V  +  L  +  ++     I       I  ++SS+  HLF+  S+  +   F  D   + I   G  L   ++AY    +W            + +   +S  +SV++   + R++   SF +   R S F+   +  + P +  ++Y     N   +  +    F    I       L+ +FY    PER +PG FD +G SHQ++HV   I  Y
Sbjct:    7 NNHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYT-IKQCIKSIFQFSNESVNIWTHLIGFIIFIYYLIVDNVIQLPLKNGSFNDHLIISIGLLCYIICMLSSVGYHLFSCHSEPMQQFWFSIDLTGICIGLIGCYLPGIYFAYYCFSAW----------QKFYMFFTLSLAISVLIFQLSPRYRGHESFCK---RTSIFLVLAIFGVVPTV-HWIY---LSNGFRS--EIVSIFLQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLICFY 275          
BLAST of Progestin and adipoQ receptor family member 6 vs. Planmine SMEST
Match: SMESG000021251.1 (SMESG000021251.1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.452e-6
Identity = 31/69 (44.93%), Postives = 41/69 (59.42%), Query Frame = 1
Query:   73 NRNKIHYSLNEEQ------VPEHFR-EPFIYSGYRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFI 258
            N + I YS+  E+      +P + +  PFI SGYR   +    CIKS+F  +NE+VNIWTHLI  I FI
Sbjct:    7 NNHNIQYSIKCERLLKYSSIPVYLKWNPFIKSGYRTSYT-IKQCIKSIFQFSNESVNIWTHLIGFIIFI 74          
The following BLAST results are available for this feature:
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAQR67.956e-4832.04progestin and adipoQ receptor family member 6 [Sou... [more]
PAQR65.282e-4632.00progestin and adipoQ receptor family member 6 [Sou... [more]
PAQR62.898e-4431.63progestin and adipoQ receptor family member 6 [Sou... [more]
PAQR58.127e-4434.28progestin and adipoQ receptor family member 5 [Sou... [more]
PAQR58.127e-4434.28progestin and adipoQ receptor family member 5 [Sou... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
K11C4.23.551e-1527.27pep chromosome:WBcel235:V:6895078:6896922:1 gene:W... [more]
paqr-11.142e-725.78Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-11.481e-625.78Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-11.481e-625.78Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-11.481e-625.78Progestin and adipoQ receptor-like protein 1 [Sou... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG75301.788e-740.98gene:FBgn0038256 transcript:FBtr0333277[more]
CG75302.172e-740.98gene:FBgn0038256 transcript:FBtr0083021[more]
CG75302.172e-740.98gene:FBgn0038256 transcript:FBtr0083019[more]
CG75302.172e-740.98gene:FBgn0038256 transcript:FBtr0083020[more]
AdipoR3.145e-624.38gene:FBgn0038984 transcript:FBtr0084284[more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paqr63.726e-5437.54progestin and adipoQ receptor family member VI [So... [more]
paqr61.080e-4936.82progestin and adipoQ receptor family member VI [So... [more]
paqr5b9.520e-4934.50progestin and adipoQ receptor family member Vb [So... [more]
paqr5a3.330e-4533.71progestin and adipoQ receptor family member Va [So... [more]
paqr5b6.090e-4532.93progestin and adipoQ receptor family member Vb [So... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa1l1.273e-4834.88heat shock protein family A (Hsp70) member 1 like ... [more]
hspa1l2.917e-4834.88heat shock protein family A (Hsp70) member 1 like ... [more]
hspa1l3.156e-4835.85heat shock protein family A (Hsp70) member 1 like ... [more]
hspa1l2.307e-4534.24heat shock protein family A (Hsp70) member 1 like ... [more]
PAQR62.295e-3035.32progestin and adipoQ receptor family member VI [So... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Paqr68.390e-4833.03progestin and adipoQ receptor family member VI [So... [more]
Paqr59.952e-4534.91progestin and adipoQ receptor family member V [Sou... [more]
Paqr55.332e-4333.23progestin and adipoQ receptor family member V [Sou... [more]
Paqr83.988e-2226.05progestin and adipoQ receptor family member VIII [... [more]
Paqr83.988e-2226.05progestin and adipoQ receptor family member VIII [... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6TCH4|PAQR6_HUMAN3.821e-4732.04Membrane progestin receptor delta OS=Homo sapiens ... [more]
sp|Q6TCG5|PAQR6_MOUSE5.869e-4733.03Membrane progestin receptor delta OS=Mus musculus ... [more]
sp|Q7ZVH1|MPRGA_DANRE2.514e-4433.71Membrane progestin receptor gamma-A OS=Danio rerio... [more]
sp|Q6DC77|MPRGB_DANRE4.597e-4432.93Membrane progestin receptor gamma-B OS=Danio rerio... [more]
sp|Q9DCU0|PAQR5_MOUSE6.961e-4434.91Membrane progestin receptor gamma OS=Mus musculus ... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PRF17.311e-5535.50Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A433SJI51.898e-5438.41Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A210QIU74.208e-5436.34Membrane progestin receptor gamma-B OS=Mizuhopecte... [more]
R7TGY42.513e-5335.22Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1U7SC131.334e-5236.20membrane progestin receptor delta isoform X2 OS=Al... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paqr5b8.510e-5335.44membrane progestin receptor gamma-B-like [Source:N... [more]
paqr5b2.865e-4934.25membrane progestin receptor gamma-B-like [Source:N... [more]
paqr62.014e-4735.19progestin and adipoQ receptor family member 6-like... [more]
paqr5a6.913e-4633.96membrane progestin receptor gamma-A-like [Source:N... [more]
PAQR94.902e-3032.04progestin and adipoQ receptor family member 9 [Sou... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
paqr5a1.178e-4836.14progestin and adipoQ receptor family member Va [So... [more]
paqr82.023e-2327.44progestin and adipoQ receptor family member VIII [... [more]
adipor1b1.832e-1126.19adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
IZH11.686e-925.62Membrane protein involved in zinc ion homeostasis;... [more]
IZH25.960e-935.96Plasma membrane receptor for plant antifungal osmo... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO330003.463e-4033.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498511.666e-3731.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499963.102e-3534.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276898.026e-3233.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414747.111e-3130.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paqr62.502e-4833.75membrane progestin receptor delta [Source:NCBI gen... [more]
paqr5a9.355e-4833.80progestin and adipoQ receptor family member 5 [Sou... [more]
paqr63.261e-4532.26membrane progestin receptor delta [Source:NCBI gen... [more]
PAQR96.647e-3030.06membrane progesterone receptor epsilon [Source:NCB... [more]
paqr7b5.786e-2726.65G protein coupled progestin receptor alpha [Source... [more]
back to top
BLAST of Progestin and adipoQ receptor family member 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000044081.10.000e+0100.00SMESG000044081.1[more]
SMESG000021251.12.670e-1128.03SMESG000021251.1[more]
SMESG000021251.11.452e-644.93SMESG000021251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027202 ID=SMED30027202|Name=Progestin and adipoQ receptor family member 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1137bp
CTATATAAATCTTATATGAATAATAGAAATCCAATCTTTGCATGGATGGG
ATTTTTGATTTTCATGCCTTTAAATCGTAATAAAATTCATTACAGTTTGA
ATGAAGAGCAAGTTCCAGAACATTTTCGTGAGCCATTTATTTATTCTGGC
TATCGTAATCCAAGAAGCTCATTTTCTCTTTGTATTAAATCTCTATTTTT
TCCAACAAATGAAACAGTGAACATATGGACACATTTAATCCCAGCCATTT
ATTTCATAATCTGCTTTGTTTCGGAGATATTCTATTTAAATTTTAGATTT
GATAATTATTACTATACCCCTTATATTATTTATATTGCTACAGTAGTTAT
ATATACACTTATTAGTTCTTTAGCTCATTTATTCAATACGATGTCAGATT
GGGCTCGCCATGTATGTTTTATATGTGATTATGCGGCAGTGAGTATTCAT
GCGCATGGTACTGGACTTGCGTTTTACGCTTATTCTTTACCGATTTCTTG
GATTGAAAAAACATCAAACAAAATATTCACGAATAACTATATTATAATAT
CTATCATATCTTGTACAGTTAGTGTCGTTTTATCTTGCAACACAAGATTT
CAAACTGCCAGCTTCCGTCGAAAACTTTTAAGATTCAGTGCTTTTATGTA
TCCTTGTTTAGTTACTATTTCGCCTGTTTTATTTCGTTTTTTATATTGTT
ACATTTTTGACAATACATTGAATGCTACAGATGACTGCAAAGACGATTTC
TATACGAATTGGATTTATCAAATTTTTTTTTCTATACTTGCTGTTATGTT
TTACATTTCACACTTTCCGGAAAGAATTTATCCCGGATATTTCGATATTT
TAGGTCATAGTCATCAATTGTTTCATGTTACTGGAACTATTAATACGTAC
TTTCAAATCAAACTAATCAGGTCTGATGTTTTTAATAGAAAGGTTTTGCT
AGAATCCTACAATAAATTGCCTAATTTTGATAATACATATGCTCCTTTCA
TGTTTGTGGTAATTTGTAATATTTTGTTCTCAGTGTATTTCATTTCTCAA
TTACGTTATAAAATGAAAAATGCACCAGAATAATTGATTTTGAGTTTGAC
ATATCAAATAATTTCTAGAACAGGTTTTACAGTAAGT
back to top

protein sequence of SMED30027202-orf-1

>SMED30027202-orf-1 ID=SMED30027202-orf-1|Name=SMED30027202-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
LYKSYMNNRNPIFAWMGFLIFMPLNRNKIHYSLNEEQVPEHFREPFIYSG
YRNPRSSFSLCIKSLFFPTNETVNIWTHLIPAIYFIICFVSEIFYLNFRF
DNYYYTPYIIYIATVVIYTLISSLAHLFNTMSDWARHVCFICDYAAVSIH
AHGTGLAFYAYSLPISWIEKTSNKIFTNNYIIISIISCTVSVVLSCNTRF
QTASFRRKLLRFSAFMYPCLVTISPVLFRFLYCYIFDNTLNATDDCKDDF
YTNWIYQIFFSILAVMFYISHFPERIYPGYFDILGHSHQLFHVTGTINTY
FQIKLIRSDVFNRKVLLESYNKLPNFDNTYAPFMFVVICNILFSVYFISQ
LRYKMKNAPE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR004254AdipoR/HlyIII-related
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004254AdipoR/Haemolysin-III-relatedPFAMPF03006HlyIIIcoord: 63..295
e-value: 1.5E-33
score: 116.4
IPR004254AdipoR/Haemolysin-III-relatedPANTHERPTHR20855ADIPOR/PROGESTIN RECEPTOR-RELATEDcoord: 14..338
NoneNo IPR availablePANTHERPTHR20855:SF61coord: 14..338
NoneNo IPR availableTMHMMTMhelixcoord: 69..91
NoneNo IPR availableTMHMMTMhelixcoord: 244..266
NoneNo IPR availableTMHMMTMhelixcoord: 169..188
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 203..225
NoneNo IPR availableTMHMMTMhelixcoord: 323..342