Palmitoyltransferase

Overview
NamePalmitoyltransferase
Smed IDSMED30027199
Length (bp)2048
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Palmitoyltransferase (SMED30027199) t-SNE clustered cells

Violin plots show distribution of expression levels for Palmitoyltransferase (SMED30027199) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Palmitoyltransferase (SMED30027199) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Palmitoyltransferase (SMED30027199) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027199

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30027199SMESG000033660.1 dd_Smed_v4_7720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027199SMESG000033660.1 dd_Smed_v4_7720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC5 (zinc finger DHHC-type containing 5 [Source:HGNC Symbol;Acc:HGNC:18472])

HSP 1 Score: 253.832 bits (647), Expect = 2.766e-74
Identity = 112/198 (56.57%), Postives = 141/198 (71.21%), Query Frame = 3
Query:  195 LFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            +F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + +KG+ +++KWC+TC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV    E+L      + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G   N   +LC S  P
Sbjct:    1 MFLFVLANFSMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAP 197          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC5 (zinc finger DHHC-type containing 5 [Source:HGNC Symbol;Acc:HGNC:18472])

HSP 1 Score: 254.218 bits (648), Expect = 5.463e-74
Identity = 112/199 (56.28%), Postives = 142/199 (71.36%), Query Frame = 3
Query:  192 LLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            ++F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + +KG+ +++KWC+TC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV    E+L      + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G   N   +LC S  P
Sbjct:   53 IMFLFVLANFSMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAP 250          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC8 (zinc finger DHHC-type containing 8 [Source:HGNC Symbol;Acc:HGNC:18474])

HSP 1 Score: 251.136 bits (640), Expect = 2.108e-72
Identity = 115/229 (50.22%), Postives = 153/229 (66.81%), Query Frame = 3
Query:  105 LLVFSLSHFIV-ICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            LLV S + F V  C +  +  S  +   + ++F+F+  NFS ATFMDPG + P  +E+  + D FR+PLY+++ V+G+ +++KWC+TC FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSL+ H+  V+     YV    E L      I M  + VAG+ FIPV+GLTGFH+ L+  GRTTNEQVT KF+G  NPFT G   N  ++LC    P
Sbjct:   23 LLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLANFSMATFMDPGVF-PRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLVYVLNHAEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCCGNVEHVLCSPLAP 250          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC8 (zinc finger DHHC-type containing 8 [Source:HGNC Symbol;Acc:HGNC:18474])

HSP 1 Score: 249.98 bits (637), Expect = 5.320e-72
Identity = 115/229 (50.22%), Postives = 153/229 (66.81%), Query Frame = 3
Query:  105 LLVFSLSHFIV-ICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            LLV S + F V  C +  +  S  +   + ++F+F+  NFS ATFMDPG + P  +E+  + D FR+PLY+++ V+G+ +++KWC+TC FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSL+ H+  V+     YV    E L      I M  + VAG+ FIPV+GLTGFH+ L+  GRTTNEQVT KF+G  NPFT G   N  ++LC    P
Sbjct:   23 LLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLANFSMATFMDPGVF-PRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLVYVLNHAEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCCGNVEHVLCSPLAP 250          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC5 (zinc finger DHHC-type containing 5 [Source:HGNC Symbol;Acc:HGNC:18472])

HSP 1 Score: 196.823 bits (499), Expect = 3.525e-59
Identity = 85/137 (62.04%), Postives = 100/137 (72.99%), Query Frame = 3
Query:  345 IKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKN 755
            +KWC+TC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV    E+L      + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G   N
Sbjct:    1 MKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNN 137          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-8 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9U2K0])

HSP 1 Score: 226.868 bits (577), Expect = 1.682e-66
Identity = 102/225 (45.33%), Postives = 146/225 (64.89%), Query Frame = 3
Query:  174 IFAVHILLFMFLTINFSRATFMDPGFYQPAT-EEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYK-----FREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYPGSKSIILNSSKSHK 830
            + A+ ++LF+ ++ N   A  +DP  +  A   EE  Q D  R+PLY+++ + G+ +++KWC TC+FYRPPRSSHCS+CN+CI  FDHHCPWV+NC+GKRNYRYF  FL SL++H+  V  L   YV+       R+ +++   + A+V + +  ++ +PV+GLT FH+ L+A GRTTNEQVT KF    NPFT G + N    LC SQ P  KS ++   K  K
Sbjct:   44 LIAIDVVLFLMVSSNLLMAMLLDPAVHPYAIGSEEPTQVDDLRAPLYKNVDINGITVRMKWCVTCKFYRPPRSSHCSVCNRCIETFDHHCPWVHNCVGKRNYRYFFFFLCSLSIHMMYVFFLCFAYVWSGSDTNARDHILSPPYLCAIVLLALCAVLCVPVIGLTVFHLVLVARGRTTNEQVTGKFTSGYNPFTIGCWGNCKKTLCHSQLPTFKSHVMEFRKQRK 268          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-2 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9XWD7])

HSP 1 Score: 135.191 bits (339), Expect = 3.592e-34
Identity = 83/285 (29.12%), Postives = 134/285 (47.02%), Query Frame = 3
Query:   54 NRACSTRXXXXXXXXXXLLVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRS------------PLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKL----VTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFK------------------------GSNNPFTSGMFKNWLYLLCKSQYP 788
             R   +R   A +   IL++ +L+ + V    F   YS  I  V  +L + +  NF   +F DPG        E+ + D  ++            P ++D+ V G  +K+K+C+TC+ YRPPR SHC+IC+ C++ FDHHCPWV NCIG RNY YF  F+  L++ +  +      ++    +++    V      + V IV+       ++GL  FH  L+    TTNE +   ++                         + NPF +G FK++   L KS++P
Sbjct:   90 GRLVCSRSHGAFVVTVILMIATLTVYFVFDAPFLWGYSPAIPIVAAVLSLIVITNFFATSFTDPGILPRVDNIEIIEMDRQQANGNGINDVAHLRPRFQDVVVNGEHVKMKYCTTCRLYRPPRCSHCAICDNCVLMFDHHCPWVGNCIGLRNYTYFYRFVFCLSILVIYLFASAVTHISLLAQEMPFGDVMRKTPGSAVVIVICFFTTWSIIGLACFHTYLLCADLTTNEDLKGLYRRKHRPTPPSSTPSTSAATNSSVGHSTKNPFYAGCFKSFFGRLFKSRFP 374          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-14 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q7Z127])

HSP 1 Score: 85.1149 bits (209), Expect = 1.451e-18
Identity = 49/183 (26.78%), Postives = 89/183 (48.63%), Query Frame = 3
Query:  189 ILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYV------YKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKG 719
            +L  + L     R   +DPG  + A              L+ +    G+  + K+C TC   +   + HC++C  C+  FDHHCPW+N+C+ +RN R F++F++S+++  AI     S Y       +   E L T  +   M+TI+++ +  + +  L    +  I+ G TTN+++  +  G
Sbjct:    4 VLSVLALAFTLFRIGTLDPGVVRAAKNCH---------QLFVNEAEAGIQHQQKYCFTCFIRKMDHTKHCAVCGFCVNNFDHHCPWLNSCVTRRNMREFIMFVISVSVSSAIYCMATSHYALLQIEDHGLEEFLET--DAFLMITIILSAMHALMLAVLFCVQMNQISQGVTTNDRIKARRAG 175          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-4 (Zinc finger DHHC domain-containing protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I0G4])

HSP 1 Score: 85.8853 bits (211), Expect = 1.197e-17
Identity = 37/86 (43.02%), Postives = 55/86 (63.95%), Query Frame = 3
Query:  252 YQPATEEEVKQTDSFRSPLYRD----ITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFL 497
            Y+   ++E +Q   F S + R+    + V+G    I++C  C   +P RS HCS+C +C++ FDHHCPWVNNC+   NY+YF+LFL
Sbjct:   99 YESVKDDE-RQLQLFLSDIARERDLTLLVRGFDHGIRFCDKCCCIKPDRSHHCSMCEQCVLKFDHHCPWVNNCVNFGNYKYFILFL 183          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-4 (Zinc finger DHHC domain-containing protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I0G4])

HSP 1 Score: 85.1149 bits (209), Expect = 1.694e-17
Identity = 37/86 (43.02%), Postives = 55/86 (63.95%), Query Frame = 3
Query:  252 YQPATEEEVKQTDSFRSPLYRD----ITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFL 497
            Y+   ++E +Q   F S + R+    + V+G    I++C  C   +P RS HCS+C +C++ FDHHCPWVNNC+   NY+YF+LFL
Sbjct:   97 YESVKDDE-RQLQLFLSDIARERDLTLLVRGFDHGIRFCDKCCCIKPDRSHHCSMCEQCVLKFDHHCPWVNNCVNFGNYKYFILFL 181          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Zdhhc8 (gene:FBgn0085478 transcript:FBtr0112755)

HSP 1 Score: 220.705 bits (561), Expect = 6.385e-64
Identity = 102/216 (47.22%), Postives = 144/216 (66.67%), Query Frame = 3
Query:  141 CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            C F+ K++ + + A   ++  F+  NF+ ATFMDPG    A+ +E  + +  R+PLY++  + G+ +K+KWC TC+FYRPPR SHCS+CN CI  FDHHCPWVNNCIG+RNYR+F  FL+SL++H+  +  L   YV K    +     I+A++ + +  I+ IP+ GLTGFH+ L++ GRTTNEQVT KFKG  NPF+ G + N  Y     QYP
Sbjct:   32 CQFYVKSHPW-VLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDCE-EELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGPQYP 245          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Zdhhc8 (gene:FBgn0085478 transcript:FBtr0308591)

HSP 1 Score: 220.705 bits (561), Expect = 1.067e-63
Identity = 102/216 (47.22%), Postives = 144/216 (66.67%), Query Frame = 3
Query:  141 CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            C F+ K++ + + A   ++  F+  NF+ ATFMDPG    A+ +E  + +  R+PLY++  + G+ +K+KWC TC+FYRPPR SHCS+CN CI  FDHHCPWVNNCIG+RNYR+F  FL+SL++H+  +  L   YV K    +     I+A++ + +  I+ IP+ GLTGFH+ L++ GRTTNEQVT KFKG  NPF+ G + N  Y     QYP
Sbjct:   32 CQFYVKSHPW-VLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDCE-EELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGPQYP 245          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Zdhhc8 (gene:FBgn0085478 transcript:FBtr0343028)

HSP 1 Score: 222.246 bits (565), Expect = 6.760e-62
Identity = 102/216 (47.22%), Postives = 144/216 (66.67%), Query Frame = 3
Query:  141 CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            C F+ K++ + + A   ++  F+  NF+ ATFMDPG    A+ +E  + +  R+PLY++  + G+ +K+KWC TC+FYRPPR SHCS+CN CI  FDHHCPWVNNCIG+RNYR+F  FL+SL++H+  +  L   YV K    +     I+A++ + +  I+ IP+ GLTGFH+ L++ GRTTNEQVT KFKG  NPF+ G + N  Y     QYP
Sbjct:   32 CQFYVKSHPW-VLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDCE-EELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGPQYP 245          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Zdhhc8 (gene:FBgn0085478 transcript:FBtr0112754)

HSP 1 Score: 222.631 bits (566), Expect = 8.613e-62
Identity = 102/216 (47.22%), Postives = 144/216 (66.67%), Query Frame = 3
Query:  141 CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            C F+ K++ + + A   ++  F+  NF+ ATFMDPG    A+ +E  + +  R+PLY++  + G+ +K+KWC TC+FYRPPR SHCS+CN CI  FDHHCPWVNNCIG+RNYR+F  FL+SL++H+  +  L   YV K    +     I+A++ + +  I+ IP+ GLTGFH+ L++ GRTTNEQVT KFKG  NPF+ G + N  Y     QYP
Sbjct:   32 CQFYVKSHPW-VLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDCE-EELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGPQYP 245          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Zdhhc8 (gene:FBgn0085478 transcript:FBtr0112753)

HSP 1 Score: 222.631 bits (566), Expect = 1.120e-61
Identity = 102/216 (47.22%), Postives = 144/216 (66.67%), Query Frame = 3
Query:  141 CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            C F+ K++ + + A   ++  F+  NF+ ATFMDPG    A+ +E  + +  R+PLY++  + G+ +K+KWC TC+FYRPPR SHCS+CN CI  FDHHCPWVNNCIG+RNYR+F  FL+SL++H+  +  L   YV K    +     I+A++ + +  I+ IP+ GLTGFH+ L++ GRTTNEQVT KFKG  NPF+ G + N  Y     QYP
Sbjct:   32 CQFYVKSHPW-VLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDCE-EELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGPQYP 245          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc5b (zinc finger DHHC-type containing 5b [Source:ZFIN;Acc:ZDB-GENE-101117-1])

HSP 1 Score: 258.84 bits (660), Expect = 1.849e-76
Identity = 115/216 (53.24%), Postives = 154/216 (71.30%), Query Frame = 3
Query:  141 CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            C +  + +S  I   ++++F+F   NF  ATFMDPG + P  EE+  + D FR+PLY+ + V+G+ +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT+HI  V G +  Y+    ++L    + + M  + VAG+ F+PV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT G FKN  ++LC SQ P
Sbjct:   47 CPWLSEKFSSFIPLYNVVVFLFTLANFCMATFMDPGVF-PRAEEDEDKEDDFRAPLYKTVEVRGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTVHIMDVFGFSLLYILHHTKQLDLVQSGVTMAVMCVAGLFFVPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTHGCFKNIAHVLCSSQAP 261          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc5a (zinc finger DHHC-type containing 5a [Source:ZFIN;Acc:ZDB-GENE-090312-92])

HSP 1 Score: 258.84 bits (660), Expect = 9.584e-76
Identity = 113/220 (51.36%), Postives = 153/220 (69.55%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F   C +  + +S  +   + ++FMF+  NF  ATFMDPG + P  EE+  + D FR+PLY+ + ++G+ +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    ++    ++L    + + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G  +N  ++LC SQ P
Sbjct:   49 FCFTCPWLSEQFSVAVPIYNGVMFMFVLANFCMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIRGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLFILYHTQQLDRVHSAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCLRNVSHVLCSSQAP 267          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc5a (zinc finger DHHC-type containing 5a [Source:ZFIN;Acc:ZDB-GENE-090312-92])

HSP 1 Score: 258.84 bits (660), Expect = 1.283e-75
Identity = 113/220 (51.36%), Postives = 153/220 (69.55%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F   C +  + +S  +   + ++FMF+  NF  ATFMDPG + P  EE+  + D FR+PLY+ + ++G+ +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    ++    ++L    + + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G  +N  ++LC SQ P
Sbjct:   49 FCFTCPWLSEQFSVAVPIYNGVMFMFVLANFCMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIRGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLFILYHTQQLDRVHSAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCLRNVSHVLCSSQAP 267          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc5a (zinc finger DHHC-type containing 5a [Source:ZFIN;Acc:ZDB-GENE-090312-92])

HSP 1 Score: 258.84 bits (660), Expect = 1.283e-75
Identity = 113/220 (51.36%), Postives = 153/220 (69.55%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F   C +  + +S  +   + ++FMF+  NF  ATFMDPG + P  EE+  + D FR+PLY+ + ++G+ +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    ++    ++L    + + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G  +N  ++LC SQ P
Sbjct:   49 FCFTCPWLSEQFSVAVPIYNGVMFMFVLANFCMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIRGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLFILYHTQQLDRVHSAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCLRNVSHVLCSSQAP 267          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc8b (zinc finger DHHC-type containing 8b [Source:ZFIN;Acc:ZDB-GENE-030407-3])

HSP 1 Score: 247.284 bits (630), Expect = 2.646e-71
Identity = 114/229 (49.78%), Postives = 154/229 (67.25%), Query Frame = 3
Query:  105 LLVFSLSHFIVI-CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            LLV S + F V  C +  K  S  +   + ++F+F+  NFS ATFMDPG + P  +E+  + D FR+PLY+++ +KG+ +++KWC+TC FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSL++H+  V      +V    E L      + +V + V G+ FIPV+GLTGFH+ L+A GRTTNEQVT KF+G  NPFT G   N  ++LC    P
Sbjct:   23 LLVGSTTLFFVFTCPWLTKAVSPVVPLYNGIVFLFVLANFSMATFMDPGVF-PRADEDEDKDDDFRAPLYKNVEIKGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLSVHMVGVFSFGLLFVLHHLETLSALHTTVTLVVMCVTGLFFIPVMGLTGFHMVLVARGRTTNEQVTGKFRGGVNPFTRGCGGNVKHVLCSPLAP 250          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: glis3 (GLIS family zinc finger 3 [Source:Xenbase;Acc:XB-GENE-984727])

HSP 1 Score: 249.21 bits (635), Expect = 1.959e-73
Identity = 114/220 (51.82%), Postives = 150/220 (68.18%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            FI  C +     S+ + A + ++F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + V+GV +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFL+SLTLHI  V     FY     ++L      + +  + VAG+ F PV GLTGFHI L+  GRTTNEQVT KF+G  NPF+ G  +N  ++LC S  P
Sbjct:   47 FIFTCPWLSVEVSFALPAYNAVMFLFVLANFSMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEVRGVQVRMKWCSTCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLVSLTLHIISVFICGLFYTMGHPDQLGDIPAAVTISVLCVAGLFFFPVAGLTGFHIVLVFRGRTTNEQVTGKFRGGVNPFSDGCCQNVSHVLCSSTPP 265          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: glis3 (GLIS family zinc finger 3 [Source:Xenbase;Acc:XB-GENE-984727])

HSP 1 Score: 247.284 bits (630), Expect = 9.411e-73
Identity = 114/220 (51.82%), Postives = 150/220 (68.18%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            FI  C +     S+ + A + ++F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + V+GV +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFL+SLTLHI  V     FY     ++L      + +  + VAG+ F PV GLTGFHI L+  GRTTNEQVT KF+G  NPF+ G  +N  ++LC S  P
Sbjct:   47 FIFTCPWLSVEVSFALPAYNAVMFLFVLANFSMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEVRGVQVRMKWCSTCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLVSLTLHIISVFICGLFYTMGHPDQLGDIPAAVTISVLCVAGLFFFPVAGLTGFHIVLVFRGRTTNEQVTGKFRGGVNPFSDGCCQNVSHVLCSSTPP 265          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: zdhhc8 (zinc finger DHHC-type containing 8 [Source:NCBI gene;Acc:733453])

HSP 1 Score: 243.432 bits (620), Expect = 1.359e-69
Identity = 119/246 (48.37%), Postives = 158/246 (64.23%), Query Frame = 3
Query:  105 LLVFSLSHFIV-ICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYPGSKSIILNSSKSHKVTI 839
            LLV S + F V  C +  +  S  I   + L+F+F+  NFS ATFMDPG + P  +E+  + D FR+PLY+++ +K + +++KWC+TC FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSL+ H+  V      +V    E L      I +  + VAG+ FIPV+GLTGFHI L+  GRTTNEQVT KF+G  NPFT G   N  ++LC    P S   I++  K   V +
Sbjct:   23 LLVGSTTLFFVFTCPWLTREISPAIPVYNGLMFLFVLANFSMATFMDPGIF-PRADEDEDKDDDFRAPLYKNVEIKRIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSTHMIGVFSFGLIFVLHHLEVLGEAHTSITISVMCVAGLFFIPVIGLTGFHIVLVVRGRTTNEQVTGKFRGGVNPFTRGCCGNIQHVLCS---PLSPRYIVDPKKRPSVAL 264          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: zdhhc8 (zinc finger DHHC-type containing 8 [Source:NCBI gene;Acc:733453])

HSP 1 Score: 242.662 bits (618), Expect = 2.979e-69
Identity = 115/229 (50.22%), Postives = 151/229 (65.94%), Query Frame = 3
Query:  105 LLVFSLSHFIV-ICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            LLV S + F V  C +  +  S  I   + L+F+F+  NFS ATFMDPG + P  +E+  + D FR+PLY+++ +K + +++KWC+TC FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSL+ H+  V      +V    E L      I +  + VAG+ FIPV+GLTGFHI L+  GRTTNEQVT KF+G  NPFT G   N  ++LC    P
Sbjct:   23 LLVGSTTLFFVFTCPWLTREISPAIPVYNGLMFLFVLANFSMATFMDPGIF-PRADEDEDKDDDFRAPLYKNVEIKRIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSTHMIGVFSFGLIFVLHHLEVLGEAHTSITISVMCVAGLFFIPVIGLTGFHIVLVVRGRTTNEQVTGKFRGGVNPFTRGCCGNIQHVLCSPLSP 250          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: glis3 (GLIS family zinc finger 3 [Source:Xenbase;Acc:XB-GENE-984727])

HSP 1 Score: 226.868 bits (577), Expect = 2.521e-65
Identity = 103/202 (50.99%), Postives = 136/202 (67.33%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPF 734
            FI  C +     S+ + A + ++F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + V+GV +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFL+SLTLHI  V     FY     ++L      + +  + VAG+ F PV GLTGFHI L+  GRTTNEQ+T +  G    F
Sbjct:   47 FIFTCPWLSVEVSFALPAYNAVMFLFVLANFSMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEVRGVQVRMKWCSTCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLVSLTLHIISVFICGLFYTMGHPDQLGDIPAAVTISVLCVAGLFFFPVAGLTGFHIVLVFRGRTTNEQITSEVTGGKGVF 247          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc5 (zinc finger, DHHC domain containing 5 [Source:MGI Symbol;Acc:MGI:1923573])

HSP 1 Score: 254.603 bits (649), Expect = 2.415e-74
Identity = 115/220 (52.27%), Postives = 147/220 (66.82%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F   C       S  +   + ++F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + +KG+ +++KWC+TC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV    E+L      + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G   N   +LC S  P
Sbjct:   32 FAFTCPGLSLNVSPAVPIYNAIMFLFVLANFSMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAP 250          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc8 (zinc finger, DHHC domain containing 8 [Source:MGI Symbol;Acc:MGI:1338012])

HSP 1 Score: 254.988 bits (650), Expect = 4.331e-74
Identity = 112/220 (50.91%), Postives = 149/220 (67.73%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F+  C +  +  S  I   + +LF+F+  NFS ATFMDPG + P  +E+  + D FR+PLY+++ V+G+ +++KWC+TC FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSL+ H+  V+     YV    E L      I M  + VAG+ FIPV+GLTGFH+ L+  GRTTNEQVT KF+G  NPFT G + N  ++LC    P
Sbjct:   32 FVFTCPWLTRAVSPAIPVYNGILFLFVLANFSMATFMDPGVF-PRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLLYVLNHSEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCYGNVEHVLCSPLAP 250          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc8 (zinc finger, DHHC domain containing 8 [Source:MGI Symbol;Acc:MGI:1338012])

HSP 1 Score: 254.988 bits (650), Expect = 4.331e-74
Identity = 112/220 (50.91%), Postives = 149/220 (67.73%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F+  C +  +  S  I   + +LF+F+  NFS ATFMDPG + P  +E+  + D FR+PLY+++ V+G+ +++KWC+TC FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSL+ H+  V+     YV    E L      I M  + VAG+ FIPV+GLTGFH+ L+  GRTTNEQVT KF+G  NPFT G + N  ++LC    P
Sbjct:   32 FVFTCPWLTRAVSPAIPVYNGILFLFVLANFSMATFMDPGVF-PRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLLYVLNHSEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCYGNVEHVLCSPLAP 250          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc9 (zinc finger, DHHC domain containing 9 [Source:MGI Symbol;Acc:MGI:2444393])

HSP 1 Score: 150.984 bits (380), Expect = 1.030e-39
Identity = 90/259 (34.75%), Postives = 129/259 (49.81%), Query Frame = 3
Query:  111 VFSLSHFIVI----------CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPA-------TEEEVKQTDSF------RSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYV------YKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSN---NPFTSG-MFKNWLYLLCKSQYP 788
            +F L+ F+++          C +     S  I     +LF+F      R +F DPG    A        E E++ T+          P  ++  +    +K+K+C TC+ +RPPR+SHCSIC+ C+  FDHHCPWV NC+GKRNYRYF LF+LSL+L    V   N  YV        F E L      +  + +++       VVGLTGFH  L+A  +TTNE +   + G N   NP++ G + KN   +LC    P
Sbjct:   37 IFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTV--LEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPP 293          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc9 (zinc finger, DHHC domain containing 9 [Source:MGI Symbol;Acc:MGI:2444393])

HSP 1 Score: 150.984 bits (380), Expect = 1.030e-39
Identity = 90/259 (34.75%), Postives = 129/259 (49.81%), Query Frame = 3
Query:  111 VFSLSHFIVI----------CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPA-------TEEEVKQTDSF------RSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYV------YKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSN---NPFTSG-MFKNWLYLLCKSQYP 788
            +F L+ F+++          C +     S  I     +LF+F      R +F DPG    A        E E++ T+          P  ++  +    +K+K+C TC+ +RPPR+SHCSIC+ C+  FDHHCPWV NC+GKRNYRYF LF+LSL+L    V   N  YV        F E L      +  + +++       VVGLTGFH  L+A  +TTNE +   + G N   NP++ G + KN   +LC    P
Sbjct:   37 IFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTV--LEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPP 293          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q8VDZ4|ZDHC5_MOUSE (Palmitoyltransferase ZDHHC5 OS=Mus musculus OX=10090 GN=Zdhhc5 PE=1 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.689e-73
Identity = 115/220 (52.27%), Postives = 147/220 (66.82%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F   C       S  +   + ++F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + +KG+ +++KWC+TC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV    E+L      + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G   N   +LC S  P
Sbjct:   32 FAFTCPGLSLNVSPAVPIYNAIMFLFVLANFSMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAP 250          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|E1BLT8|ZDHC5_BOVIN (Palmitoyltransferase ZDHHC5 OS=Bos taurus OX=9913 GN=ZDHHC5 PE=3 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 2.254e-73
Identity = 115/220 (52.27%), Postives = 148/220 (67.27%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F   C     + S  +   + ++F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + +KG+ +++KWC+TC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV    E+L      + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G   N   +LC S  P
Sbjct:   32 FAFTCPGLSLSVSPAVPVYNAVVFLFVLANFSMATFMDPGVF-PRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHITGVFGFGLLYVLYHMEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAP 250          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q2THW7|ZDHC5_RAT (Palmitoyltransferase ZDHHC5 OS=Rattus norvegicus OX=10116 GN=Zdhhc5 PE=1 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 2.393e-73
Identity = 115/220 (52.27%), Postives = 147/220 (66.82%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F   C       S  +   + ++F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + +KG+ +++KWC+TC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV    E+L      + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G   N   +LC S  P
Sbjct:   32 FAFTCPGLSLDVSPAVPIYNAIMFLFVLANFSMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLCHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAP 250          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q9C0B5|ZDHC5_HUMAN (Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2)

HSP 1 Score: 254.218 bits (648), Expect = 2.624e-73
Identity = 112/199 (56.28%), Postives = 142/199 (71.36%), Query Frame = 3
Query:  192 LLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            ++F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + +KG+ +++KWC+TC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV    E+L      + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G   N   +LC S  P
Sbjct:   53 IMFLFVLANFSMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAP 250          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q2THX1|ZDHC5_PANTR (Palmitoyltransferase ZDHHC5 OS=Pan troglodytes OX=9598 GN=ZDHHC5 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 2.705e-73
Identity = 112/199 (56.28%), Postives = 142/199 (71.36%), Query Frame = 3
Query:  192 LLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            ++F+F+  NFS ATFMDPG + P  EE+  + D FR+PLY+ + +KG+ +++KWC+TC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV    E+L      + M  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G   N   +LC S  P
Sbjct:   53 IMFLFVLANFSMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNVSRVLCSSPAP 250          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A0X3P8V4 (Palmitoyltransferase (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR165508 PE=3 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 8.961e-79
Identity = 127/269 (47.21%), Postives = 173/269 (64.31%), Query Frame = 3
Query:  105 LLVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYPG------------SKSIILNSSKSHKVTIVDTKNIESSEKI 875
            LL  +  +FI ICF F    S+ IF VH++  +F+   F+R TFM+PGF   ATE+EV+  ++  SPLYR+  V+G   K+KWC TC FYR PRS+HCSICNKC+  FDHHCPWVNNCIG+RNYRYF  FLL++ LH+  V  +  FYV    + L T+ NIIAMV + + G++FIPV+ LT FHI +I+ G TTNEQVT+KF+   NP+ +   ++WL L C  QYP              +  + N  K H   ++D +N+E+S  +
Sbjct:   19 LLTLNSIYFICICFQFASQTSWAIFIVHLIFAVFVICTFARTTFMNPGFLPAATEQEVEFDEAMGSPLYREFDVRGTVAKVKWCKTCLFYRIPRSTHCSICNKCVECFDHHCPWVNNCIGRRNYRYFFTFLLTVCLHMVAVFLVTLFYVLWSDQPLDTHTNIIAMVLMSLVGLVFIPVLSLTIFHITIISRGMTTNEQVTEKFRTVPNPYATTCLQHWLTLFCSPQYPTHMDPMSGKELLKKRRKLRNRYKDH--FLLDVENVETSRAL 285          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A0L8HJN1 (Palmitoyltransferase OS=Octopus bimaculoides OX=37653 GN=OCBIM_22013090mg PE=3 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.637e-78
Identity = 130/241 (53.94%), Postives = 167/241 (69.29%), Query Frame = 3
Query:   66 STRXXXXXXXXXXLLVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            STR +PA  AW++LLV +   FI I     + Y   I     +L +F+  NF+ ATFMDPG Y  A E+E +  D FR+PLY+++ +KG+ M++KWC+TCQFYRPPR SHCS+CN CI  FDHHCPWVNNCIG+RNYRYF LFL+SLT+H   +  L   YV   +++L    +I+A + +V+ GI+ IPV GLTGFH  L+A GRTTNEQVT KF+GS NPFT G  KN  Y LC  Q+P
Sbjct:    7 STRILPATCAWSLLLVATGLFFIFIVPDHLEKYHMAIPIYQGILSLFVVANFALATFMDPGVYPKAHEDEFRD-DDFRAPLYKNVEIKGITMRMKWCTTCQFYRPPRCSHCSVCNNCIETFDHHCPWVNNCIGRRNYRYFFLFLISLTIHKISIFSLCLLYVLDHKKELAQAGSIVAFIVMVIIGILIIPVAGLTGFHTVLVARGRTTNEQVTGKFRGSQNPFTRGCCKNCKYALCGPQWP 246          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: V9L2P5 (Palmitoyltransferase (Fragment) OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 2.398e-78
Identity = 119/229 (51.97%), Postives = 160/229 (69.87%), Query Frame = 3
Query:  105 LLVFSLSHFIVI-CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
             LV + + F+   C +  +T+S  +   ++ +F+F+  NFS ATFMDPG +  A+E+E K  D FR+PLY+++ +KG+ +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    Y+    + L +    + +  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT G +KN   +LC SQ P
Sbjct:   22 FLVTATTLFLAFTCPWLSQTFSLAVPVYNVSIFLFVLANFSLATFMDPGIFPRASEDEDKD-DDFRAPLYKNVEIKGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIVGVFGSGLVYILYHLQTLSSVHPAVTLAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTQGCWKNIASVLCSSQAP 249          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A093DIT4 (Palmitoyltransferase (Fragment) OS=Chaetura pelagica OX=8897 GN=M959_08183 PE=3 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 6.654e-77
Identity = 115/199 (57.79%), Postives = 145/199 (72.86%), Query Frame = 3
Query:  192 LLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            ++F+F+  NFS ATFMDPG +  A E+E K+ D FR+PLY+ + +KG+ +++KWC+TC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV    E+L      + MV + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G  KN   +LC S  P
Sbjct:   53 VVFLFVLANFSMATFMDPGIFPRAEEDEAKE-DDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTTHIMGVFGFGLLYVLYQVEELSGVRMAVTMVVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCKNVSRVLCSSPAP 250          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A401RI46 (Palmitoyltransferase OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0020663 PE=3 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 8.144e-77
Identity = 125/229 (54.59%), Postives = 158/229 (69.00%), Query Frame = 3
Query:  105 LLVFSLSHFIVI-CFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
             LV S S F V  C +  + YS  I   ++++F+F+  NFS ATFMDPG + P  +E+  + D FR+PLY+++ +KG+ +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    YV     KL      + M  + VAG+ FIPV GLTGFHI L+A GRTTNEQVT KF+G  NPFT G + N  Y+LC SQ P
Sbjct:   23 FLVGSTSLFFVFPCPWLSQVYSPAIPIYNVIIFLFVLANFSMATFMDPGIF-PRADEDEDKDDDFRAPLYKNVEIKGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTTHIIGVFGFGLLYVLNHVNKLSDVHTAVTMAVMCVAGLFFIPVAGLTGFHIVLVARGRTTNEQVTGKFRGGVNPFTQGCWMNISYVLCSSQAP 250          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc5a (palmitoyltransferase ZDHHC5-like [Source:NCBI gene;Acc:103036553])

HSP 1 Score: 257.299 bits (656), Expect = 4.939e-75
Identity = 114/220 (51.82%), Postives = 153/220 (69.55%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F   C +  + +S  +   + ++F+F+  NF  ATFMDPG + P  EE+  + D FR+PLY+ + ++G+ +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    ++   R+ L    + + M  + VAG+ FIPV GLTGFHI L+A GRTTNEQVT KF+G  NPFT+G ++N   +LC SQ P
Sbjct:   49 FCFTCPWLSEEFSVAVPIYNGIMFLFVLANFCMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIRGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLFILYHRQHLDRVHSAVTMAVMCVAGLFFIPVAGLTGFHIVLVARGRTTNEQVTGKFRGGVNPFTNGCWRNVSRVLCSSQAP 267          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc5b (zinc finger DHHC-type containing 5b [Source:ZFIN;Acc:ZDB-GENE-101117-1])

HSP 1 Score: 249.98 bits (637), Expect = 3.367e-73
Identity = 116/227 (51.10%), Postives = 155/227 (68.28%), Query Frame = 3
Query:  108 LVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            LV + + F   C +  + +S  I   + ++F+F   NF  ATFMDPG +    EE+  + D FR+PLY+ + V+G+ +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G +  Y+    ++L    + + M  + +AG+ F+PV GLTGFHI L+A GRTTNEQVT KF+G  NPFT G  KN  ++LC SQ P
Sbjct:   35 LVGATTLFFCFCPWLAERFSSSIPLYNGVVFLFTLANFCMATFMDPGVF--PREEDEDKEDDFRAPLYKTVEVRGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLTTHIMGVFGFSLLYILHHTKQLDEVHSGV-MAVMCIAGLFFVPVAGLTGFHIVLVARGRTTNEQVTGKFRGGVNPFTHGCCKNVSHVLCSSQAP 258          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: ZDHHC8 (probable palmitoyltransferase ZDHHC8 [Source:NCBI gene;Acc:103030349])

HSP 1 Score: 224.942 bits (572), Expect = 1.207e-63
Identity = 114/281 (40.57%), Postives = 157/281 (55.87%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYPGSKSIILNSSKSHKVTIVDTKNIESSEKIPLTEAKYFASPEKINSKPNLDGDVNLRMGFPP 971
            F   C +  +  S        + F+F+  NF+ ATFMD G    A E+E K  D FR+PLY+++ V+G+ +++KWC++C FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYR+F LFLL+LT+H+  V      YV +  E L      + +  + V G+ FIPVVGL  FH+ L+A GRTTNEQVT KF+G  NPFT G   N  ++LC                     I      +  ++ P+     F  PE +   P   GD  ++   PP
Sbjct:   32 FAFTCPWLAEHVSLAFPPCVAVTFLFVMANFTMATFMDAGVLPRANEDEDKD-DDFRAPLYKNVEVRGIQVRMKWCASCHFYRPPRCSHCSVCDHCVEDFDHHCPWVNNCIGRRNYRFFFLFLLTLTVHMVAVFSGGLLYVLEHLEDLWALRAAVTLAVMSVTGLFFIPVVGLACFHLVLVARGRTTNEQVTGKFQGGVNPFTRGCCSNVEFVLCS-------------------PITPRYTGKPGKRPPVRVQPPFQKPESLKRSPGKVGDNGIQNKSPP 292          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc14 (probable palmitoyltransferase ZDHHC14 [Source:NCBI gene;Acc:103029743])

HSP 1 Score: 154.451 bits (389), Expect = 4.750e-40
Identity = 90/252 (35.71%), Postives = 135/252 (53.57%), Query Frame = 3
Query:  105 LLVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEV----KQTDS--------FRSP-LYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTY-----DNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQV-----TDKFKGSNNPFTSG-MFKNWLYLLCKSQYP 788
            +LV S   F   C F     +  I A+  +LF+F+     RA+F DPG    AT EE     +Q D+        +R P   R++ + G  +K+K+C TC+ +RPPR+SHCS+C+ C+  FDHHCPWV NC+GKRNYR+F LF+LSL+     +      +V   R     +     D+  +++ +VV       +VGL+GFH  LI++ +TTNE +     T + K + NP++ G +  N    LC    P
Sbjct:   69 ILVTSGLFFAFDCPFLASNLTPAIPAIGGVLFLFVIGMLLRASFSDPGVLPRATPEEAADVERQIDAANGAGGPGYRPPPRTREVVINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFFYLFILSLSFLTIFIFAFVITHVI-LRSNRTGFLSALKDSPASVLEVVVCFFSVWSIVGLSGFHTYLISSNQTTNEDIKGSWSTKRGKDNYNPYSYGNILTNCCAALCGPLPP 319          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: ZDHHC14 (zinc finger DHHC-type containing 14 [Source:HGNC Symbol;Acc:HGNC:20341])

HSP 1 Score: 152.525 bits (384), Expect = 3.235e-39
Identity = 87/251 (34.66%), Postives = 135/251 (53.78%), Query Frame = 3
Query:  105 LLVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEV----KQTD--------SFRSPLY-RDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIG--LNSFYVYKFREKLVTY--DNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQV-----TDKFKGSNNPFTSG-MFKNWLYLLCKSQYP 788
            ++V S   F   C F   T +  I  +  +LF F+     R +F DPG    AT +E     +Q D         +R P   R++T+ G  +K+K+C TC+ +RPPR+SHCS+C+ C+  FDHHCPWV NC+GKRNYR+F +F+LSL+     +    +    +   ++  +T   D+  +++ +VV       +VGL+GFH  LI + +TTNE +     T + K + NP++ G +F N    LC    P
Sbjct:   96 IVVTSGLFFTFDCPFLANTLTPAIPVIGGVLFSFVLGTLLRTSFSDPGVLPRATPDEAADLERQIDIANGSSSTGYRPPPRTREVTINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTIFIFAFVITHIIMQSHKKGFLTALKDSPASVLEVVVCFFSVWSIVGLSGFHTYLIGSNQTTNEDIKGSWSTKRGKENYNPYSYGNIFTNCCAALCGPLPP 346          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004672.1 (pep scaffold:Pmarinus_7.0:GL477315:17052:39954:-1 gene:ENSPMAG00000004227.1 transcript:ENSPMAT00000004672.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 6.224e-21
Identity = 64/201 (31.84%), Postives = 96/201 (47.76%), Query Frame = 3
Query:  216 NFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVI-GLNSFYVYKFR-----EKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIAT-------GRTTNEQVTDK----FKGS----NNPFTSGMFKN 755
            NF ++   DPG  +   E++ K           D+++        +CSTC   +P RS HCS+CN+CI  FDHHCPWV NC+G  N+RYFV +L  L   I  +I G   F+  +       +   TY + +AM +  +  +    +  LT   I L+         G TTNE++  +    FK +     +PF  G F+N
Sbjct:  404 NFGKSWKSDPGVVKATEEQKKKTIVELAEAGSLDLSI--------FCSTCLIRKPVRSKHCSVCNRCIAKFDHHCPWVGNCVGAGNHRYFVGYLFFLLGTICWLIYGCIIFWSRRCHTTYHTDGFWTYVSQVAMCSPWIFWMFINSLFHLTWVTILLMCQLYQISCLGITTNERMNARRYKHFKVTATTIESPFNHGCFRN 596          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: zdhhc6 (zinc finger DHHC-type containing 6 [Source:ZFIN;Acc:ZDB-GENE-030131-3189])

HSP 1 Score: 90.1225 bits (222), Expect = 1.852e-19
Identity = 51/176 (28.98%), Postives = 85/176 (48.30%), Query Frame = 3
Query:  171 GIFAVHIL-LFMFLTI-NFSRATFMDPGF----YQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATG 680
            G+  + +L L+ FL + N+  A F+ PG+    ++P   E+V+                     +++C+ CQ Y+PPRS HC  CN+C++  DHHCPW+NNC G  N+ YF  FLL   L       + S  +Y      +++      + +    +  +P  G++ F  +L A G
Sbjct:   54 GLLNLAVLSLWAFLILYNYFSAMFVGPGYVPYGWKPEKPEDVQY--------------------LQYCNICQGYKPPRSHHCRKCNRCVMKMDHHCPWINNCCGHYNHAYFTWFLLLAPLGCLHASAIISLTIYSQLYHRISFGMTKLQIDVSAPPVGPVP-FGVSAFAASLFALG 208          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: zdhhc16a (zinc finger DHHC-type containing 16a [Source:NCBI gene;Acc:394017])

HSP 1 Score: 85.1149 bits (209), Expect = 4.169e-18
Identity = 52/168 (30.95%), Postives = 79/168 (47.02%), Query Frame = 3
Query:  354 CSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIA---IVIGLNSFYVYKFRE--------KLVTYDNIIA-------------MVTIVVAGIIFIPVVGLTGFHIALIATGRTTNE---------QVTDKFKGSNNPFTSGMFKNW 758
            C  C   +PPR+ HCSICN+CI+  DHHCPW+NNC+G  N+RYF  F L +++  A   I +    F  +   +        KL++  +  A             +   V+   + + +  LT +H ALI+ G T+ E         ++  K K   NP+  G   NW
Sbjct:  125 CKRCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGNYNHRYFFSFCLYMSMGCAFTSITLSRTYFRTHAPSQVAPSHSPLKLLSPASTTAEPEKREDHVHNSIVFVWVLTSTVSVVLGALTLWHAALISRGETSVERHINRKERARLHKKGKVFKNPYHFGSLSNW 292          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: zdhhc3a (zinc finger DHHC-type containing 3a [Source:ZFIN;Acc:ZDB-GENE-040718-484])

HSP 1 Score: 74.3294 bits (181), Expect = 1.468e-15
Identity = 30/58 (51.72%), Postives = 41/58 (70.69%), Query Frame = 3
Query:  354 CSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIV 527
            C  C   +P R+ HCS+C +CI   DHHCPWVNNC+G+ N +YFVLF    T++IA++
Sbjct:   27 CPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGESNQKYFVLF----TMYIALI 80          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: zdhhc4 (zinc finger DHHC-type containing 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9031])

HSP 1 Score: 73.1738 bits (178), Expect = 3.930e-15
Identity = 47/142 (33.10%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  354 CSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLT-------------LHIAIVI----------GLN----SFYVYKFREKL-VTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNE 695
            C TC F +P RS HC +C++C+  FDHHC WVN C+G  N   F+ +LLSLT             LH A V+          GL+    S  +    + L +++  ++  +  ++  II + + G T FH+ L+   RT NE
Sbjct:   47 CRTCLFEKPARSKHCRVCDRCVHRFDHHCVWVNGCVGAGNLPLFLGYLLSLTAAASCMAAVMVVALHRAAVLSGLVQEGSLRGLHGEMPSLPITDIVQLLFLSFPRLVFTLGFLI--IISVLLGGFTAFHLYLLLVNRTANE 186          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: ERF2 (Subunit of a palmitoyltransferase; this complex adds a palmitoyl lipid moiety to heterolipidated substrates such as Ras1p and Ras2p through a thioester linkage; mutants partially mislocalize Ras2p to the vacuole; palmitoyltransferase is composed of Erf2p and Shr5p [Source:SGD;Acc:S000004236])

HSP 1 Score: 110.538 bits (275), Expect = 8.899e-27
Identity = 69/192 (35.94%), Postives = 100/192 (52.08%), Query Frame = 3
Query:  165 SYGIFAVHILLFMFLTI-NFSRATFMDPGF-------------YQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGI-IFIPVVGLTGFHIALIATGRTTNE 695
             Y +  +    F  +T+ +F R    DPG              YQ   E     T    S + +DIT       IK+C +C+ +RPPRSSHCS CN C++  DHHC WVNNCIGKRNYR+F++FLL   L  + VI L +  ++  RE     D  +A++ +  AG+ ++ P +  T +HI +    +TT E
Sbjct:  105 GYKVLVIFFYYFWVITLASFIRTATSDPGVLPRNIHLSQLRNNYQIPQEYYNLITLPTHSSISKDIT-------IKYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAIL--SSVILLTNCAIHIARESGGPRDCPVAILLLCYAGLTLWYPAILFT-YHIFMAGNQQTTRE 286          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: SWF1 (Palmitoyltransferase that acts on transmembrane proteins; including the SNAREs Snc1p, Syn8p, Tlg1p and likely all SNAREs; contains an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; may have a role in vacuole fusion [Source:SGD;Acc:S000002533])

HSP 1 Score: 87.8113 bits (216), Expect = 2.543e-19
Identity = 46/115 (40.00%), Postives = 63/115 (54.78%), Query Frame = 3
Query:  354 CSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQ 698
            CSTC+  +P RS HCSICN+C++  DHHC W+NNCIGK NY  F LFL+S    +     L  +Y+        T    +  +TI+      I  +  T   +A++  G TTNEQ
Sbjct:  136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAF-LRLWYIS--LNSTSTLPRAVLTLTILCGCFTIICAI-FTYLQLAIVKEGMTTNEQ 246          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: PFA3 (Palmitoyltransferase for Vac8p; required for vacuolar membrane fusion; contains an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; autoacylates; required for vacuolar integrity under stress conditions [Source:SGD;Acc:S000005270])

HSP 1 Score: 77.7962 bits (190), Expect = 5.535e-16
Identity = 39/124 (31.45%), Postives = 66/124 (53.23%), Query Frame = 3
Query:  342 KIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYV------YKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNE 695
            + + C  C  ++P R  HCS C+ CI+  DHHCPW   C G RN ++F+ FL+  TL+  +V+    + +        F  +L+ + +++ +  + VA  +FI V+  T F I  +   +TT E
Sbjct:  102 RFRVCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLYAFLVLIYTCYELGTWFNSGSFNRELIDF-HLLGVALLAVA--VFISVLAFTCFSIYQVCKNQTTIE 222          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: PFA4 (Palmitoyltransferase with autoacylation activity; required for palmitoylation of amino acid permeases containing a C-terminal Phe-Trp-Cys site; required for modification of Chs3p; member of the DHHC family of putative palmitoyltransferases [Source:SGD;Acc:S000005363])

HSP 1 Score: 74.7146 bits (182), Expect = 8.928e-15
Identity = 27/67 (40.30%), Postives = 42/67 (62.69%), Query Frame = 3
Query:  354 CSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVY 554
            C  CQ Y+P RS HC  CN+C++  DHHCPW  NC+G  NY +F+ FL  + +  +++  + +  +Y
Sbjct:   80 CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRIY 146          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: PFA5 (Palmitoyltransferase with autoacylation activity; likely functions in pathway(s) outside Ras; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain [Source:SGD;Acc:S000002867])

HSP 1 Score: 58.151 bits (139), Expect = 1.564e-9
Identity = 39/126 (30.95%), Postives = 62/126 (49.21%), Query Frame = 3
Query:  351 WCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLF-------LLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTD 707
            WCS CQ  +  R+ H S    CI  FDH+C W+   IG+ NYR FV F       LL + + I + I + + + + +   L    NII+  T+V A + ++    L    I  ++  +T+ E + D
Sbjct:  130 WCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAYFSTLLLIMWVSICVYIRIITQHNHNYSPNLNA--NIIS--TLVFAILGWLLTASLLASSIFYMSQNKTSLEAIID 251          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO39692 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7S9E6])

HSP 1 Score: 217.624 bits (553), Expect = 5.778e-66
Identity = 112/247 (45.34%), Postives = 155/247 (62.75%), Query Frame = 3
Query:   54 NRACSTRXXXXXXXXXXLLVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQ--PATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            +R  +++ IP I A  +LL  S   FI +C +  + YS  I     LL  F+  NF+ ATF DPG     P T E+    D F+ PLY+++ + G+ +++KWC TC+FYRPPR SHCSICN CI  FDHHCPWV+NCIG+RNYRYF LF+ SL++ I  V  L   +V   +  + + + II+++ + V  +  +PV GL+ FHI L++ GRTTNEQVT KF+  +NPF  G   N   +LC  QYP
Sbjct:    7 SRGLTSKQIPIICATVLLLGTSTLFFIFVCPYLTRQYSILIPVYEGLLTFFVLANFAHATFRDPGIVPRVPYTPEQ----DDFKVPLYKNVDINGITVRMKWCDTCKFYRPPRCSHCSICNNCIEMFDHHCPWVDNCIGRRNYRYFFLFVSSLSVDIVSVFALALVHVLDNKGNMGSPEVIISIIVMCVCALTSVPVFGLSVFHIGLVSMGRTTNEQVTGKFRSGHNPFDLGCRSNCNAVLCTGQYP 249          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO38596 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7SCF8])

HSP 1 Score: 143.665 bits (361), Expect = 2.852e-38
Identity = 80/227 (35.24%), Postives = 119/227 (52.42%), Query Frame = 3
Query:  195 LFMFLTINFSRATFMDPGFYQPATEEEVKQTD------------SFRSP-LYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGL----------NSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKF---KGSN--NPFTSG-MFKNWLYLLCKSQYP 788
            LF F+     R  F DPG    A+ +E    +            ++R P   +++TV G  +K+K+C TC+ +RPPR+SHCS+C+ C+  FDHHCPWV NC+GKRNY++F +FLLSL++H   +             N  +V   +E    Y   +    +    I  I  VGLTGFH  L+A+ +TTNE +   F   +G +  NP++ G    N L ++C    P
Sbjct:   67 LFFFVMATLLRTAFSDPGIVPRASADEAAYIEKSMAEPPSGDPQTYRPPPRTKEVTVNGQTIKLKFCFTCKIFRPPRASHCSMCDNCVERFDHHCPWVGNCVGKRNYKFFYMFLLSLSIHCCYIFAFVIIHLVMCKENRSFVDAMKESPARYPFTVYHTVVCFFSIWSI--VGLTGFHTYLVASNQTTNEDIKGSFSSRRGQDNYNPYSVGSSCGNCLAVICGPMEP 291          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO40825 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7S6A3])

HSP 1 Score: 97.0561 bits (240), Expect = 2.908e-22
Identity = 58/184 (31.52%), Postives = 94/184 (51.09%), Query Frame = 3
Query:  180 AVHILLFMFLTINFSRATFMDPG-----FYQPATEEE-VKQTDSFRSPLYR-----DITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIF-IPVVGLTGFHIALIATGRTTNE 695
            A H   FM L I++ R    D G     F    T+++ V+  ++ R  L R         + ++  +++C  C   +P R  HCS+C KCI+  DHHCPWVNNC+G  NY++F+LFL    L+   V G  + Y   F    +  +  + ++ +    ++F I +  L G+HI L++  +TT E
Sbjct:   55 AFHPFFFM-LIISYWRTILADQGIVPSQFALSKTDKDLVENGENVREVLTRVSKNLPTATRTLSGGVRYCDICCHIKPDRCHHCSMCRKCILKMDHHCPWVNNCVGYSNYKFFLLFLFYAILYTFYVTGTVTKYFIAFWSNSLEGEGKLHILFLFFVALMFCISLWSLFGYHIYLVSQNKTTLE 237          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO38376 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7SD39])

HSP 1 Score: 89.3521 bits (220), Expect = 7.184e-20
Identity = 60/207 (28.99%), Postives = 104/207 (50.24%), Query Frame = 3
Query:  183 VHILLF----MFLTINFSRATFMDPGFYQ-PATEEEVKQTDSFRSPLYRDITVKGVAMKIKW--CSTCQFYRPPRSSHCS-----ICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLL---SLTLHIAIVIGLNSFYVYKFREKLVTYDN----IIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGM 746
            +H+++F    + L I+ SRA++ DPG    P T  +  + +   S   +  T        +W  C+ C+ YRPPR+ HC      IC +CI   DHHCPW+NNC+G+ N +YFVLFL     L+++ AI+  ++  + +K       YD     I  ++ +V + +  + V+ +     + I +  T  E V  + + +  P ++ M
Sbjct:   45 LHVIIFNVLALLLLISHSRASYSDPGVVPLPTTSLDFSEINKAHSEKPQSNT--------EWTACTRCEAYRPPRAHHCRLLFMLICGRCIKKMDHHCPWINNCVGENNQKYFVLFLFYTGVLSVYAAILTAVS--WTHKCLGCSKEYDQRTRYIYTIILMVESCLFGLFVLAMMCDQFSSILSDLTAVENVQRQIRANRKPRSALM 241          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO46304 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RQK1])

HSP 1 Score: 90.8929 bits (224), Expect = 9.586e-20
Identity = 71/263 (27.00%), Postives = 118/263 (44.87%), Query Frame = 3
Query:  183 VHILLFMFLTINFS----RATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLT---LHIAIV---IGLNSFYVYK--------------------FREKLVT------YDNII------AMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNE-------QVTDKFKG--SNNPFTSGMFKNWLYLLCKSQYPGSKSIILNSS 818
            +H+L+  +L +N S    ++ F  PG Y P  ++   + +++                   C  C   +PPR+ HCSIC +CI+  DHHCPW+NNC+G  N+RYF+LF + +T   L++A+    + L  F+  K                     REK+        Y N++      ++   ++   + + +  LT +H  LIA G+T+ E       Q   + KG    NP+  G + NW  +L         S++L SS
Sbjct:   87 LHLLVAHWLLLNISFHYLKSVFTSPG-YPPEGDKLPGKPENYLI-----------------CRKCSQAKPPRTHHCSICKRCILKMDHHCPWINNCVGHFNHRYFILFCIYMTLGSLYVAVSSWDLFLEHFFSPKGKDLSNSKSNVNYHQSKAEIMREKIANVVVMGGYKNLLEFEHNSSVFVFMLCSAVTLALGLLTLWHAKLIADGQTSIELYINRANQRAFRKKGLVYKNPYNYGAWDNWRLMLGLVNNRSWMSVLLPSS 331          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: zdhhc8b (zinc finger DHHC-type containing 8 [Source:NCBI gene;Acc:101163584])

HSP 1 Score: 263.462 bits (672), Expect = 2.642e-77
Identity = 121/229 (52.84%), Postives = 155/229 (67.69%), Query Frame = 3
Query:  105 LLVFSLSHFIV-ICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            LLV S + F V  C +  K  S  +   + L+F+F+  NFS ATFMDPG Y  A E+E K  D FR+PLY+++ +KG+ +++KWC+TC FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSL+ H+  V      +V   RE L      + +V + VAG+ FIPV+GLTGFH+ L+A GRTTNEQVT KF+G  NPFT G   N  Y+LC    P
Sbjct:   23 LLVGSTTLFFVFTCPWLAKVISPAVPFYNGLVFLFVLANFSMATFMDPGVYPRANEDEDKD-DDFRAPLYKNVEIKGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVFSFGLIFVLHHREMLGALHTAVTLVVMCVAGLFFIPVMGLTGFHMVLVARGRTTNEQVTGKFRGGVNPFTKGCCGNVEYVLCSPLAP 250          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: ENSORLT00000037905.1 (palmitoyltransferase ZDHHC5 [Source:NCBI gene;Acc:101159242])

HSP 1 Score: 254.603 bits (649), Expect = 1.603e-74
Identity = 112/220 (50.91%), Postives = 153/220 (69.55%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F   C +  + +S  +   + ++F+F+  NF  ATFMDPG + P  EE+  + D FR+PLY+ + ++G+ +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    ++   R+ +     I+ +  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G +KN  ++LC S  P
Sbjct:   52 FCFTCPWLTERFSVAVPVYNGVIFLFVLANFCMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIRGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMAVFGFGLLFILYHRQSVDRLHAIVTLAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCWKNVSHVLCSSLAP 270          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: ENSORLT00000043523.1 (palmitoyltransferase ZDHHC5 [Source:NCBI gene;Acc:101159242])

HSP 1 Score: 254.988 bits (650), Expect = 6.078e-74
Identity = 116/233 (49.79%), Postives = 158/233 (67.81%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKS---QYPGSKSIILNSS 818
            F   C +  + +S  +   + ++F+F+  NF  ATFMDPG + P  EE+  + D FR+PLY+ + ++G+ +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V G    ++   R+ +     I+ +  + VAG+ FIPV GLTGFH+ L+A GRTTNEQVT KF+G  NPFT+G +KN  ++LC S   +Y G K    N S
Sbjct:   52 FCFTCPWLTERFSVAVPVYNGVIFLFVLANFCMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIRGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMAVFGFGLLFILYHRQSVDRLHAIVTLAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCWKNVSHVLCSSLAPRYLGRKRCTQNVS 283          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: zdhhc5b (zinc finger DHHC-type containing 5 [Source:NCBI gene;Acc:101165648])

HSP 1 Score: 250.366 bits (638), Expect = 8.912e-73
Identity = 113/220 (51.36%), Postives = 148/220 (67.27%), Query Frame = 3
Query:  129 FIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            F   C +   + S  +     ++F+F   NF  ATFMDPG + P  EE+  + D FR+PLY+ + +K + +++KWCSTC+FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT HI  V      YV   R++L T    + M  + VAG+ F+PV GLTGFHI L+A GRTTNEQVT KF+G  NPF  G  +N  ++LC++Q P
Sbjct:   47 FCFTCPWLSDSVSPVVPIYIAVIFIFTLANFCMATFMDPGIF-PRAEEDEDKEDDFRAPLYKTVEIKAIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLTTHIIDVFSFGLVYVLNHRQQLDTPQAAVTMGVMCVAGLFFVPVAGLTGFHIVLVARGRTTNEQVTGKFRGGVNPFNKGCSRNISHILCRAQAP 265          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: ENSORLT00000009587.2 (probable palmitoyltransferase ZDHHC8 [Source:NCBI gene;Acc:101157234])

HSP 1 Score: 227.254 bits (578), Expect = 1.742e-64
Identity = 113/229 (49.34%), Postives = 149/229 (65.07%), Query Frame = 3
Query:  105 LLVFSLSHFIV-ICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYP 788
            LLV + S F V  C +   T    +     +LF+F+  NF+ ATFMD G    A+E+E K  D FR+PLY+++ +KGV +++KWC++C FYRPPR SHCS+C+ C+  FDHHCPWVNNCIG+RNYRYF LFLLSLT H+  V      YV      L      + +V I ++G+  +PV+GLTGFH+ L++ GRTTNEQVT KF+G  NPFT G   N  YL+C    P
Sbjct:   23 LLVGATSLFFVFTCPWLAATICPAVPPCCAILFLFVLANFTMATFMDAGVLPVASEDEDKD-DGFRAPLYKNVDIKGVQVRMKWCASCHFYRPPRCSHCSVCDHCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLTFHMVAVFTFGLIYVLHHMNDLWKLHFTVTVVVISISGLFLLPVLGLTGFHLYLVSRGRTTNEQVTGKFQGGVNPFTQGCCNNMEYLVCSPISP 250          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000033660.1 (SMESG000033660.1)

HSP 1 Score: 1048.5 bits (2710), Expect = 0.000e+0
Identity = 518/518 (100.00%), Postives = 518/518 (100.00%), Query Frame = 3
Query:   45 MRRNRACSTRXXXXXXXXXXLLVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYPGSKSIILNSSKSHKVTIVDTKNIESSEKIPLTEAKYFASPEKINSKPNLDGDVNLRMGFPPYNPNGKVTHNSSFLKKDINHSISSTKSSLVYNDDVELLQIDNHWANGNKKNDSKCNLFEEGACSIVVDVDDYEFADSNQKANLLNQKSIELNNHKSVPLLTTSNFHHQQNFYKPSNNMSNEYYGNKTSKYKLDLAPRASMETLDRFVSSPTSKSSFNHSVNSPIHSKGQDFINSNSPIQTSSAQIILEREPPYISNYPMTDQVMFHNNN 1598
            MRRNRACSTRPIPAIIAWAILLVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYPGSKSIILNSSKSHKVTIVDTKNIESSEKIPLTEAKYFASPEKINSKPNLDGDVNLRMGFPPYNPNGKVTHNSSFLKKDINHSISSTKSSLVYNDDVELLQIDNHWANGNKKNDSKCNLFEEGACSIVVDVDDYEFADSNQKANLLNQKSIELNNHKSVPLLTTSNFHHQQNFYKPSNNMSNEYYGNKTSKYKLDLAPRASMETLDRFVSSPTSKSSFNHSVNSPIHSKGQDFINSNSPIQTSSAQIILEREPPYISNYPMTDQVMFHNNN
Sbjct:    1 MRRNRACSTRPIPAIIAWAILLVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYPGSKSIILNSSKSHKVTIVDTKNIESSEKIPLTEAKYFASPEKINSKPNLDGDVNLRMGFPPYNPNGKVTHNSSFLKKDINHSISSTKSSLVYNDDVELLQIDNHWANGNKKNDSKCNLFEEGACSIVVDVDDYEFADSNQKANLLNQKSIELNNHKSVPLLTTSNFHHQQNFYKPSNNMSNEYYGNKTSKYKLDLAPRASMETLDRFVSSPTSKSSFNHSVNSPIHSKGQDFINSNSPIQTSSAQIILEREPPYISNYPMTDQVMFHNNN 518          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000018376.1 (SMESG000018376.1)

HSP 1 Score: 242.662 bits (618), Expect = 2.101e-71
Identity = 118/257 (45.91%), Postives = 158/257 (61.48%), Query Frame = 3
Query:  105 LLVFSLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQP--ATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYPGSKSIILNSSKSHKVTIVDTKNIESSE 869
             +  S ++F  I F++ +  S  I   HILLF+F+T  F R+TFMDPGFY P   +EEE +  D       RD+ VKG  +K+KWC+TC FYRP RSSHCS CN+C+  FDHHCPWVNNC+G+RNYR+F +FL+SL +H+A+VIG    +    R  +  Y  II++    V G++  PV GL GFH+ L++ G TTNE V DK+    NPF  G+  N+ Y+ C   YP       N S   K T V  K +ESS+
Sbjct:   18 FISLSSTYFTTISFYYAQKTSPFILVCHILLFIFVTSCFMRSTFMDPGFYTPNQMSEEEKRIHDQKGQQSSRDVNVKGALLKMKWCTTCYFYRPLRSSHCSSCNRCVDTFDHHCPWVNNCLGRRNYRFFFMFLISLFIHMALVIGGCITFAISHRSDIYNYLTIISIALACVVGLLLFPVFGLAGFHVFLLSKGVTTNEYVCDKYNDMKNPFNRGVCMNFCYIFCGPTYP-------NLSSFRKKTNVCYKYVESSD 267          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000028446.1 (SMESG000028446.1)

HSP 1 Score: 202.601 bits (514), Expect = 6.785e-59
Identity = 110/294 (37.41%), Postives = 163/294 (55.44%), Query Frame = 3
Query:  105 LLVFSLSHFIVICFFFGKTYSYGIF--AVHILLFMFLTINFSRATFMDPGFYQPATEEEVK---QTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHI---AIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVGLTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLL-CKSQYPGSKSIILNSSKSHKVTIVDTKNIESSEKIPLTEAKYFASPEKINSKPNLDGDVNLRM 959
            L+  ++ +  VI  +F K   +GI   A H+++  F  INF R+TFMDPG+Y     ++     Q+D  +      + ++G ++++KWC TC+FYRPPR SHCS+CN C+ +FDHHCPWVNNCIG+RNYRYF LFLLSL++H+   A  IG    +V   R  L    +I+ M          +P+ GLTG HI L+  G TTNE VT K+    NPF  G   N+ YL     Q      ++  +  S   +   +KN+ ++ K    EA+Y A     N K + +  + +++
Sbjct:   21 LIALNILYLSVIPSYFIKLTVFGILILAFHLIVLYFTVINFGRSTFMDPGYYPAGIPDDQYFGIQSDG-KPASAIVVEIEGTSVRMKWCVTCEFYRPPRCSHCSVCNHCVDSFDHHCPWVNNCIGRRNYRYFFLFLLSLSVHLLYDAFTIGT---FVVLNRNNLTEIPSIMMMALGATVVCFIVPIFGLTGLHIFLVWHGTTTNEHVTSKYDDERNPFDRGCLGNFDYLANGPHQISFLNKVLREAPSSGYTSAFYSKNVNAASKSESEEAEYLAPKLTENKKGDSEAVMQIKL 310          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000018376.1 (SMESG000018376.1)

HSP 1 Score: 173.326 bits (438), Expect = 3.922e-50
Identity = 82/162 (50.62%), Postives = 109/162 (67.28%), Query Frame = 3
Query:  117 SLSHFIVICFFFGKTYSYGIFAVHILLFMFLTINFSRATFMDPGFYQP--ATEEEVKQTDSFRSPLYRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIA 596
            S ++F  I F++ +  S  I   HILLF+F+T  F R+TFMDPGFY P   +EEE +  D       RD+ VKG  +K+KWC+TC FYRP RSSHCS CN+C+  FDHHCPWVNNC+G+RNYR+F +FL+SL +H+A+VIG    +    R  +  Y  II+
Sbjct:   22 SSTYFTTISFYYAQKTSPFILVCHILLFIFVTSCFMRSTFMDPGFYTPNQMSEEEKRIHDQKGQQSSRDVNVKGALLKMKWCTTCYFYRPLRSSHCSSCNRCVDTFDHHCPWVNNCLGRRNYRFFFMFLISLFIHMALVIGGCITFAISHRSDIYNYLTIIS 183          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000005997.1 (SMESG000005997.1)

HSP 1 Score: 140.969 bits (354), Expect = 4.115e-36
Identity = 86/253 (33.99%), Postives = 137/253 (54.15%), Query Frame = 3
Query:  165 SYGIFAVHILLFMFLTINFSRATFMDPGFYQPA--TEEEVKQTDSFRSPL------------YRDITVKGVAMKIKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLFLLSLTLHIAIVIG--LNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFI---PVVGLTGFHIALIATGRTTNEQVTDKFK--GSNNPFTSG-MFKNWLYLLCKSQYPGSKSIILNSSKSHKVTIVDTKNI 857
            SY I    ILL + +     +    DPG    A  +E E  + D  ++               +++ +KG  +K+K+C+TC+ +RPPR+SHCS+C+ C+  FDHHCPWV NCIG+RNYRYF LF L LT++   ++G  + +  +    +  +T    ++  +++V  I F+    V+GL+GFH  LI    +TNE +   +K     NPF+ G   KN  ++LC  + P     +LN+++S     VD KN+
Sbjct:   60 SYAILVFGILLCLSVLSLLLKTALTDPGIIPRANVSESEWLEEDIVKNLFTNTNEPQRQQIRVKEVMLKGQLIKMKYCTTCKMFRPPRASHCSVCDNCVDRFDHHCPWVGNCIGRRNYRYFFLFNLFLTIYCLYILGFSITNLVLLSIDKSSLTEALKMSPTSVIVIIISFVSMTSVIGLSGFHSHLICKEISTNEDIKGSYKLISQTNPFSKGNGCKNCAWILCGPRPPS----LLNATQS-----VDMKNL 303          
The following BLAST results are available for this feature:
BLAST of Palmitoyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZDHHC52.766e-7456.57zinc finger DHHC-type containing 5 [Source:HGNC Sy... [more]
ZDHHC55.463e-7456.28zinc finger DHHC-type containing 5 [Source:HGNC Sy... [more]
ZDHHC82.108e-7250.22zinc finger DHHC-type containing 8 [Source:HGNC Sy... [more]
ZDHHC85.320e-7250.22zinc finger DHHC-type containing 8 [Source:HGNC Sy... [more]
ZDHHC53.525e-5962.04zinc finger DHHC-type containing 5 [Source:HGNC Sy... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhhc-81.682e-6645.33Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-23.592e-3429.12Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-141.451e-1826.78Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-41.197e-1743.02Zinc finger DHHC domain-containing protein 4 [Sou... [more]
dhhc-41.694e-1743.02Zinc finger DHHC domain-containing protein 4 [Sou... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zdhhc86.385e-6447.22gene:FBgn0085478 transcript:FBtr0112755[more]
Zdhhc81.067e-6347.22gene:FBgn0085478 transcript:FBtr0308591[more]
Zdhhc86.760e-6247.22gene:FBgn0085478 transcript:FBtr0343028[more]
Zdhhc88.613e-6247.22gene:FBgn0085478 transcript:FBtr0112754[more]
Zdhhc81.120e-6147.22gene:FBgn0085478 transcript:FBtr0112753[more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc5b1.849e-7653.24zinc finger DHHC-type containing 5b [Source:ZFIN;A... [more]
zdhhc5a9.584e-7651.36zinc finger DHHC-type containing 5a [Source:ZFIN;A... [more]
zdhhc5a1.283e-7551.36zinc finger DHHC-type containing 5a [Source:ZFIN;A... [more]
zdhhc5a1.283e-7551.36zinc finger DHHC-type containing 5a [Source:ZFIN;A... [more]
zdhhc8b2.646e-7149.78zinc finger DHHC-type containing 8b [Source:ZFIN;A... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glis31.959e-7351.82GLIS family zinc finger 3 [Source:Xenbase;Acc:XB-G... [more]
glis39.411e-7351.82GLIS family zinc finger 3 [Source:Xenbase;Acc:XB-G... [more]
zdhhc81.359e-6948.37zinc finger DHHC-type containing 8 [Source:NCBI ge... [more]
zdhhc82.979e-6950.22zinc finger DHHC-type containing 8 [Source:NCBI ge... [more]
glis32.521e-6550.99GLIS family zinc finger 3 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zdhhc52.415e-7452.27zinc finger, DHHC domain containing 5 [Source:MGI ... [more]
Zdhhc84.331e-7450.91zinc finger, DHHC domain containing 8 [Source:MGI ... [more]
Zdhhc84.331e-7450.91zinc finger, DHHC domain containing 8 [Source:MGI ... [more]
Zdhhc91.030e-3934.75zinc finger, DHHC domain containing 9 [Source:MGI ... [more]
Zdhhc91.030e-3934.75zinc finger, DHHC domain containing 9 [Source:MGI ... [more]
back to top
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VDZ4|ZDHC5_MOUSE1.689e-7352.27Palmitoyltransferase ZDHHC5 OS=Mus musculus OX=100... [more]
sp|E1BLT8|ZDHC5_BOVIN2.254e-7352.27Palmitoyltransferase ZDHHC5 OS=Bos taurus OX=9913 ... [more]
sp|Q2THW7|ZDHC5_RAT2.393e-7352.27Palmitoyltransferase ZDHHC5 OS=Rattus norvegicus O... [more]
sp|Q9C0B5|ZDHC5_HUMAN2.624e-7356.28Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=960... [more]
sp|Q2THX1|ZDHC5_PANTR2.705e-7356.28Palmitoyltransferase ZDHHC5 OS=Pan troglodytes OX=... [more]
back to top
BLAST of Palmitoyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P8V48.961e-7947.21Palmitoyltransferase (Fragment) OS=Schistocephalus... [more]
A0A0L8HJN11.637e-7853.94Palmitoyltransferase OS=Octopus bimaculoides OX=37... [more]
V9L2P52.398e-7851.97Palmitoyltransferase (Fragment) OS=Callorhinchus m... [more]
A0A093DIT46.654e-7757.79Palmitoyltransferase (Fragment) OS=Chaetura pelagi... [more]
A0A401RI468.144e-7754.59Palmitoyltransferase OS=Chiloscyllium punctatum OX... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc5a4.939e-7551.82palmitoyltransferase ZDHHC5-like [Source:NCBI gene... [more]
zdhhc5b3.367e-7351.10zinc finger DHHC-type containing 5b [Source:ZFIN;A... [more]
ZDHHC81.207e-6340.57probable palmitoyltransferase ZDHHC8 [Source:NCBI ... [more]
zdhhc144.750e-4035.71probable palmitoyltransferase ZDHHC14 [Source:NCBI... [more]
ZDHHC143.235e-3934.66zinc finger DHHC-type containing 14 [Source:HGNC S... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004672.16.224e-2131.84pep scaffold:Pmarinus_7.0:GL477315:17052:39954:-1 ... [more]
zdhhc61.852e-1928.98zinc finger DHHC-type containing 6 [Source:ZFIN;Ac... [more]
zdhhc16a4.169e-1830.95zinc finger DHHC-type containing 16a [Source:NCBI ... [more]
zdhhc3a1.468e-1551.72zinc finger DHHC-type containing 3a [Source:ZFIN;A... [more]
zdhhc43.930e-1533.10zinc finger DHHC-type containing 4 [Source:ZFIN;Ac... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ERF28.899e-2735.94Subunit of a palmitoyltransferase; this complex ad... [more]
SWF12.543e-1940.00Palmitoyltransferase that acts on transmembrane pr... [more]
PFA35.535e-1631.45Palmitoyltransferase for Vac8p; required for vacuo... [more]
PFA48.928e-1540.30Palmitoyltransferase with autoacylation activity; ... [more]
PFA51.564e-930.95Palmitoyltransferase with autoacylation activity; ... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO396925.778e-6645.34Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO385962.852e-3835.24Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO408252.908e-2231.52Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO383767.184e-2028.99Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO463049.586e-2027.00Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc8b2.642e-7752.84zinc finger DHHC-type containing 8 [Source:NCBI ge... [more]
ENSORLT00000037905.11.603e-7450.91palmitoyltransferase ZDHHC5 [Source:NCBI gene;Acc:... [more]
ENSORLT00000043523.16.078e-7449.79palmitoyltransferase ZDHHC5 [Source:NCBI gene;Acc:... [more]
zdhhc5b8.912e-7351.36zinc finger DHHC-type containing 5 [Source:NCBI ge... [more]
ENSORLT00000009587.21.742e-6449.34probable palmitoyltransferase ZDHHC8 [Source:NCBI ... [more]
back to top
BLAST of Palmitoyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033660.10.000e+0100.00SMESG000033660.1[more]
SMESG000018376.12.101e-7145.91SMESG000018376.1[more]
SMESG000028446.16.785e-5937.41SMESG000028446.1[more]
SMESG000018376.13.922e-5050.62SMESG000018376.1[more]
SMESG000005997.14.115e-3633.99SMESG000005997.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027199 ID=SMED30027199|Name=Palmitoyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2048bp
CTGTAAACAAATAAATTAATTTTTGTAAATTAAATTATTTCTCAATGAGA
AGAAACCGTGCATGTTCAACTAGACCAATTCCAGCTATTATTGCATGGGC
AATATTATTAGTTTTCAGTCTTTCTCACTTTATAGTAATATGTTTTTTTT
TTGGAAAAACCTATAGCTACGGAATATTTGCTGTTCACATTTTATTATTC
ATGTTCTTAACAATAAATTTTTCTCGAGCGACTTTCATGGATCCAGGATT
TTATCAACCAGCAACTGAAGAAGAAGTAAAGCAAACTGACAGCTTTAGAT
CACCTCTTTATCGAGACATAACAGTTAAAGGGGTCGCAATGAAAATTAAA
TGGTGTTCGACTTGTCAATTTTATCGGCCACCACGTTCTTCACATTGTTC
AATATGTAATAAATGCATCGTGGCATTCGACCATCATTGTCCATGGGTCA
ATAACTGCATTGGCAAACGCAACTATCGCTATTTTGTACTATTTTTGCTC
TCTTTAACGTTACATATTGCTATCGTAATTGGCTTGAATAGTTTTTATGT
TTACAAATTTCGAGAAAAACTTGTAACATATGACAATATTATAGCTATGG
TGACTATTGTTGTGGCTGGGATAATCTTTATTCCAGTGGTCGGGTTGACT
GGTTTTCATATCGCTCTTATAGCTACAGGTCGGACAACGAATGAACAGGT
TACTGATAAATTCAAAGGATCAAACAATCCATTCACAAGTGGAATGTTTA
AAAATTGGCTGTATTTATTGTGTAAATCCCAATACCCAGGCTCGAAATCT
ATCATATTGAACAGTTCTAAATCTCATAAAGTCACAATTGTCGATACGAA
AAATATTGAAAGTTCTGAAAAAATTCCGTTAACAGAAGCAAAATACTTTG
CTAGTCCTGAGAAAATAAACTCAAAACCAAATCTAGATGGGGATGTGAAT
TTACGGATGGGTTTTCCTCCATATAATCCAAATGGCAAAGTTACTCACAA
TTCCTCGTTTTTAAAAAAAGATATCAATCATTCTATATCATCAACAAAAT
CCAGTTTAGTTTACAACGATGATGTCGAGTTATTACAGATTGACAATCAT
TGGGCAAATGGAAATAAAAAGAATGATTCTAAGTGTAATTTATTTGAAGA
AGGAGCTTGTTCTATTGTAGTGGATGTGGATGATTACGAATTTGCTGATT
CAAATCAGAAAGCAAATCTTTTGAATCAGAAGTCAATTGAATTGAACAAT
CACAAATCTGTTCCTTTGTTAACAACAAGCAATTTCCATCATCAGCAAAA
CTTTTACAAACCATCAAATAATATGTCAAATGAATATTATGGCAATAAAA
CAAGCAAATATAAATTAGATTTAGCTCCACGAGCATCCATGGAAACACTT
GACAGATTTGTTTCATCTCCAACCTCCAAATCCTCATTCAATCATTCCGT
AAACTCACCAATACACTCCAAAGGTCAAGACTTTATAAATTCCAATTCAC
CAATCCAAACATCATCAGCCCAAATCATATTGGAAAGGGAGCCGCCATAT
ATCAGTAATTATCCAATGACTGATCAAGTCATGTTTCATAACAATAATTA
AACTAAATTTCAGCACATGTCGTTTTATTTATTTTGTGATTATTATTATT
ACTATTATTTTTTGTCTCAATGAAATTTTCGTTGAAATGTTTGCAATAAT
TTGGTTTGTATTAATGAGTTCTGGTTTTAACCATTTCAAATATGTTAACT
GATCAACTCTCATCACACAAGGAAGTTTCAACAATATAATATTAATAATA
TTAATAATAATGAGAATGATAACAAGTGATGAAGCTGAAATGTCGCCTTT
GTCACCGTCACCAACAACGCTACCAATAACGATTATGGTCGTCTATCCTT
CTTCATCGTCGTTCAATGTGTTCCAGTGTAAAATGTACATCTAAATATTT
TATTAAGTTGTTGTTATATTTAGAATCGGTTCGACTAACTTTCAAATATG
ATTATTTAATCCGATCAAAAAGAATCTATGTACACTTGTACTTGTCAG
back to top

protein sequence of SMED30027199-orf-1

>SMED30027199-orf-1 ID=SMED30027199-orf-1|Name=SMED30027199-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=519bp
MRRNRACSTRPIPAIIAWAILLVFSLSHFIVICFFFGKTYSYGIFAVHIL
LFMFLTINFSRATFMDPGFYQPATEEEVKQTDSFRSPLYRDITVKGVAMK
IKWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYRYFVLF
LLSLTLHIAIVIGLNSFYVYKFREKLVTYDNIIAMVTIVVAGIIFIPVVG
LTGFHIALIATGRTTNEQVTDKFKGSNNPFTSGMFKNWLYLLCKSQYPGS
KSIILNSSKSHKVTIVDTKNIESSEKIPLTEAKYFASPEKINSKPNLDGD
VNLRMGFPPYNPNGKVTHNSSFLKKDINHSISSTKSSLVYNDDVELLQID
NHWANGNKKNDSKCNLFEEGACSIVVDVDDYEFADSNQKANLLNQKSIEL
NNHKSVPLLTTSNFHHQQNFYKPSNNMSNEYYGNKTSKYKLDLAPRASME
TLDRFVSSPTSKSSFNHSVNSPIHSKGQDFINSNSPIQTSSAQIILEREP
PYISNYPMTDQVMFHNNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016409palmitoyltransferase activity
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0019706protein-cysteine S-palmitoyltransferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001594Palmitoyltrfase_DHHC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 516..518
NoneNo IPR availablePANTHERPTHR12349:SF2coord: 8..351
NoneNo IPR availablePANTHERPTHR12349FAMILY NOT NAMEDcoord: 8..351
NoneNo IPR availablePROSITEPS50216DHHCcoord: 102..152
score: 28.821
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 42..64
NoneNo IPR availableTMHMMTMhelixcoord: 147..169
IPR001594Palmitoyltransferase, DHHC domainPFAMPF01529DHHCcoord: 100..220
e-value: 1.3E-37
score: 128.9