UMP-CMP kinase

Overview
NameUMP-CMP kinase
Smed IDSMED30027197
Length (bp)888
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UMP-CMP kinase (SMED30027197) t-SNE clustered cells

Violin plots show distribution of expression levels for UMP-CMP kinase (SMED30027197) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UMP-CMP kinase (SMED30027197) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UMP-CMP kinase (SMED30027197) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027197

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027197SMESG000056620.1 Contig6817newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30027197SMESG000056620.1 Contig6817uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30027197SMESG000056620.1 SMESG000031498.1 dd_Smed_v4_3353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027197SMESG000056620.1 SMESG000031498.1 dd_Smed_v4_3353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027197SMESG000056620.1 SMESG000031498.1 dd_Smed_v4_3353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027197SMESG000056620.1 SMESG000031498.1 dd_Smed_v4_3353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027197SMESG000056620.1 SMESG000031498.1 dd_Smed_v4_3353_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UMP-CMP kinase vs. Ensembl Human
Match: CMPK1 (cytidine/uridine monophosphate kinase 1 [Source:HGNC Symbol;Acc:HGNC:18170])

HSP 1 Score: 204.527 bits (519), Expect = 7.498e-65
Identity = 99/181 (54.70%), Postives = 132/181 (72.93%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            V+FVLGGPG+GKGTQCA I +++GY HLSAG+LLR E+  P+S++GELI K IKEG IVPV IT SL++  M ++      K KFLIDGFPRN+DNL GWNK M GK  +  +L+ DC+ E+C++RCL RG  +GR+DDN E+L+KR+  + +  KPIID + E   V K++    V+EVF
Sbjct:   37 VVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVF 217          
BLAST of UMP-CMP kinase vs. Ensembl Human
Match: CMPK1 (cytidine/uridine monophosphate kinase 1 [Source:HGNC Symbol;Acc:HGNC:18170])

HSP 1 Score: 151.754 bits (382), Expect = 4.438e-45
Identity = 72/121 (59.50%), Postives = 91/121 (75.21%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEE 511
            V+FVLGGPG+GKGTQCA I +++GY HLSAG+LLR E+  P+S++GELI K IKEG IVPV IT SL++  M ++      K KFLIDGFPRN+DNL GWNK M GK  +  +L+ DC+ E
Sbjct:   37 VVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNE 157          
BLAST of UMP-CMP kinase vs. Ensembl Human
Match: AK1 (adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:361])

HSP 1 Score: 132.88 bits (333), Expect = 1.961e-37
Identity = 70/183 (38.25%), Postives = 112/183 (61.20%), Query Frame = 2
Query:  152 NKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
             K  +IFV+GGPGSGKGTQC  I +++GY HLS GDLLR+E    +++ G+ + + +++G +VP+     ++ +AM  K +    FLIDG+PR     + + + +    +   +LY+D   E   +R L RG  +GR DDNEET+KKRL  + +  +P+I  + +  +V KVN +  V+ VF+
Sbjct:    6 KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSAR-GKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTL---LLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFS 184          
BLAST of UMP-CMP kinase vs. Ensembl Human
Match: AK1 (adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:361])

HSP 1 Score: 132.88 bits (333), Expect = 1.961e-37
Identity = 70/183 (38.25%), Postives = 112/183 (61.20%), Query Frame = 2
Query:  152 NKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
             K  +IFV+GGPGSGKGTQC  I +++GY HLS GDLLR+E    +++ G+ + + +++G +VP+     ++ +AM  K +    FLIDG+PR     + + + +    +   +LY+D   E   +R L RG  +GR DDNEET+KKRL  + +  +P+I  + +  +V KVN +  V+ VF+
Sbjct:    6 KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSAR-GKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTL---LLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFS 184          
BLAST of UMP-CMP kinase vs. Ensembl Human
Match: AK1 (adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:361])

HSP 1 Score: 131.724 bits (330), Expect = 8.606e-37
Identity = 70/183 (38.25%), Postives = 112/183 (61.20%), Query Frame = 2
Query:  152 NKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
             K  +IFV+GGPGSGKGTQC  I +++GY HLS GDLLR+E    +++ G+ + + +++G +VP+     ++ +AM  K +    FLIDG+PR     + + + +    +   +LY+D   E   +R L RG  +GR DDNEET+KKRL  + +  +P+I  + +  +V KVN +  V+ VF+
Sbjct:   22 KKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSAR-GKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTL---LLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFS 200          
BLAST of UMP-CMP kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 222.631 bits (566), Expect = 2.413e-72
Identity = 109/208 (52.40%), Postives = 145/208 (69.71%), Query Frame = 2
Query:   89 KLKLIMFKSYIMSGAGGDVNANKF-SVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYK-FLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            +L L    S   S + G +  N   +V+FVLG PGSGKGT CA I +   YVHLSAGDLLRAE+ +  S+FG LI  +IK G+IVPV ITCSL+ENAMK  G  K FL+DGFPRN+DNL GWNK M GK +++ +L++ C   +C++RCL RG GR DDNEE+LKKR+  + ++  PII+HF +  LV +V  + PV+ V+A +E+ F
Sbjct:   15 RLSLSTLHSTRQSVSFGTLTRNDMHNVVFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQGRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVF 222          
BLAST of UMP-CMP kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 218.009 bits (554), Expect = 4.195e-71
Identity = 103/183 (56.28%), Postives = 136/183 (74.32%), Query Frame = 2
Query:  161 SVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYK-FLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            +V+FVLG PGSGKGT CA I +   YVHLSAGDLLRAE+ +  S+FG LI  +IK G+IVPV ITCSL+ENAMK  G  K FL+DGFPRN+DNL GWNK M GK +++ +L++ C   +C++RCL RG GR DDNEE+LKKR+  + ++  PII+HF +  LV +V  + PV+ V+A +E+ F
Sbjct:    3 NVVFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQGRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVF 185          
BLAST of UMP-CMP kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 218.009 bits (554), Expect = 4.195e-71
Identity = 103/183 (56.28%), Postives = 136/183 (74.32%), Query Frame = 2
Query:  161 SVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYK-FLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            +V+FVLG PGSGKGT CA I +   YVHLSAGDLLRAE+ +  S+FG LI  +IK G+IVPV ITCSL+ENAMK  G  K FL+DGFPRN+DNL GWNK M GK +++ +L++ C   +C++RCL RG GR DDNEE+LKKR+  + ++  PII+HF +  LV +V  + PV+ V+A +E+ F
Sbjct:    3 NVVFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQGRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVF 185          
BLAST of UMP-CMP kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 218.009 bits (554), Expect = 4.195e-71
Identity = 103/183 (56.28%), Postives = 136/183 (74.32%), Query Frame = 2
Query:  161 SVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYK-FLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            +V+FVLG PGSGKGT CA I +   YVHLSAGDLLRAE+ +  S+FG LI  +IK G+IVPV ITCSL+ENAMK  G  K FL+DGFPRN+DNL GWNK M GK +++ +L++ C   +C++RCL RG GR DDNEE+LKKR+  + ++  PII+HF +  LV +V  + PV+ V+A +E+ F
Sbjct:    3 NVVFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQGRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVF 185          
BLAST of UMP-CMP kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 218.009 bits (554), Expect = 4.195e-71
Identity = 103/183 (56.28%), Postives = 136/183 (74.32%), Query Frame = 2
Query:  161 SVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYK-FLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            +V+FVLG PGSGKGT CA I +   YVHLSAGDLLRAE+ +  S+FG LI  +IK G+IVPV ITCSL+ENAMK  G  K FL+DGFPRN+DNL GWNK M GK +++ +L++ C   +C++RCL RG GR DDNEE+LKKR+  + ++  PII+HF +  LV +V  + PV+ V+A +E+ F
Sbjct:    3 NVVFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQGRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVF 185          
BLAST of UMP-CMP kinase vs. Ensembl Fly
Match: Dak1 (gene:FBgn0028833 transcript:FBtr0084976)

HSP 1 Score: 215.312 bits (547), Expect = 4.933e-69
Identity = 104/193 (53.89%), Postives = 136/193 (70.47%), Query Frame = 2
Query:  137 GDVNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGR---GTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            G ++  K  ++FVLGGPG+GKGTQC+ I  RF + HLSAGDLLR E+ +  S+FG LI   I+ G IVPV +TCSL+ENAMK SGK +FLIDGFPRN+DNLDGWN+ M+ KV  + +L+ DC E+VCVKRCLGR   G+GR DDN ++LKKR+  +  +  PII  F     V +++     EEVF  +E+ F
Sbjct:   56 GIMSVEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTCSLLENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEVEKIF 248          
BLAST of UMP-CMP kinase vs. Ensembl Fly
Match: Adk1 (gene:FBgn0022709 transcript:FBtr0076017)

HSP 1 Score: 107.842 bits (268), Expect = 4.392e-28
Identity = 66/183 (36.07%), Postives = 105/183 (57.38%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM-KESGKYK-FLIDGFPRNKDNLDGWNKAMTGKVII---ESILYIDCSEEVCVKRCLGRGTG----RADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            +I++LGGPG GKGTQCA I +++G+ HLS+GDLLR E    + K G  +   +  G +V      SL+ +A+ +  G  K FLIDG+PR K      N+ +  +  I   +  LY +CSE+  V+R + R       R DDNE+T++ RL+ FK+    I++ +  + L   +N +  V+++F
Sbjct:    6 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDK-GRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQK------NQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTLT--INAERDVDDIF 179          
BLAST of UMP-CMP kinase vs. Ensembl Fly
Match: Adk1 (gene:FBgn0022709 transcript:FBtr0076018)

HSP 1 Score: 108.227 bits (269), Expect = 6.050e-28
Identity = 65/185 (35.14%), Postives = 104/185 (56.22%), Query Frame = 2
Query:  149 ANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM-KESGKYK-FLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTG----RADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            A    +I++LGGPG GKGTQCA I +++G+ HLS+GDLLR E    + K G  +   +  G +V      SL+ +A+ +  G  K FLIDG+PR K+    +   +      +  LY +CSE+  V+R + R       R DDNE+T++ RL+ FK+    I++ +  + L   +N +  V+++F
Sbjct:   29 AADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDK-GRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPA---DLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTLT--INAERDVDDIF 207          
BLAST of UMP-CMP kinase vs. Ensembl Fly
Match: Adk2 (gene:FBgn0283494 transcript:FBtr0072163)

HSP 1 Score: 88.9669 bits (219), Expect = 1.217e-20
Identity = 62/211 (29.38%), Postives = 101/211 (47.87%), Query Frame = 2
Query:  170 FVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM-KESGKYKFLIDGFPRNKDNLDGWNKAMTG-KVIIESILYIDCSEEVCVKRCLGR----GTG-------------------------RADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFS 709
             +LG PGSGKGTQ   + ++F   HLS GD+LRAE     SK G  + K +  G +V   +   +I++ + K   K  FL+DGFPR     +  +  +   K  +++++     + + V+R  GR     +G                         R+DDN E LKKRL  + ++ KP++D++    L FKV+      +VF+ ++  F 
Sbjct:   22 ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISS-GSKLGAELKKVMDAGKLVSDDLVVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAAKKSSDVFSTIDSIFQ 231          
BLAST of UMP-CMP kinase vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082331)

HSP 1 Score: 81.6481 bits (200), Expect = 4.472e-18
Identity = 61/212 (28.77%), Postives = 96/212 (45.28%), Query Frame = 2
Query:  158 FSVIF---VLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG------------------------TG-----RADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLE 697
            F+ IF   ++G PGSGKGT    I K  G VH+S GD+LR    K N++ G+   + I EG +VP AI    +   + E G   +++DGFPRN    +    A+  +  I++++ +D    V + R   R                         TG     R DD    + KRL  + E   P+I  + ++ LV    G    +E++ ++E
Sbjct:    2 FTKIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIK-NTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSYILDGFPRNIAQAE----ALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGK-QTKEIWPMME 207          
BLAST of UMP-CMP kinase vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 202.986 bits (515), Expect = 1.918e-64
Identity = 96/185 (51.89%), Postives = 132/185 (71.35%), Query Frame = 2
Query:  155 KFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            K  V+FVLGGPG+GKGTQCA I + + Y HLSAGDLLR E+ + +S+FG+LI   IKEG IVPV IT +L+  AM+E+      K++FLIDGFPRN+DNL GWN  M GK  ++ +L+ DCS EVC+ RCL RG  +GR DDN E+L+KR+  + +  +PII+ + ++  V +++    V+EVFA
Sbjct:   31 KPQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFA 215          
BLAST of UMP-CMP kinase vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 202.601 bits (514), Expect = 2.342e-64
Identity = 96/185 (51.89%), Postives = 132/185 (71.35%), Query Frame = 2
Query:  155 KFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            K  V+FVLGGPG+GKGTQCA I + + Y HLSAGDLLR E+ + +S+FG+LI   IKEG IVPV IT +L+  AM+E+      K++FLIDGFPRN+DNL GWN  M GK  ++ +L+ DCS EVC+ RCL RG  +GR DDN E+L+KR+  + +  +PII+ + ++  V +++    V+EVFA
Sbjct:   27 KPQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFA 211          
BLAST of UMP-CMP kinase vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 202.601 bits (514), Expect = 2.398e-64
Identity = 96/185 (51.89%), Postives = 132/185 (71.35%), Query Frame = 2
Query:  155 KFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            K  V+FVLGGPG+GKGTQCA I + + Y HLSAGDLLR E+ + +S+FG+LI   IKEG IVPV IT +L+  AM+E+      K++FLIDGFPRN+DNL GWN  M GK  ++ +L+ DCS EVC+ RCL RG  +GR DDN E+L+KR+  + +  +PII+ + ++  V +++    V+EVFA
Sbjct:   25 KPQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFA 209          
BLAST of UMP-CMP kinase vs. Ensembl Zebrafish
Match: ak1 (adenylate kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040822-37])

HSP 1 Score: 150.599 bits (379), Expect = 2.126e-44
Identity = 79/189 (41.80%), Postives = 120/189 (63.49%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNLQ 718
            ++FV+GGPGSGKGTQC  I  ++GY HLS+GDLLRAE     S+ G+ +   +++G +VP+     +I++AM  K      +LIDG+PR     + + K +    ++   LYID   E  VKR + RG  +GRADDNEET+KKRL  + +  +P+I  + +  +V K+N +LPV+EVFA++E+    L+
Sbjct:   10 IVFVVGGPGSGKGTQCEKIVAKYGYTHLSSGDLLRAEV-ASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGYLIDGYPREVKQGEEFEKKIGAPALL---LYIDAKGETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVIAFYEQRGIVRKINSELPVDEVFAIVEKAIDELK 194          
BLAST of UMP-CMP kinase vs. Ensembl Zebrafish
Match: ak1 (adenylate kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040822-37])

HSP 1 Score: 150.214 bits (378), Expect = 3.131e-44
Identity = 79/189 (41.80%), Postives = 120/189 (63.49%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNLQ 718
            ++FV+GGPGSGKGTQC  I  ++GY HLS+GDLLRAE     S+ G+ +   +++G +VP+     +I++AM  K      +LIDG+PR     + + K +    ++   LYID   E  VKR + RG  +GRADDNEET+KKRL  + +  +P+I  + +  +V K+N +LPV+EVFA++E+    L+
Sbjct:   10 IVFVVGGPGSGKGTQCEKIVAKYGYTHLSSGDLLRAEV-ASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGYLIDGYPREVKQGEEFEKKIGAPALL---LYIDAKGETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVIAFYEQRGIVRKINSELPVDEVFAIVEKAIDELK 194          
BLAST of UMP-CMP kinase vs. Ensembl Xenopus
Match: ncan (neurocan [Source:Xenbase;Acc:XB-GENE-961217])

HSP 1 Score: 206.068 bits (523), Expect = 1.437e-65
Identity = 96/188 (51.06%), Postives = 135/188 (71.81%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            V+FVLGGPG+GKGTQC  I +++GY HLSAGDLLR E+ KP+S++GELI   I++G IVPV IT SL++ AM+++      K+KFLIDGFPRN+DNL GW + M GK  +  +L+ DC  E C++RCL RG  +GR+DDN E+L+KR+  + +  +PIID + +   V KV+    V+EVF  +++ F
Sbjct:   28 VVFVLGGPGAGKGTQCERIVQKYGYTHLSAGDLLRDERKKPDSQYGELIESYIRDGRIVPVEITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCIERCLERGKSSGRSDDNRESLEKRIQTYLQSTRPIIDLYEKTGKVKKVDASKSVDEVFTKVQDIF 215          
BLAST of UMP-CMP kinase vs. Ensembl Xenopus
Match: ncan (neurocan [Source:Xenbase;Acc:XB-GENE-961217])

HSP 1 Score: 166.777 bits (421), Expect = 1.622e-50
Identity = 83/186 (44.62%), Postives = 116/186 (62.37%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            V+FVLGGPG+GKGTQC  I +++GY HLSAGDLLR E+ KP+S++GELI   I++G IVPV IT SL++ AM+++      K+KFLIDGFPRN+DNL GW + M GK  +  +L+ DC  EV ++  L                      +  +PIID + +   V KV+    V+EVF  +++ F
Sbjct:   28 VVFVLGGPGAGKGTQCERIVQKYGYTHLSAGDLLRDERKKPDSQYGELIESYIRDGRIVPVEITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNEVIIQTYL----------------------QSTRPIIDLYEKTGKVKKVDASKSVDEVFTKVQDIF 191          
BLAST of UMP-CMP kinase vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 130.954 bits (328), Expect = 9.711e-37
Identity = 73/189 (38.62%), Postives = 110/189 (58.20%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNLQ 718
            +IFV+GGPGSGKGTQC  I  ++GY HLS GDLLRAE     S+ G+ +   +++G +VP+     +++ AM  K      +LIDG+PR     + + K +    +   +LYID   +  VKR L RG  +GRADDNE T+KKRL  + +  +P+I  +    +V K+N +  V++VF  +      L+
Sbjct:   10 IIFVVGGPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVSS-GSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSL---LLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEGSVDDVFKQVSTALDALK 194          
BLAST of UMP-CMP kinase vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 130.183 bits (326), Expect = 8.116e-36
Identity = 72/178 (40.45%), Postives = 107/178 (60.11%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            +IFV+GGPGSGKGTQC  I  ++GY HLS GDLLRAE     S+ G+ +   +++G +VP+     +++ AM  K      +LIDG+PR     + + K +    +   +LYID   +  VKR L RG  +GRADDNE T+KKRL  + +  +P+I  +    +V K+N +  V++VF
Sbjct:   55 IIFVVGGPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVSS-GSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSL---LLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEGSVDDVF 228          
BLAST of UMP-CMP kinase vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 123.635 bits (309), Expect = 7.273e-34
Identity = 69/168 (41.07%), Postives = 100/168 (59.52%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKV 655
            +IFV+GGPGSGKGTQC  I  ++GY HLS GDLLRAE     S+ G+ +   +++G +VP+     +++ AM  K      +LIDG+PR     + + K +    +   +LYID   +  VKR L RG  +GRADDNE T+KKRL  + +  +P+I  +    +V KV
Sbjct:   28 IIFVVGGPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVSS-GSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSL---LLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKV 191          
BLAST of UMP-CMP kinase vs. Ensembl Mouse
Match: Cmpk1 (cytidine monophosphate (UMP-CMP) kinase 1 [Source:MGI Symbol;Acc:MGI:1913838])

HSP 1 Score: 204.912 bits (520), Expect = 3.722e-65
Identity = 100/182 (54.95%), Postives = 132/182 (72.53%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            V+FVLGGPG+GKGTQCA I +++GY HLSAG+LLR E+  P+S++GELI K IKEG IVPV IT SL++  M ++      K KFLIDGFPRN+DNL GWNK M GK  +  +L+ DC+ E+C++RCL RG  +GR+DDN E+L+KR+  + E  KPIID + E   V K++    V+EVF 
Sbjct:   36 VVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKIDASKSVDEVFG 217          
BLAST of UMP-CMP kinase vs. Ensembl Mouse
Match: Ak1 (adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:87977])

HSP 1 Score: 132.494 bits (332), Expect = 1.855e-37
Identity = 72/182 (39.56%), Postives = 109/182 (59.89%), Query Frame = 2
Query:  155 KFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            K  +IFV+GGPGSGKGTQC  I +++GY HLS GDLLRAE     S+ G+ +   +++G +VP+     ++ +AM  K      FLIDG+PR     + + + +    +   +LY+D   E   +R L RG  +GR DDNEET+KKRL  +    +P+I  +++  +V KVN +  V+ VF+
Sbjct:    7 KAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVS-SGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTL---LLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFS 184          
BLAST of UMP-CMP kinase vs. Ensembl Mouse
Match: Ak1 (adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:87977])

HSP 1 Score: 132.494 bits (332), Expect = 1.855e-37
Identity = 72/182 (39.56%), Postives = 109/182 (59.89%), Query Frame = 2
Query:  155 KFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            K  +IFV+GGPGSGKGTQC  I +++GY HLS GDLLRAE     S+ G+ +   +++G +VP+     ++ +AM  K      FLIDG+PR     + + + +    +   +LY+D   E   +R L RG  +GR DDNEET+KKRL  +    +P+I  +++  +V KVN +  V+ VF+
Sbjct:    7 KAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVS-SGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTL---LLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFS 184          
BLAST of UMP-CMP kinase vs. Ensembl Mouse
Match: Ak1 (adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:87977])

HSP 1 Score: 131.724 bits (330), Expect = 6.573e-37
Identity = 72/182 (39.56%), Postives = 109/182 (59.89%), Query Frame = 2
Query:  155 KFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            K  +IFV+GGPGSGKGTQC  I +++GY HLS GDLLRAE     S+ G+ +   +++G +VP+     ++ +AM  K      FLIDG+PR     + + + +    +   +LY+D   E   +R L RG  +GR DDNEET+KKRL  +    +P+I  +++  +V KVN +  V+ VF+
Sbjct:   23 KAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVS-SGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTL---LLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFS 200          
BLAST of UMP-CMP kinase vs. Ensembl Mouse
Match: Gm17949 (predicted gene, 17949 [Source:MGI Symbol;Acc:MGI:5010134])

HSP 1 Score: 113.235 bits (282), Expect = 7.127e-30
Identity = 61/178 (34.27%), Postives = 103/178 (57.87%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYK-FLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGT--GRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            +IFV+GGPG GKGTQC N++ ++G+ H+  G LLR E  + +++ G  I   +++G +VP  +   +I + +    K + FLIDGFPR  +    + + + G+     ++  DCS E  V+R L RG    RADD+E  ++KRL      C+P++  + ++NL+  +  +   E +FA
Sbjct:   28 IIFVVGGPGCGKGTQCRNMALKYGFYHVELGQLLREEAQR-STQRGRQIRDIMQKGLLVPTGLILDMISDNLLSYPKIRGFLIDGFPRELEQAKEFER-IVGRA-PNMVIVFDCSMETMVRRVLRRGQVEHRADDSEPAIRKRLETHYTLCEPVLTFYQQKNLLRHILAEEAPESIFA 202          
BLAST of UMP-CMP kinase vs. UniProt/SwissProt
Match: sp|Q20230|KCY2_CAEEL (UMP-CMP kinase 2 OS=Caenorhabditis elegans OX=6239 GN=F40F8.1 PE=1 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 5.336e-70
Identity = 103/183 (56.28%), Postives = 136/183 (74.32%), Query Frame = 2
Query:  161 SVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYK-FLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            +V+FVLG PGSGKGT CA I +   YVHLSAGDLLRAE+ +  S+FG LI  +IK G+IVPV ITCSL+ENAMK  G  K FL+DGFPRN+DNL GWNK M GK +++ +L++ C   +C++RCL RG GR DDNEE+LKKR+  + ++  PII+HF +  LV +V  + PV+ V+A +E+ F
Sbjct:    3 NVVFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQGRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVF 185          
BLAST of UMP-CMP kinase vs. UniProt/SwissProt
Match: sp|Q9DBP5|KCY_MOUSE (UMP-CMP kinase OS=Mus musculus OX=10090 GN=Cmpk1 PE=1 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 3.770e-65
Identity = 100/182 (54.95%), Postives = 132/182 (72.53%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            V+FVLGGPG+GKGTQCA I +++GY HLSAG+LLR E+  P+S++GELI K IKEG IVPV IT SL++  M ++      K KFLIDGFPRN+DNL GWNK M GK  +  +L+ DC+ E+C++RCL RG  +GR+DDN E+L+KR+  + E  KPIID + E   V K++    V+EVF 
Sbjct:    5 VVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKIDASKSVDEVFG 186          
BLAST of UMP-CMP kinase vs. UniProt/SwissProt
Match: sp|Q4KM73|KCY_RAT (UMP-CMP kinase OS=Rattus norvegicus OX=10116 GN=Cmpk1 PE=1 SV=2)

HSP 1 Score: 205.682 bits (522), Expect = 5.697e-65
Identity = 100/182 (54.95%), Postives = 131/182 (71.98%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            V+FVLGGPG+GKGTQCA I +++GY HLSAG+LLR E+  P+S++GELI K IKEG IVPV IT SL++  M ++      K KFLIDGFPRN+DNL GWNK M GK  +  +L+ DC+ E+C+ RCL RG  +GR+DDN E+L+KR+  + E  KPIID + E   V K++    V+EVF 
Sbjct:    5 VVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIDRCLERGKSSGRSDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKIDASKSVDEVFG 186          
BLAST of UMP-CMP kinase vs. UniProt/SwissProt
Match: sp|Q28H12|KCY_XENTR (UMP-CMP kinase OS=Xenopus tropicalis OX=8364 GN=cmpk1 PE=2 SV=2)

HSP 1 Score: 205.297 bits (521), Expect = 6.147e-65
Identity = 96/188 (51.06%), Postives = 135/188 (71.81%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            V+FVLGGPG+GKGTQC  I +++GY HLSAGDLLR E+ KP+S++GELI   I++G IVPV IT SL++ AM+++      K+KFLIDGFPRN+DNL GW + M GK  +  +L+ DC  E C++RCL RG  +GR+DDN E+L+KR+  + +  +PIID + +   V KV+    V+EVF  +++ F
Sbjct:    5 VVFVLGGPGAGKGTQCERIVQKYGYTHLSAGDLLRDERKKPDSQYGELIESYIRDGRIVPVEITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCIERCLERGKSSGRSDDNRESLEKRIQTYLQSTRPIIDLYEKTGKVKKVDASKSVDEVFTKVQDIF 192          
BLAST of UMP-CMP kinase vs. UniProt/SwissProt
Match: sp|P30085|KCY_HUMAN (UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3)

HSP 1 Score: 205.297 bits (521), Expect = 7.475e-65
Identity = 99/181 (54.70%), Postives = 132/181 (72.93%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            V+FVLGGPG+GKGTQCA I +++GY HLSAG+LLR E+  P+S++GELI K IKEG IVPV IT SL++  M ++      K KFLIDGFPRN+DNL GWNK M GK  +  +L+ DC+ E+C++RCL RG  +GR+DDN E+L+KR+  + +  KPIID + E   V K++    V+EVF
Sbjct:    5 VVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVF 185          
BLAST of UMP-CMP kinase vs. TrEMBL
Match: A0A023F4Y2 (Putative ump-cmp kinase family (Fragment) OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.509e-74
Identity = 112/192 (58.33%), Postives = 148/192 (77.08%), Query Frame = 2
Query:  149 ANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGR---GTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNL 715
             +K  V+FVLGGPG+GKGTQCANI + FG+VHLSAGDLLRAE++ P ++FGELI  +I+ GTIVPV ITC LIE AM ESG+ KFLIDGFPRNKDNLDGW + M  KV +  +L++ CSE+VC+KRCL R   G+GR+DDN  +LKKR+  F ++  PI++H+   NLV  ++ D P++EVF  +++ FSN+
Sbjct:   12 GSKPKVVFVLGGPGAGKGTQCANIVREFGFVHLSAGDLLRAERNSPGTQFGELIETHIRNGTIVPVEITCKLIERAMIESGRDKFLIDGFPRNKDNLDGWTREMENKVDLLFVLFLHCSEDVCIKRCLKRGADGSGRSDDNITSLKKRIETFYKDSLPIVEHYRAMNLVRSIDADKPIDEVFEEVKKVFSNV 203          
BLAST of UMP-CMP kinase vs. TrEMBL
Match: T1HJN2 (UMP-CMP kinase OS=Rhodnius prolixus OX=13249 PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.955e-74
Identity = 112/192 (58.33%), Postives = 147/192 (76.56%), Query Frame = 2
Query:  149 ANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGR---GTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNL 715
             +K  V+FVLGGPG+GKGTQCANI ++FG+VHLSAGDLLRAE++ P +++GELI  +I+ GTIVPV ITC LIE AM ESGK KFLIDGFPRNKDNLDGW + M  KV +  +L+ +CSE+VC+ RCL R   G+GR+DDN  +LKKR+  F ++  PII+H+   NLV  ++ D PV EVF  +++ F+N+
Sbjct:    4 GSKPKVVFVLGGPGAGKGTQCANIVRQFGFVHLSAGDLLRAERNSPGTQYGELIETHIRNGTIVPVEITCKLIERAMIESGKAKFLIDGFPRNKDNLDGWTREMEKKVDLLFVLFFNCSEQVCIDRCLKRGAEGSGRSDDNITSLKKRIETFHKDSMPIIEHYKAMNLVRSIDADKPVNEVFEEVKKVFANV 195          
BLAST of UMP-CMP kinase vs. TrEMBL
Match: A0A1B6EIT6 (UMP-CMP kinase OS=Cuerna arida OX=1464854 GN=g.39679 PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 4.597e-74
Identity = 116/196 (59.18%), Postives = 149/196 (76.02%), Query Frame = 2
Query:  137 GDVNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGR---GTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNL 715
            GDV   K  V+FVLGGPG+GKGTQCANI K FG+VHLSAGDLLR E+ KP +K+GELI ++I+ G+IVPV ITC LIE AM+ SGK KFLIDGFPRN++NL+GWNKAM  KV +  +L+ DCS+++CV+RCL R   G+GR+DDNEE+LKKR+  F  +  PII+HF E  LV +++ D    EVF  ++  F N+
Sbjct:   17 GDVLKPK--VVFVLGGPGAGKGTQCANIVKEFGFVHLSAGDLLREERSKPGTKYGELIEEHIRNGSIVPVEITCKLIEMAMQNSGKQKFLIDGFPRNENNLEGWNKAMAEKVELLFVLFFDCSQDICVQRCLKRGAQGSGRSDDNEESLKKRIQTFVNDSMPIIEHFKERKLVHRIDADQEPNEVFEDVKAIFQNI 210          
BLAST of UMP-CMP kinase vs. TrEMBL
Match: A0A0P4VSA2 (Putative uridylate kinase/adenylate kinase (Fragment) OS=Rhodnius neglectus OX=72488 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 7.650e-74
Identity = 113/197 (57.36%), Postives = 148/197 (75.13%), Query Frame = 2
Query:  134 GGDVNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGR---GTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNL 715
            G     +K  V+FVLGGPG+GKGTQCANI ++FG+VHLSAGDLLRAE++ P +++GELI  +I+ GTIVPV ITC LIE AM ESGK KFLIDGFPRNKDNLDGW + M  KV +  +L+ +CSE+VC+ RCL R   G+GR+DDN  +LKKR+  F ++  PII+H+   NLV  ++ D PV EVF  +++ F+N+
Sbjct:    7 GAMSGGSKPKVVFVLGGPGAGKGTQCANIVRQFGFVHLSAGDLLRAERNSPGTQYGELIETHIRNGTIVPVEITCKLIERAMIESGKDKFLIDGFPRNKDNLDGWTREMEKKVDLLFVLFFNCSEQVCIDRCLKRGAEGSGRSDDNITSLKKRIETFHKDSMPIIEHYKAMNLVRSIDADKPVNEVFEEVKKVFANV 203          
BLAST of UMP-CMP kinase vs. TrEMBL
Match: A0A1D2N326 (UMP-CMP kinase OS=Orchesella cincta OX=48709 GN=Ocin01_07042 PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 3.663e-73
Identity = 112/191 (58.64%), Postives = 148/191 (77.49%), Query Frame = 2
Query:  143 VNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGR---GTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKF 706
            ++A+K +V+FVLGGPG+GKGTQCANI K FG+VHLSAGDLLR E+ KP S+FGELI K+I++GTIVPV ITCSL+ENAM ++ K  FLIDGFPRN+DNLDGW + M  KV +  +L+++  E++CV RCL R   G+GR+DDN E+LKKR+V +  +  PII HF++ +LV KV+     EEVF  ++E F
Sbjct:    1 MSASKPNVVFVLGGPGAGKGTQCANIVKTFGFVHLSAGDLLREERSKPGSEFGELIEKHIRDGTIVPVEITCSLLENAMTKNEKNNFLIDGFPRNQDNLDGWTRQMGDKVNVHFVLFLEAPEDICVNRCLSRGQAGSGRSDDNPESLKKRVVTYNNDTMPIISHFDKLSLVRKVDAAKGTEEVFDQVKEHF 191          
BLAST of UMP-CMP kinase vs. Ensembl Cavefish
Match: cmpk (cytidine/uridine monophosphate kinase 1 [Source:NCBI gene;Acc:103043729])

HSP 1 Score: 202.216 bits (513), Expect = 2.608e-64
Identity = 98/197 (49.75%), Postives = 133/197 (67.51%), Query Frame = 2
Query:  119 IMSGAGGDVNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKES-----GKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            + S   G   A K  V+FVLGGPG+GKGTQCA I + + Y HLSAGDLLR E+ +  S+FG+LI   IKEG IVPV IT +L+  AM+E+      K++FLIDGFPRN+DNL GW   M GK  ++ +L+ DCS EVC+ RCL RG  +GR DDN E+L+KR+  + +  +PII+ + ++  V  ++    V+EVFA
Sbjct:   13 VSSALRGIALAMKPQVVFVLGGPGAGKGTQCARIVQNYSYTHLSAGDLLREERSRTGSEFGQLIDSYIKEGKIVPVEITINLLRKAMEETMKADENKFRFLIDGFPRNQDNLQGWTTVMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIEQYEQQGKVRCIDASRDVDEVFA 209          
BLAST of UMP-CMP kinase vs. Ensembl Cavefish
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:103035193])

HSP 1 Score: 141.739 bits (356), Expect = 3.804e-41
Identity = 76/189 (40.21%), Postives = 116/189 (61.38%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNLQ 718
            +IFV+GGPGSGKGTQC  +  ++GY HLS+GDLLRAE     S+ G+ +   +++G +VP+     +I++AM  K      FLIDG+PR     + + K +    +   +LY+D   E  VKR + RG  +GRADDNEET+KKRL  + +  +P+I  +    +V K+N +L V++VFA + +    L+
Sbjct:   10 IIFVVGGPGSGKGTQCEKVVAKYGYTHLSSGDLLRAEV-ASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGAPAL---LLYVDAKSETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVITFYEGRGIVRKINSELAVDDVFAEVSKAIDGLK 194          
BLAST of UMP-CMP kinase vs. Ensembl Cavefish
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:103035193])

HSP 1 Score: 140.969 bits (354), Expect = 1.749e-40
Identity = 76/189 (40.21%), Postives = 116/189 (61.38%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNLQ 718
            +IFV+GGPGSGKGTQC  +  ++GY HLS+GDLLRAE     S+ G+ +   +++G +VP+     +I++AM  K      FLIDG+PR     + + K +    +   +LY+D   E  VKR + RG  +GRADDNEET+KKRL  + +  +P+I  +    +V K+N +L V++VFA + +    L+
Sbjct:   29 IIFVVGGPGSGKGTQCEKVVAKYGYTHLSSGDLLRAEV-ASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGAPAL---LLYVDAKSETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVITFYEGRGIVRKINSELAVDDVFAEVSKAIDGLK 213          
BLAST of UMP-CMP kinase vs. Ensembl Cavefish
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:103035193])

HSP 1 Score: 129.798 bits (325), Expect = 1.277e-36
Identity = 70/169 (41.42%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVN 658
            +IFV+GGPGSGKGTQC  +  ++GY HLS+GDLLRAE     S+ G+ +   +++G +VP+     +I++AM  K      FLIDG+PR     + + K +    +   +LY+D   E  VKR + RG  +GRADDNEET+KKRL  + +  +P+I  +    +V KV+
Sbjct:   10 IIFVVGGPGSGKGTQCEKVVAKYGYTHLSSGDLLRAEV-ASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGAPAL---LLYVDAKSETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVITFYEGRGIVRKVH 174          
BLAST of UMP-CMP kinase vs. Ensembl Cavefish
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:103029093])

HSP 1 Score: 96.6709 bits (239), Expect = 4.543e-22
Identity = 59/187 (31.55%), Postives = 99/187 (52.94%), Query Frame = 2
Query:  140 DVNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAE--KDKPNSKFGELIIKNIKEGTIVPVAITCSLI-ENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            D +  +  VI ++GGPGSGKGTQ   I++R+G+ ++S G+LLR     +  +++   LI K I  G + P   T + I +  MK       +IDGFPR+      +   +    +   ++++ CS +   +R   R    GR DDN +  ++RL  FK+   P++ +F E+ L+  ++ D   EEVF
Sbjct:  126 DPSRPRPKVILIIGGPGSGKGTQSLKIAERYGFEYVSVGELLRKRMIHNATSNRKWSLIAKIITNGELAPQETTITEIKQKIMKIPDANGIVIDGFPRDVGQALSFEDQICTPDL---VVFLACSNQRLKERLEKRAEQQGRPDDNPKATERRLANFKQNAVPLVKYFQEKGLIVTLDADRDEEEVF 309          

HSP 2 Score: 78.5666 bits (192), Expect = 6.682e-16
Identity = 51/186 (27.42%), Postives = 90/186 (48.39%), Query Frame = 2
Query:  143 VNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKY--KFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNE---ETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            V   K  VIFV+GGPGSGK  QC  I +++G   L   D+L +E  + +S+ G      ++ G  +P      L+  +M+ + ++   FL+ GFPR+    + +   M GK  +  +L ++C  +   +R   R        E       +R+  F     P+I H+  + ++ K++ + P +EVF
Sbjct:  371 VEKKKPKVIFVIGGPGSGKALQCEKIEEQYGLKRLCPRDILCSEL-QSHSERGRFFRDVLERGEQLPEDTLLDLLCESMESTVRHGKGFLVSGFPRDLRQAEEYEAKM-GKPCV--VLLLECCSDTMSRRLQQRTCSSLRSREARDRDAHRRVDSFCSTITPVIHHYEHKGVLHKIDAEQPPDEVF 552          
BLAST of UMP-CMP kinase vs. Ensembl Sea Lamprey
Match: ak5l (adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE-050410-2])

HSP 1 Score: 86.6557 bits (213), Expect = 8.872e-21
Identity = 50/174 (28.74%), Postives = 89/174 (51.15%), Query Frame = 2
Query:  179 GGPGSGKGTQCANISKRFGYVHLSAGDLLRAE--KDKPNSKFGELIIKNIKEGTIVPVAIT-CSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            GGPGSGKGTQ   +S+ +G V +S G++LR    +  P+++   LI + I +G + P       L ++ ++      F+IDGFPR       + + +      ++++ + C+ E   +R   R    GR DDN   +++RL  F++   P++ H+ E  L+   + D    E+F
Sbjct:    1 GGPGSGKGTQSRKLSESYGLVCVSLGEVLRQHVLQRAPSNRKWRLIAQIISKGELAPQETAIWELKQHFLQNPDAPGFVIDGFPREISQALAFEEQVGAP---DAVILLACASERLRQRLGERADRHGRPDDNPRAVERRLATFRQHTVPLVQHYQERGLLLTFDADREEGELF 171          
BLAST of UMP-CMP kinase vs. Ensembl Yeast
Match: URA6 (Uridylate kinase; catalyzes the seventh enzymatic step in the de novo biosynthesis of pyrimidines, converting uridine monophosphate (UMP) into uridine-5'-diphosphate (UDP) [Source:SGD;Acc:S000001507])

HSP 1 Score: 169.474 bits (428), Expect = 1.107e-52
Identity = 90/187 (48.13%), Postives = 127/187 (67.91%), Query Frame = 2
Query:  146 NANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKE---SGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIES--ILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            + ++ SVIFVLGGPG+GKGTQC  + K + +VHLSAGDLLRAE+ +  S++GELI   IKEG IVP  IT +L+ NA+ +   + K+KFLIDGFPR  D    + +      I+ES  IL+ DC E++ ++R L RG  +GR+DDN E++KKR   FKE   P+I++F  ++ V +V  D  VE+V+
Sbjct:   12 SPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERD-----IVESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVY 193          
BLAST of UMP-CMP kinase vs. Ensembl Yeast
Match: ADK1 (Adenylate kinase, required for purine metabolism; localized to the cytoplasm and the mitochondria; lacks cleavable signal sequence; protein abundance increases in response to DNA replication stress; mutations affecting Adk1p catalytic activity deregulate expression of phosphate utilization genes PHO5 and PHO84; human homolog AK1 can complement yeast adk1 mutant [Source:SGD;Acc:S000002634])

HSP 1 Score: 82.8037 bits (203), Expect = 2.496e-19
Identity = 54/206 (26.21%), Postives = 99/206 (48.06%), Query Frame = 2
Query:  167 IFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYK--FLIDGFPRNKDNLDGWNKAMTGK-VIIESILYIDCSEEVCVKRCLGR----GTG-------------------------RADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFA 688
            + ++G PG+GKGTQ  N+ +RF   HL+ GD+LR++  K  ++ G    K + +G +V   I  ++I++ +  +   K  F++DGFPR     +  ++ +  +   +E  + +   +E+ V R  GR     +G                         R+DDN + LKKRL  +  + +PI+D + +  +   V+   P   V+A
Sbjct:    9 MVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAK-GTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWA 213          
BLAST of UMP-CMP kinase vs. Ensembl Yeast
Match: ADK2 (Mitochondrial adenylate kinase; catalyzes the reversible synthesis of GTP and AMP from GDP and ADP; may serve as a back-up for synthesizing GTP or ADP depending on metabolic conditions; 3' sequence of ADK2 varies with strain background [Source:SGD;Acc:S000000972])

HSP 1 Score: 63.5438 bits (153), Expect = 2.052e-12
Identity = 50/197 (25.38%), Postives = 84/197 (42.64%), Query Frame = 2
Query:  179 GGPGSGKGTQCANISKRFGYV-HLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYK----FLIDGFPRNKDNLDGWNKAMTGK-VIIESILYIDCSEEVCVKRCLGRG-----------------------------TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGD 664
            G PGSGKGTQ + + K+   +  +S+GD+LR E  K  S  G      I +G ++P  +   LI   +   G  K    +L+DGFPR        ++ +      +  ++ +D  E   ++R   R                              T R DD  E  KKRL ++K+  +P+ D++ +  +   V+G+
Sbjct:   21 GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEI-KSESTLGREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPLKDYYKKSGIFGTVSGE 216          
BLAST of UMP-CMP kinase vs. Ensembl Nematostella
Match: EDO36160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJH0])

HSP 1 Score: 191.43 bits (485), Expect = 8.441e-61
Identity = 96/192 (50.00%), Postives = 132/192 (68.75%), Query Frame = 2
Query:  146 NANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNL 715
            +A+K  VIFVLGGPG+GKGTQC  I K +GYVHLSAG+LLR E+ +  SK G+LI   + EG IVPVAIT SL++ AM +S   KFLIDGFPRN+DNL GW   M  KV ++++L+ +C E++C+ R + RG  +GR DDN E+L+KR    +    PII+H+  + LV  ++G    +EVF  ++  F +L
Sbjct:    3 SASKPVVIFVLGGPGAGKGTQCERIVKEYGYVHLSAGELLREER-RSGSKDGDLIENCMTEGKIVPVAITVSLLQKAMAKSDVQKFLIDGFPRNEDNLQGWESRMNDKVDVKAVLFFECPEDICIGRIMSRGQSSGRPDDNIESLRKRFHTHENSTMPIIEHYRRQGLVKPISGAPTPDEVFLQVKRVFESL 193          
BLAST of UMP-CMP kinase vs. Ensembl Nematostella
Match: EDO38863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK8])

HSP 1 Score: 149.443 bits (376), Expect = 1.896e-44
Identity = 76/186 (40.86%), Postives = 120/186 (64.52%), Query Frame = 2
Query:  167 IFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYK-FLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNL 715
            I  LGGPG+GKGT C ++ K++ Y HLSAGDLLR E  + N + G++I + ++EG +VP  IT  L+++AM+E      FLIDGFPR+ D    + + +T     + +LY++C+EEV  +R L R   +GR DDN ET+KKR V F E+  P+++H+ +++   +++   P+EEV+  +   F+ L
Sbjct:    4 IITLGGPGAGKGTICDSVVKKYNYCHLSAGDLLREEVTRGNER-GQMITEMMREGKLVPKEITIGLLQDAMREHKDMPGFLIDGFPRDIDQGITFEEQVTDS---DFVLYLECTEEVMQERLLKRAETSGRPDDNIETIKKRFVTFLEKTVPVVEHYEKQSKAHRIDASRPLEEVYNAISSLFAEL 185          
BLAST of UMP-CMP kinase vs. Ensembl Nematostella
Match: EDO38864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK9])

HSP 1 Score: 130.568 bits (327), Expect = 2.160e-37
Identity = 75/173 (43.35%), Postives = 104/173 (60.12%), Query Frame = 2
Query:  176 LGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM-KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            LGGPGSGKGTQCA I ++FGY H S GDLLR E +   S+ G+ I+  +++G +VP  I   L+  AM K+     FLIDGFPR  +    + K +    + E +LY +CS +    R L RG  +GR DDNEET+  RL  F  +  P+I+H+ EE  V K++ +   +EVF
Sbjct:    1 LGGPGSGKGTQCARIVEKFGYTHFSTGDLLREEVNS-GSERGKNIVAMMEKGELVPNGIILELLRLAMVKQPNTTGFLIDGFPRELEQGLEFEKEL---ALCELLLYFECSPDTMKARLLKRGETSGRVDDNEETILSRLETFITQTMPVIEHYQEEGKVKKISAEGGPDEVF 169          
BLAST of UMP-CMP kinase vs. Ensembl Nematostella
Match: EDO26972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAJ9])

HSP 1 Score: 91.2781 bits (225), Expect = 1.748e-23
Identity = 48/75 (64.00%), Postives = 58/75 (77.33%), Query Frame = 2
Query:  146 NANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIE 370
            +A+K  VIFVLGGPG+GKGTQC  I K +GYVHLSAG+LLR E+ K  SK G+LI   + EG IVPVAIT SL++
Sbjct:    3 SASKPVVIFVLGGPGAGKGTQCERIVKEYGYVHLSAGELLREER-KSGSKDGDLIENCMTEGKIVPVAITVSLLQ 76          
BLAST of UMP-CMP kinase vs. Ensembl Nematostella
Match: EDO42583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S170])

HSP 1 Score: 75.0998 bits (183), Expect = 2.881e-16
Identity = 54/191 (28.27%), Postives = 90/191 (47.12%), Query Frame = 2
Query:  176 LGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG-----------------------------TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNG 661
            +G PGSGKGT    I + FG  HLS+G+LLR      ++  GE     I +G +VP  +   LI + + ++ K  +L+DGFPR      G  + ++ K  I+ ++ +D      V R   R                              T R DD  ET+  RL +++E+ KP+I+++N++ ++   +G
Sbjct:    1 MGPPGSGKGTVSERIVRDFGVEHLSSGELLRHHVQN-HTDLGEEAQAYILKGELVPDELMVDLILHEL-DAKKGNWLLDGFPRTV----GQAETLSEKHKIDVVVNMDVPFATIVDRIKQRWVHAVSGRVYNLEFNPPKVEGKDDITGEPLTQREDDKPETVMARLKKYEEQTKPLIEYYNKKGVLASFSG 185          
BLAST of UMP-CMP kinase vs. Ensembl Medaka
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 145.591 bits (366), Expect = 6.002e-43
Identity = 68/124 (54.84%), Postives = 88/124 (70.97%), Query Frame = 2
Query:  155 KFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM-----KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEE 511
            K  V+FVLGGPG+GKGTQC+ I + + Y HLSAGDLLR E+ +  S+FG+LI   IKEG IVPV IT +L+  AM     K+  K++FLIDGFPRN+DNL GWN  M GK  ++ +L+ DC  +
Sbjct:   23 KPQVVFVLGGPGAGKGTQCSRIVENYSYTHLSAGDLLREERAREGSEFGQLIDNYIKEGQIVPVQITINLLRKAMEDTMQKDENKFRFLIDGFPRNEDNLQGWNTVMDGKADVKFVLFFDCDNQ 146          
BLAST of UMP-CMP kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 142.895 bits (359), Expect = 1.440e-41
Identity = 79/189 (41.80%), Postives = 118/189 (62.43%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNLQ 718
            +IFV+GGPGSGKGTQC  I  ++GY HLS+GDLLRAE     S  G+ +   +++G +VP+     +I++AM  K      FLIDG+PR     + + K + GK  +  +LY+D   E  +KR L RG  +GR+DDNEET+KKRL  + +  +P+I  +    +V KV+ +LPV+EVF  + +   +L+
Sbjct:   10 IIFVVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEV-ASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKI-GKPCL--LLYVDAKSETMIKRLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSLK 194          
BLAST of UMP-CMP kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 142.895 bits (359), Expect = 1.564e-41
Identity = 79/189 (41.80%), Postives = 118/189 (62.43%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNLQ 718
            +IFV+GGPGSGKGTQC  I  ++GY HLS+GDLLRAE     S  G+ +   +++G +VP+     +I++AM  K      FLIDG+PR     + + K + GK  +  +LY+D   E  +KR L RG  +GR+DDNEET+KKRL  + +  +P+I  +    +V KV+ +LPV+EVF  + +   +L+
Sbjct:   10 IIFVVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEV-ASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKI-GKPCL--LLYVDAKSETMIKRLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSLK 194          
BLAST of UMP-CMP kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 142.895 bits (359), Expect = 1.820e-41
Identity = 79/189 (41.80%), Postives = 118/189 (62.43%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNLQ 718
            +IFV+GGPGSGKGTQC  I  ++GY HLS+GDLLRAE     S  G+ +   +++G +VP+     +I++AM  K      FLIDG+PR     + + K + GK  +  +LY+D   E  +KR L RG  +GR+DDNEET+KKRL  + +  +P+I  +    +V KV+ +LPV+EVF  + +   +L+
Sbjct:   16 IIFVVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEV-ASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKI-GKPCL--LLYVDAKSETMIKRLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSLK 200          
BLAST of UMP-CMP kinase vs. Ensembl Medaka
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:101172192])

HSP 1 Score: 95.5153 bits (236), Expect = 1.133e-21
Identity = 58/179 (32.40%), Postives = 95/179 (53.07%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAE--KDKPNSKFGELIIKNIKEGTIVPVAITCSLI-ENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            VI V+GGPGSGKGTQ   I++R+G+ ++S G+LLR +   +  +++   LI K I  G + P   T + I +  MK       +IDGFPR+      +   +    +   ++++ C+     +R   R    GR DDN + + +RL  FK+   P++ +F E  L+  ++ D   EEVF
Sbjct:  134 VILVIGGPGSGKGTQSLKIAERYGFQYVSVGELLRKKMIHNATSNRKWSLIAKIITNGELAPQETTITEIKQKIMKIPEANGIVIDGFPRDVGQALSFEDQICTPDL---VVFLACANHRLKERLQKRAEQQGRPDDNPKAIDRRLTNFKQNTIPLVKYFQERGLIVTLDADRNEEEVF 309          

HSP 2 Score: 76.2554 bits (186), Expect = 3.523e-15
Identity = 49/184 (26.63%), Postives = 89/184 (48.37%), Query Frame = 2
Query:  155 KFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKY--KFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG-----TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            K  VIF++GGPGSGK  QC  + +RFG   ++ GDLL +E  + +S  G  ++  ++ G  +P      L+ +A+  S +     ++  FPR+      +   M       +++ + CS E    R L RG        + D E +L +R   F  + + +  ++  + L++ V+ +   +EVF
Sbjct:  376 KPKVIFMMGGPGSGKTLQCERMEERFGLRRVALGDLLCSEL-QSHSDRGRHLLDILERGEKLPEVALLELLCDAVASSARQGKGLVVSSFPRDLSQAQEYEAKMGDP---SAVILLTCSPETMSSRSLHRGRSSSSLLASSDTEGSLSRRSESFCSDSQEVTAYYERKKLLYTVDAETSPDEVF 555          
BLAST of UMP-CMP kinase vs. Planmine SMEST
Match: SMESG000031498.1 (SMESG000031498.1)

HSP 1 Score: 313.153 bits (801), Expect = 5.103e-109
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 2
Query:  122 MSGAGGDVNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKR 583
            MSGAGGDVNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKR
Sbjct:    1 MSGAGGDVNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKR 154          
BLAST of UMP-CMP kinase vs. Planmine SMEST
Match: SMESG000056620.1 (SMESG000056620.1)

HSP 1 Score: 232.646 bits (592), Expect = 6.059e-78
Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 2
Query:  377 MKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEKFSNLQ 718
            MKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPV+EVFALLEEKFSNLQ
Sbjct:    1 MKESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVDEVFALLEEKFSNLQ 114          
BLAST of UMP-CMP kinase vs. Planmine SMEST
Match: SMESG000031478.1 (SMESG000031478.1)

HSP 1 Score: 158.688 bits (400), Expect = 4.979e-48
Identity = 86/176 (48.86%), Postives = 110/176 (62.50%), Query Frame = 2
Query:  158 FSVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKY-KFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEV 682
            F VI VLG PGSGKGTQC  I K + Y H+SAG LL+ E   P  K+GE+I  +  +GTIVP  ITC LI   MK S K  KF+IDGFPRN+DN  GW   +     ++ +L+IDCSEEVC KRCL R    A D+ + + KRL QF +E + ++  F    LV K+NG+    +V
Sbjct:    7 FDVIIVLGYPGSGKGTQCNKIEKEYNYHHISAGYLLQKETLNPQMKYGEIIKSHRSKGTIVPHEITCKLILQEMKSSQKSKKFVIDGFPRNEDNFIGWKSFLVKHCSLQCVLFIDCSEEVCRKRCLQRNRDSA-DSVDVVDKRLKQFNDETRLVLQQFGV--LVRKINGNQDTNKV 179          
BLAST of UMP-CMP kinase vs. Planmine SMEST
Match: SMESG000060686.1 (SMESG000060686.1)

HSP 1 Score: 124.79 bits (312), Expect = 1.578e-34
Identity = 72/178 (40.45%), Postives = 107/178 (60.11%), Query Frame = 2
Query:  164 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVF 685
            VIFVLGGPGSGKGTQC  I  ++G+ HLS+GDLLR E +   S+ G  + + +++G +V + I   LI +AM  K    + FLIDG+PR    L+   +     +  E ++    SE+V   R L RG  +GR DDN ET+ KRL  F E  KP+IDH+ +++   +++    ++E+F
Sbjct:   18 VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVE-SGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPR---ELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIF 191          
BLAST of UMP-CMP kinase vs. Planmine SMEST
Match: SMESG000053790.1 (SMESG000053790.1)

HSP 1 Score: 117.857 bits (294), Expect = 7.677e-32
Identity = 68/179 (37.99%), Postives = 96/179 (53.63%), Query Frame = 2
Query:  161 SVIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKF-LIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGR----GTGRADDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEV 682
            +++F LGGPG+GKGT C  + K     HLS G LLR  K         +I K++ EG+IV   I+C LIE+A+    KYK  +IDGFPRN  N   W K  + K+ +  I ++ C E   + RCL R       R DD   T+K R+ Q+  E  P+I  F+E   +  V+ +  + EV
Sbjct:   11 NIVFFLGGPGTGKGTICNFLEKNLNIYHLSVGQLLREVKVCDPEYL--VIKKHMGEGSIVSSEISCRLIEDALITLNKYKIVIIDGFPRNFSNYYSWKKLSSSKMNLLKIFHLTCHENAMLNRCLSRNQLNSIKRLDDEANTIKSRISQYNNETLPLIQLFHENYHIETVDANRNLIEV 187          
The following BLAST results are available for this feature:
BLAST of UMP-CMP kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CMPK17.498e-6554.70cytidine/uridine monophosphate kinase 1 [Source:HG... [more]
CMPK14.438e-4559.50cytidine/uridine monophosphate kinase 1 [Source:HG... [more]
AK11.961e-3738.25adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK11.961e-3738.25adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK18.606e-3738.25adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:36... [more]
back to top
BLAST of UMP-CMP kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F40F8.12.413e-7252.40UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.14.195e-7156.28UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.14.195e-7156.28UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.14.195e-7156.28UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.14.195e-7156.28UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
back to top
BLAST of UMP-CMP kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dak14.933e-6953.89gene:FBgn0028833 transcript:FBtr0084976[more]
Adk14.392e-2836.07gene:FBgn0022709 transcript:FBtr0076017[more]
Adk16.050e-2835.14gene:FBgn0022709 transcript:FBtr0076018[more]
Adk21.217e-2029.38gene:FBgn0283494 transcript:FBtr0072163[more]
Adk34.472e-1828.77gene:FBgn0042094 transcript:FBtr0082331[more]
back to top
BLAST of UMP-CMP kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmpk1.918e-6451.89cytidylate kinase [Source:NCBI gene;Acc:406383][more]
cmpk2.342e-6451.89cytidylate kinase [Source:NCBI gene;Acc:406383][more]
cmpk2.398e-6451.89cytidylate kinase [Source:NCBI gene;Acc:406383][more]
ak12.126e-4441.80adenylate kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04082... [more]
ak13.131e-4441.80adenylate kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04082... [more]
back to top
BLAST of UMP-CMP kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncan1.437e-6551.06neurocan [Source:Xenbase;Acc:XB-GENE-961217][more]
ncan1.622e-5044.62neurocan [Source:Xenbase;Acc:XB-GENE-961217][more]
ak19.711e-3738.62adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
ak18.116e-3640.45adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
ak17.273e-3441.07adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
back to top
BLAST of UMP-CMP kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cmpk13.722e-6554.95cytidine monophosphate (UMP-CMP) kinase 1 [Source:... [more]
Ak11.855e-3739.56adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak11.855e-3739.56adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak16.573e-3739.56adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:8797... [more]
Gm179497.127e-3034.27predicted gene, 17949 [Source:MGI Symbol;Acc:MGI:5... [more]
back to top
BLAST of UMP-CMP kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q20230|KCY2_CAEEL5.336e-7056.28UMP-CMP kinase 2 OS=Caenorhabditis elegans OX=6239... [more]
sp|Q9DBP5|KCY_MOUSE3.770e-6554.95UMP-CMP kinase OS=Mus musculus OX=10090 GN=Cmpk1 P... [more]
sp|Q4KM73|KCY_RAT5.697e-6554.95UMP-CMP kinase OS=Rattus norvegicus OX=10116 GN=Cm... [more]
sp|Q28H12|KCY_XENTR6.147e-6551.06UMP-CMP kinase OS=Xenopus tropicalis OX=8364 GN=cm... [more]
sp|P30085|KCY_HUMAN7.475e-6554.70UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE... [more]
back to top
BLAST of UMP-CMP kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023F4Y21.509e-7458.33Putative ump-cmp kinase family (Fragment) OS=Triat... [more]
T1HJN22.955e-7458.33UMP-CMP kinase OS=Rhodnius prolixus OX=13249 PE=3 ... [more]
A0A1B6EIT64.597e-7459.18UMP-CMP kinase OS=Cuerna arida OX=1464854 GN=g.396... [more]
A0A0P4VSA27.650e-7457.36Putative uridylate kinase/adenylate kinase (Fragme... [more]
A0A1D2N3263.663e-7358.64UMP-CMP kinase OS=Orchesella cincta OX=48709 GN=Oc... [more]
back to top
BLAST of UMP-CMP kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmpk2.608e-6449.75cytidine/uridine monophosphate kinase 1 [Source:NC... [more]
ak13.804e-4140.21adenylate kinase 1 [Source:NCBI gene;Acc:103035193... [more]
ak11.749e-4040.21adenylate kinase 1 [Source:NCBI gene;Acc:103035193... [more]
ak11.277e-3641.42adenylate kinase 1 [Source:NCBI gene;Acc:103035193... [more]
ak54.543e-2231.55adenylate kinase 5 [Source:NCBI gene;Acc:103029093... [more]
back to top
BLAST of UMP-CMP kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ak5l8.872e-2128.74adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of UMP-CMP kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
URA61.107e-5248.13Uridylate kinase; catalyzes the seventh enzymatic ... [more]
ADK12.496e-1926.21Adenylate kinase, required for purine metabolism; ... [more]
ADK22.052e-1225.38Mitochondrial adenylate kinase; catalyzes the reve... [more]
back to top
BLAST of UMP-CMP kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO361608.441e-6150.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388631.896e-4440.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388642.160e-3743.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269721.748e-2364.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425832.881e-1628.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UMP-CMP kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmpk6.002e-4354.84cytidylate kinase [Source:NCBI gene;Acc:406383][more]
ak11.440e-4141.80adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak11.564e-4141.80adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak11.820e-4141.80adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak51.133e-2132.40adenylate kinase 5 [Source:NCBI gene;Acc:101172192... [more]
back to top
BLAST of UMP-CMP kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031498.15.103e-109100.00SMESG000031498.1[more]
SMESG000056620.16.059e-7899.12SMESG000056620.1[more]
SMESG000031478.14.979e-4848.86SMESG000031478.1[more]
SMESG000060686.11.578e-3440.45SMESG000060686.1[more]
SMESG000053790.17.677e-3237.99SMESG000053790.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027197 ID=SMED30027197|Name=UMP-CMP kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=888bp
CACTTTCTTTCATACATTTGTTTAACATCAATTTAATTTTTTTTAAAAAT
TTCAATTTTTTTTTAATCTAAGGTGCTAATTTGATTTTAAATTAAAATTA
ATAATGTTTAAAAGTTACATAATGAGTGGAGCTGGTGGCGACGTGAATGC
AAATAAATTTTCAGTCATATTTGTTCTAGGTGGACCTGGCAGTGGAAAAG
GAACACAATGTGCGAATATTTCCAAGAGATTCGGTTATGTTCATTTGTCT
GCTGGAGACTTATTACGCGCCGAAAAAGATAAACCAAATTCTAAATTTGG
TGAATTGATCATTAAAAACATTAAAGAGGGAACTATAGTTCCGGTTGCAA
TTACTTGTAGTTTAATTGAAAATGCAATGAAAGAAAGTGGAAAATATAAA
TTTCTAATCGATGGATTTCCAAGAAATAAAGACAATTTAGATGGATGGAA
TAAAGCAATGACCGGTAAAGTGATAATTGAATCAATACTGTATATCGATT
GCAGTGAAGAAGTATGCGTTAAAAGGTGTCTCGGTAGAGGAACCGGACGA
GCTGATGATAACGAAGAAACTCTTAAAAAGCGACTTGTGCAATTCAAAGA
AGAATGTAAGCCAATTATAGATCATTTTAACGAAGAAAATCTTGTTTTTA
AAGTAAATGGAGATCTTCCGGTTGAAGAGGTATTTGCATTATTGGAGGAG
AAATTTTCAAATTTACAATAGATTTTGTTAAATACATTTATTATTTTCCT
TTATTCTTATTAGATGCTTAGATCTTGGTCTTTTGTTAGTACATTTTATA
ATTTGGCTCCTTGATTATCAAATTTTATTGTATTAGTATTGATAATAAAA
TATTTGTACAATTGATTTATTAATATAAATTATGTTTA
back to top

protein sequence of SMED30027197-orf-1

>SMED30027197-orf-1 ID=SMED30027197-orf-1|Name=SMED30027197-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=206bp
MFKSYIMSGAGGDVNANKFSVIFVLGGPGSGKGTQCANISKRFGYVHLSA
GDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAMKESGKYKF
LIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRGTGRA
DDNEETLKKRLVQFKEECKPIIDHFNEENLVFKVNGDLPVEEVFALLEEK
FSNLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0046940nucleoside monophosphate phosphorylation
GO:0006139nucleobase-containing compound metabolic process
GO:0006207'de novo' pyrimidine nucleobase biosynthetic process
GO:0006221pyrimidine nucleotide biosynthetic process
GO:0016310phosphorylation
GO:0046939nucleotide phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR006266UMP_CMP_kinase
IPR033690Adenylat_kinase_CS
IPR000850Adenylat/UMP-CMP_kin
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0019205nucleobase-containing compound kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004127cytidylate kinase activity
GO:0009041uridylate kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000850Adenylate kinase/UMP-CMP kinasePRINTSPR00094ADENYLTKNASEcoord: 166..180
score: 19.89
coord: 23..36
score: 70.58
coord: 51..65
score: 35.48
coord: 100..116
score: 41.38
coord: 149..164
score: 54.03
IPR000850Adenylate kinase/UMP-CMP kinasePANTHERPTHR23359NUCLEOTIDE KINASEcoord: 20..202
IPR000850Adenylate kinase/UMP-CMP kinaseCDDcd01428ADKcoord: 21..193
e-value: 1.76558E-65
score: 198.23
NoneNo IPR availablePFAMPF00406ADKcoord: 24..178
e-value: 3.5E-42
score: 144.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 9..202
e-value: 4.2E-59
score: 201.6
NoneNo IPR availablePANTHERPTHR23359:SF189UMP-CMP KINASE 2coord: 20..202
IPR006266UMP-CMP kinaseTIGRFAMTIGR01359TIGR01359coord: 21..201
e-value: 1.0E-76
score: 254.9
IPR033690Adenylate kinase, conserved sitePROSITEPS00113ADENYLATE_KINASEcoord: 100..111
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 17..203