SMED30027186

Overview
NameSMED30027186
Smed IDSMED30027186
Length (bp)2232
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027186 (SMED30027186) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027186 (SMED30027186) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027186 (SMED30027186) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027186 (SMED30027186) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027186

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027186SMESG000022949.1 SmedASXL_015241SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027186SMESG000022949.1 dd_Smed_v4_14572_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027186SMESG000022949.1 dd_Smed_v4_14572_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027186SMESG000022949.1 dd_Smed_v6_14572_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027186SMESG000022949.1 dd_Smed_v4_14572_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027186 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000723:90283..104991 +10958
Homology
BLAST of SMED30027186 vs. Ensembl Human
Match: LCA5 (lebercilin LCA5 [Source:HGNC Symbol;Acc:HGNC:31923])

HSP 1 Score: 85.8853 bits (211), Expect = 1.217e-16
Identity = 73/205 (35.61%), Postives = 133/205 (64.88%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++  +RILSAR  KI +  N +SELQ ++ +LL ENK+LK   YRQ+KAL+K +  +++I +++ +H  E+T LKE+L+++++      K+ K+++SE  + + SL K  ++   ++L ER+ L  +LV  + KL+ +E+ ++  SK+LE    S +R++   RK+  +   + +  +KE+  +   LKEKE+ L+I+NIYS+R+
Sbjct:   98 DLVTKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQYRQEKALNKFEDAENEISQLIFRHNNEITALKERLRKSQEKERATEKRVKDTESELFRTKFSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELSTNSFQRQLLAERKRAYEAHDENKVLQKEVQRLYHKLKEKERELDIKNIYSNRL 302          
BLAST of SMED30027186 vs. Ensembl Human
Match: LCA5 (lebercilin LCA5 [Source:HGNC Symbol;Acc:HGNC:31923])

HSP 1 Score: 85.8853 bits (211), Expect = 1.217e-16
Identity = 73/205 (35.61%), Postives = 133/205 (64.88%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++  +RILSAR  KI +  N +SELQ ++ +LL ENK+LK   YRQ+KAL+K +  +++I +++ +H  E+T LKE+L+++++      K+ K+++SE  + + SL K  ++   ++L ER+ L  +LV  + KL+ +E+ ++  SK+LE    S +R++   RK+  +   + +  +KE+  +   LKEKE+ L+I+NIYS+R+
Sbjct:   98 DLVTKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQYRQEKALNKFEDAENEISQLIFRHNNEITALKERLRKSQEKERATEKRVKDTESELFRTKFSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELSTNSFQRQLLAERKRAYEAHDENKVLQKEVQRLYHKLKEKERELDIKNIYSNRL 302          
BLAST of SMED30027186 vs. Ensembl Human
Match: LCA5 (lebercilin LCA5 [Source:HGNC Symbol;Acc:HGNC:31923])

HSP 1 Score: 84.3445 bits (207), Expect = 1.682e-16
Identity = 74/219 (33.79%), Postives = 129/219 (58.90%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRK---------QLKQYEVQ-----CRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++  +RILSAR  KI +  N +SELQ ++ +LL ENK+LK   YRQ+KAL+K +  +++I +++ +H  E+T LKE+L+++++      K+ K+++SE  + + SL K  ++   ++L ER+ L  +LV  + KL+ +E+ ++  SK+LE    S +R++   RK         ++ Q EVQ      +E E+ELD              I+NIYS+R+
Sbjct:   98 DLVTKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQYRQEKALNKFEDAENEISQLIFRHNNEITALKERLRKSQEKERATEKRVKDTESELFRTKFSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELSTNSFQRQLLAERKRAYEAHDENKVLQKEVQRLYHKLKEKERELD--------------IKNIYSNRL 302          
BLAST of SMED30027186 vs. Ensembl Human
Match: LCA5L (lebercilin LCA5 like [Source:HGNC Symbol;Acc:HGNC:1255])

HSP 1 Score: 77.411 bits (189), Expect = 4.495e-14
Identity = 71/229 (31.00%), Postives = 130/229 (56.77%), Query Frame = 3
Query:  279 MMPQKRFTESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNIL--QLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRES----------EKELDLVKINXXXXXXXXXIQNIYSHRI 929
            M+ Q+R      +  A RILSAR HKI    N ++++  +++ +L EN+ LK    R  KA+ K ++ Q+++P+I+ +HQ EV NL++ L+++++      ++ +E+DS+ LK ++ L    +L  +KNL ER  L  +L ++ T+         ++   K +++LEK  +    N R   +Q  ++ R++          + E+  ++  LKEK++ LEI+NIYSHRI
Sbjct:  131 MIAQRR------DAMAHRILSARLHKIKGLKNELADMHHKLEAILTENQFLKQLQLRHLKAIGKYENSQNNLPQIMAKHQNEVKNLRQLLRKSQEKERTLSRKLRETDSQLLKTKDILQALQKLSEDKNLAEREELTHKLSIITTK---------MDANDKKIQSLEKQLR---LNCRAFSRQLAIETRKTLAAQTATKTLQVEVKHLQQKLKEKDRELEIKNIYSHRI 341          
BLAST of SMED30027186 vs. Ensembl Human
Match: LCA5L (lebercilin LCA5 like [Source:HGNC Symbol;Acc:HGNC:1255])

HSP 1 Score: 77.411 bits (189), Expect = 4.495e-14
Identity = 71/229 (31.00%), Postives = 130/229 (56.77%), Query Frame = 3
Query:  279 MMPQKRFTESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNIL--QLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRES----------EKELDLVKINXXXXXXXXXIQNIYSHRI 929
            M+ Q+R      +  A RILSAR HKI    N ++++  +++ +L EN+ LK    R  KA+ K ++ Q+++P+I+ +HQ EV NL++ L+++++      ++ +E+DS+ LK ++ L    +L  +KNL ER  L  +L ++ T+         ++   K +++LEK  +    N R   +Q  ++ R++          + E+  ++  LKEK++ LEI+NIYSHRI
Sbjct:  131 MIAQRR------DAMAHRILSARLHKIKGLKNELADMHHKLEAILTENQFLKQLQLRHLKAIGKYENSQNNLPQIMAKHQNEVKNLRQLLRKSQEKERTLSRKLRETDSQLLKTKDILQALQKLSEDKNLAEREELTHKLSIITTK---------MDANDKKIQSLEKQLR---LNCRAFSRQLAIETRKTLAAQTATKTLQVEVKHLQQKLKEKDRELEIKNIYSHRI 341          
BLAST of SMED30027186 vs. Ensembl Zebrafish
Match: lca5 (lebercilin LCA5 [Source:ZFIN;Acc:ZDB-GENE-090313-268])

HSP 1 Score: 72.0182 bits (175), Expect = 1.603e-12
Identity = 65/207 (31.40%), Postives = 125/207 (60.39%), Query Frame = 3
Query:  309 QLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            +++   +R+LSAR  KI +  N +SEL+   D+L  EN+ L+    RQ+KAL + +   S+I ++L +H  E   L+E+L+R+++      +  +E D++  + R+ + K  QL  ++NLGER  L  +L+ TQ +L+ SE  ++   K++E    S +R++ N R++    + + +  ++E++ +   LKEKE+ L+ +NIY++R+
Sbjct:  150 EVDQVTKRMLSARLLKINELKNALSELRLHADELQRENRLLRQLQLRQEKALHRYNDTDSEISQLLARHNNETHVLRERLRRSQENQRTAERSLRERDAQLQRCRSQMQKLQQLADDQNLGEREELSRKLIGTQSRLQDSEHRVKELEKNMELSSGSFQRQLANERRKTHDAQQEVKALQEEVERLCTKLKEKERELDARNIYANRM 356          
BLAST of SMED30027186 vs. Ensembl Zebrafish
Match: lca5 (lebercilin LCA5 [Source:ZFIN;Acc:ZDB-GENE-090313-268])

HSP 1 Score: 70.4774 bits (171), Expect = 4.798e-12
Identity = 65/207 (31.40%), Postives = 125/207 (60.39%), Query Frame = 3
Query:  309 QLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            +++   +R+LSAR  KI +  N +SEL+   D+L  EN+ L+    RQ+KAL + +   S+I ++L +H  E   L+E+L+R+++      +  +E D++  + R+ + K  QL  ++NLGER  L  +L+ TQ +L+ SE  ++   K++E    S +R++ N R++    + + +  ++E++ +   LKEKE+ L+ +NIY++R+
Sbjct:  150 EVDQVTKRMLSARLLKINELKNALSELRLHADELQRENRLLRQLQLRQEKALHRYNDTDSEISQLLARHNNETHVLRERLRRSQENQRTAERSLRERDAQLQRCRSQMQKLQQLADDQNLGEREELSRKLIGTQSRLQDSEHRVKELEKNMELSSGSFQRQLANERRKTHDAQQEVKALQEEVERLCTKLKEKERELDARNIYANRM 356          
BLAST of SMED30027186 vs. Ensembl Zebrafish
Match: lca5 (lebercilin LCA5 [Source:ZFIN;Acc:ZDB-GENE-090313-268])

HSP 1 Score: 70.0922 bits (170), Expect = 6.427e-12
Identity = 65/206 (31.55%), Postives = 124/206 (60.19%), Query Frame = 3
Query:  312 LEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++   +R+LSAR  KI +  N +SEL+   D+L  EN+ L+    RQ+KAL + +   S+I ++L +H  E   L+E+L+R+++      +  +E D++  + R+ + K  QL  ++NLGER  L  +L+ TQ +L+ SE  ++   K++E    S +R++ N R++    + + +  ++E++ +   LKEKE+ L+ +NIY++R+
Sbjct:  151 VDQVTKRMLSARLLKINELKNALSELRLHADELQRENRLLRQLQLRQEKALHRYNDTDSEISQLLARHNNETHVLRERLRRSQENQRTAERSLRERDAQLQRCRSQMQKLQQLADDQNLGEREELSRKLIGTQSRLQDSEHRVKELEKNMELSSGSFQRQLANERRKTHDAQQEVKALQEEVERLCTKLKEKERELDARNIYANRM 356          
BLAST of SMED30027186 vs. Ensembl Xenopus
Match: ENSXETT00000020390.1 (lebercilin-like [Source:NCBI gene;Acc:100497171])

HSP 1 Score: 73.9442 bits (180), Expect = 5.557e-13
Identity = 67/209 (32.06%), Postives = 126/209 (60.29%), Query Frame = 3
Query:  312 LEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRIKMP 938
            + +  +R+LSAR  KI +  N I ELQ +++    ENK LK   +RQ+KAL++ +  +S+I +++ +H  E   LKE L+++++   N  K+ KE++ E  +  +++ K  QL   ++LGER  L  +L  T+ KL+  E+ ++   K LE  + S +R++   +K+++  + + +   +EL  +   LKEKE+ L+++NIY++R+  P
Sbjct:   50 IALVTKRVLSARLLKINELRNEIRELQIKLEQHQKENKILKKLQFRQEKALNRFEDTESEISQLISRHNNETRALKEHLRKSQERERNTEKRLKEAEDELYRANSTVKKLKQLSENQHLGEREELAKKLDITETKLDEQERRVQDLEKKLEITQNSFQRQLMVEKKKIQNAQEENKMLLEELQKLTYKLKEKERELDVKNIYAYRLSKP 258          
BLAST of SMED30027186 vs. Ensembl Xenopus
Match: ENSXETT00000034181.1 (lebercilin-like [Source:NCBI gene;Acc:100497171])

HSP 1 Score: 73.559 bits (179), Expect = 6.156e-13
Identity = 67/209 (32.06%), Postives = 126/209 (60.29%), Query Frame = 3
Query:  312 LEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRIKMP 938
            + +  +R+LSAR  KI +  N I ELQ +++    ENK LK   +RQ+KAL++ +  +S+I +++ +H  E   LKE L+++++   N  K+ KE++ E  +  +++ K  QL   ++LGER  L  +L  T+ KL+  E+ ++   K LE  + S +R++   +K+++  + + +   +EL  +   LKEKE+ L+++NIY++R+  P
Sbjct:   47 IALVTKRVLSARLLKINELRNEIRELQIKLEQHQKENKILKKLQFRQEKALNRFEDTESEISQLISRHNNETRALKEHLRKSQERERNTEKRLKEAEDELYRANSTVKKLKQLSENQHLGEREELAKKLDITETKLDEQERRVQDLEKKLEITQNSFQRQLMVEKKKIQNAQEENKMLLEELQKLTYKLKEKERELDVKNIYAYRLSKP 255          
BLAST of SMED30027186 vs. Ensembl Xenopus
Match: ENSXETT00000020383.1 (lebercilin-like [Source:NCBI gene;Acc:100497171])

HSP 1 Score: 72.4034 bits (176), Expect = 9.475e-13
Identity = 67/209 (32.06%), Postives = 126/209 (60.29%), Query Frame = 3
Query:  312 LEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRIKMP 938
            + +  +R+LSAR  KI +  N I ELQ +++    ENK LK   +RQ+KAL++ +  +S+I +++ +H  E   LKE L+++++   N  K+ KE++ E  +  +++ K  QL   ++LGER  L  +L  T+ KL+  E+ ++   K LE  + S +R++   +K+++  + + +   +EL  +   LKEKE+ L+++NIY++R+  P
Sbjct:  106 IALVTKRVLSARLLKINELRNEIRELQIKLEQHQKENKILKKLQFRQEKALNRFEDTESEISQLISRHNNETRALKEHLRKSQERERNTEKRLKEAEDELYRANSTVKKLKQLSENQHLGEREELAKKLDITETKLDEQERRVQDLEKKLEITQNSFQRQLMVEKKKIQNAQEENKMLLEELQKLTYKLKEKERELDVKNIYAYRLSKP 314          
BLAST of SMED30027186 vs. Ensembl Xenopus
Match: atg4d (autophagy related 4D, cysteine peptidase [Source:Xenbase;Acc:XB-GENE-1016717])

HSP 1 Score: 72.7886 bits (177), Expect = 1.088e-12
Identity = 63/209 (30.14%), Postives = 127/209 (60.77%), Query Frame = 3
Query:  312 LEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRIKMP 938
            +++  +R+LSAR  KI +  N +++ Q ++ +L  ENK LK   +RQ+KAL+K +  +++I +++ +H  E+  L+++L+++++   N  K+ K+++ E  +  N+L K  QL   +NL ER  L  +L   + KL+  E+ ++   K+LE  + S +R++ + +K+    + + +  ++EL  +   LKEKE+ L  +NIY++R+  P
Sbjct:   33 IDLVTKRVLSARLLKINELRNELTDHQTKLKELQNENKILKRLQFRQEKALTKFEDTENEISQLISRHNNEIRTLRDRLRKSQERERNMEKRLKDAEEELYRTNNTLKKLKQLSENRNLAEREELTKKLDIMESKLDEKERRVKDLEKNLELTQSSFQRQLLSEKKKAHDAQEENKTFQEELQRLTQKLKEKERELHAKNIYAYRLSKP 241          
BLAST of SMED30027186 vs. Ensembl Xenopus
Match: atg4d (autophagy related 4D, cysteine peptidase [Source:Xenbase;Acc:XB-GENE-1016717])

HSP 1 Score: 72.7886 bits (177), Expect = 1.173e-12
Identity = 63/209 (30.14%), Postives = 127/209 (60.77%), Query Frame = 3
Query:  312 LEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRIKMP 938
            +++  +R+LSAR  KI +  N +++ Q ++ +L  ENK LK   +RQ+KAL+K +  +++I +++ +H  E+  L+++L+++++   N  K+ K+++ E  +  N+L K  QL   +NL ER  L  +L   + KL+  E+ ++   K+LE  + S +R++ + +K+    + + +  ++EL  +   LKEKE+ L  +NIY++R+  P
Sbjct:   78 IDLVTKRVLSARLLKINELRNELTDHQTKLKELQNENKILKRLQFRQEKALTKFEDTENEISQLISRHNNEIRTLRDRLRKSQERERNMEKRLKDAEEELYRTNNTLKKLKQLSENRNLAEREELTKKLDIMESKLDEKERRVKDLEKNLELTQSSFQRQLLSEKKKAHDAQEENKTFQEELQRLTQKLKEKERELHAKNIYAYRLSKP 286          
BLAST of SMED30027186 vs. Ensembl Mouse
Match: Lca5 (Leber congenital amaurosis 5 (human) [Source:MGI Symbol;Acc:MGI:1923032])

HSP 1 Score: 88.9669 bits (219), Expect = 9.946e-18
Identity = 73/219 (33.33%), Postives = 128/219 (58.45%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKR----------EIYN----LRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++  +R+LSAR  KI +  N +SELQ ++  LL ENK LKS  YRQ+KAL+K +  +++I +++ +H  E+T LKE+L+++++      K+ KE++ E  + + SL K  ++   ++L ER+ L  +LV  + KL+ +E+ ++  SK+LE    S +R          E Y+    L+K+L++   + +E EKELD              I+NIY++R+
Sbjct:  101 DIVTKRVLSARLLKINELQNEVSELQVKLAQLLKENKALKSLQYRQEKALNKFEDAENEISQLIHRHNNEITALKERLRKSQEKERATEKRVKETEGELFRTKFSLQKLKKISEARHLPERDDLAKKLVSAELKLDDTERKIKELSKNLELSTNSFQRQLLAERKRAFEAYDENKVLQKELQRLHHKLKEKEKELD--------------IKNIYANRL 305          
BLAST of SMED30027186 vs. Ensembl Mouse
Match: Lca5 (Leber congenital amaurosis 5 (human) [Source:MGI Symbol;Acc:MGI:1923032])

HSP 1 Score: 87.0409 bits (214), Expect = 1.278e-17
Identity = 73/219 (33.33%), Postives = 128/219 (58.45%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKR----------EIYN----LRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++  +R+LSAR  KI +  N +SELQ ++  LL ENK LKS  YRQ+KAL+K +  +++I +++ +H  E+T LKE+L+++++      K+ KE++ E  + + SL K  ++   ++L ER+ L  +LV  + KL+ +E+ ++  SK+LE    S +R          E Y+    L+K+L++   + +E EKELD              I+NIY++R+
Sbjct:  101 DIVTKRVLSARLLKINELQNEVSELQVKLAQLLKENKALKSLQYRQEKALNKFEDAENEISQLIHRHNNEITALKERLRKSQEKERATEKRVKETEGELFRTKFSLQKLKKISEARHLPERDDLAKKLVSAELKLDDTERKIKELSKNLELSTNSFQRQLLAERKRAFEAYDENKVLQKELQRLHHKLKEKEKELD--------------IKNIYANRL 305          
BLAST of SMED30027186 vs. Ensembl Mouse
Match: Lca5 (Leber congenital amaurosis 5 (human) [Source:MGI Symbol;Acc:MGI:1923032])

HSP 1 Score: 87.0409 bits (214), Expect = 1.497e-17
Identity = 73/219 (33.33%), Postives = 128/219 (58.45%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKR----------EIYN----LRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++  +R+LSAR  KI +  N +SELQ ++  LL ENK LKS  YRQ+KAL+K +  +++I +++ +H  E+T LKE+L+++++      K+ KE++ E  + + SL K  ++   ++L ER+ L  +LV  + KL+ +E+ ++  SK+LE    S +R          E Y+    L+K+L++   + +E EKELD              I+NIY++R+
Sbjct:  101 DIVTKRVLSARLLKINELQNEVSELQVKLAQLLKENKALKSLQYRQEKALNKFEDAENEISQLIHRHNNEITALKERLRKSQEKERATEKRVKETEGELFRTKFSLQKLKKISEARHLPERDDLAKKLVSAELKLDDTERKIKELSKNLELSTNSFQRQLLAERKRAFEAYDENKVLQKELQRLHHKLKEKEKELD--------------IKNIYANRL 305          
BLAST of SMED30027186 vs. Ensembl Mouse
Match: Lca5 (Leber congenital amaurosis 5 (human) [Source:MGI Symbol;Acc:MGI:1923032])

HSP 1 Score: 64.3142 bits (155), Expect = 2.188e-11
Identity = 34/76 (44.74%), Postives = 53/76 (69.74%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKE 542
            ++  +R+LSAR  KI +  N +SELQ ++  LL ENK LKS  YRQ+KAL+K +  +++I +++ +H  E+T LKE
Sbjct:  101 DIVTKRVLSARLLKINELQNEVSELQVKLAQLLKENKALKSLQYRQEKALNKFEDAENEISQLIHRHNNEITALKE 176          
BLAST of SMED30027186 vs. Ensembl Mouse
Match: Lca5l (Leber congenital amaurosis 5-like [Source:MGI Symbol;Acc:MGI:3041157])

HSP 1 Score: 68.1662 bits (165), Expect = 2.914e-11
Identity = 60/221 (27.15%), Postives = 115/221 (52.04%), Query Frame = 3
Query:  330 RILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEK-------SHKREIY--------------NLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            RILSAR HKI +  N ++++ ++++   +EN+ LK    R  KA+ K  + Q+++P+I  +HQ EV NL++ L+++++      ++ +E+D E L+ ++ L    +L  +KNL ER  L  +L +           +E   K ++NLEK       S+ R++                L+ +++Q + + +E ++EL+              I+NIY++RI
Sbjct:  142 RILSARLHKIKELKNELADVHRKLEASAIENQFLKQLQLRHLKAIGKYVNSQNNLPQITAKHQNEVKNLRQLLRKSQEKERAVSRKLRETDGELLRTKDVLQALQRLSEDKNLAEREELTDRLTD-------LTAKMEANDKKIQNLEKQLRLNNRSYSRQLAKENRKTLAAQTATKTLQAEVRQLQQKLKEKDRELE--------------IKNIYTNRI 341          
BLAST of SMED30027186 vs. UniProt/SwissProt
Match: sp|Q5U2Y9|LCA5_RAT (Lebercilin OS=Rattus norvegicus OX=10116 GN=Lca5 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.438e-17
Identity = 72/219 (32.88%), Postives = 129/219 (58.90%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYN--------------LRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++  +R+LSAR  KIT+  N +SELQ ++  LL ENK LKS  YRQ+KALSK +  +++I +++ +H  E+T LKE+L+++++      K+ K+++ E  + + SL K  ++   ++L ER+ L  +LV  + KL+++E+ ++  SK+LE    S +R++                L+K+L++   + +E EKELD              I+NIY++R+
Sbjct:  102 DIVTKRVLSARLLKITELQNEVSELQVKLAQLLKENKALKSLQYRQEKALSKFEDAENEISQLIHRHNGEITALKERLRKSQEKERMAEKRVKDTEGELFRTKFSLQKLKKISEARHLPERDDLAKKLVSAELKLDNTERKIKELSKNLELSTNSFQRQLLAERKRAFEAHDENKILQKELQRLHHKLKEKEKELD--------------IKNIYANRL 306          
BLAST of SMED30027186 vs. UniProt/SwissProt
Match: sp|Q80ST9|LCA5_MOUSE (Lebercilin OS=Mus musculus OX=10090 GN=Lca5 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 8.061e-17
Identity = 73/219 (33.33%), Postives = 128/219 (58.45%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKR----------EIYN----LRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++  +R+LSAR  KI +  N +SELQ ++  LL ENK LKS  YRQ+KAL+K +  +++I +++ +H  E+T LKE+L+++++      K+ KE++ E  + + SL K  ++   ++L ER+ L  +LV  + KL+ +E+ ++  SK+LE    S +R          E Y+    L+K+L++   + +E EKELD              I+NIY++R+
Sbjct:  101 DIVTKRVLSARLLKINELQNEVSELQVKLAQLLKENKALKSLQYRQEKALNKFEDAENEISQLIHRHNNEITALKERLRKSQEKERATEKRVKETEGELFRTKFSLQKLKKISEARHLPERDDLAKKLVSAELKLDDTERKIKELSKNLELSTNSFQRQLLAERKRAFEAYDENKVLQKELQRLHHKLKEKEKELD--------------IKNIYANRL 305          
BLAST of SMED30027186 vs. UniProt/SwissProt
Match: sp|Q86VQ0|LCA5_HUMAN (Lebercilin OS=Homo sapiens OX=9606 GN=LCA5 PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 5.845e-16
Identity = 73/205 (35.61%), Postives = 133/205 (64.88%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++  +RILSAR  KI +  N +SELQ ++ +LL ENK+LK   YRQ+KAL+K +  +++I +++ +H  E+T LKE+L+++++      K+ K+++SE  + + SL K  ++   ++L ER+ L  +LV  + KL+ +E+ ++  SK+LE    S +R++   RK+  +   + +  +KE+  +   LKEKE+ L+I+NIYS+R+
Sbjct:   98 DLVTKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQYRQEKALNKFEDAENEISQLIFRHNNEITALKERLRKSQEKERATEKRVKDTESELFRTKFSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELSTNSFQRQLLAERKRAYEAHDENKVLQKEVQRLYHKLKEKERELDIKNIYSNRL 302          
BLAST of SMED30027186 vs. UniProt/SwissProt
Match: sp|B0CM36|LCA5L_PAPAN (Lebercilin-like protein OS=Papio anubis OX=9555 GN=LCA5L PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.063e-13
Identity = 72/229 (31.44%), Postives = 131/229 (57.21%), Query Frame = 3
Query:  279 MMPQKRFTESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNIL--QLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRES----------EKELDLVKINXXXXXXXXXIQNIYSHRI 929
            M+ Q+R      +  A RILSAR HKI    N ++++  +++ +L EN+ LK    R  KA+ K ++ Q+++P+I+ +HQ EV NL++ L+++++      ++ +E+DS+ LK +++L    +L  +KNL ER  L  +L ++ T+         +E   K +++LEK  +    N R   +Q  ++ R++          + E+  ++  LKEK++ LEI+NIYSHRI
Sbjct:  131 MIAQRR------DAMAHRILSARLHKIKGLKNELADMHHKLEAILTENQFLKQLQLRHLKAIGKYENSQNNLPQIMAKHQNEVKNLRQLLRKSQEKERTVSRKLRETDSQLLKTKDTLQALQKLSEDKNLAEREELTHKLSIITTK---------MEANDKKIQSLEKQLR---LNSRAFSRQLAIETRKTLAAQTATKTLQVEVKHLQQKLKEKDRELEIKNIYSHRI 341          
BLAST of SMED30027186 vs. UniProt/SwissProt
Match: sp|Q4R3Q7|LCA5L_MACFA (Lebercilin-like protein OS=Macaca fascicularis OX=9541 GN=LCA5L PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 2.116e-13
Identity = 72/229 (31.44%), Postives = 131/229 (57.21%), Query Frame = 3
Query:  279 MMPQKRFTESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNIL--QLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRES----------EKELDLVKINXXXXXXXXXIQNIYSHRI 929
            M+ Q+R      +  A RILSAR HKI    N ++++  +++ +L EN+ LK    R  KA+ K ++ Q+++P+I+ +HQ EV NL++ L+++++      ++ +E+DS+ LK +++L    +L  +KNL ER  L  +L ++ T+         +E   K +++LEK  +    N R   +Q  ++ R++          + E+  ++  LKEK++ LEI+NIYSHRI
Sbjct:  131 MIAQRR------DAMAHRILSARLHKIKGLKNELADMHHKLEAILTENQFLKQLQLRHLKAIGKYENSQNNLPQIMAKHQNEVKNLRQLLRKSQEKERTVSRKLRETDSQLLKTKDTLQALQKLSEDKNLAEREELTHKLSIITTK---------MEANDKKIQSLEKQLR---LNSRVFSRQLAIETRKTLAAQTATKTLQVEVKHLQQKLKEKDRELEIKNIYSHRI 341          
BLAST of SMED30027186 vs. TrEMBL
Match: C3YX78 (Lebercilin domain-containing protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_225027 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.753e-17
Identity = 78/209 (37.32%), Postives = 138/209 (66.03%), Query Frame = 3
Query:  303 ESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            + Q +VT +RILSAR+ KI D  + I ELQ+++DDL  ENK LK+  ++Q+KAL++ + ++SD+P++L +H AEV NLKE+L+  +D  +   ++ K+   +  K  + ++K  +++ +KNL ER+ L  +L+ T++ L   EK +   +KHLE ++ S  R++   R + K+ + +    ++E + ++  LKEKEK L+I+NIYS+R+
Sbjct:   13 QGQGDVT-RRILSARRVKIKDLTSQIFELQRELDDLRRENKLLKTLQHKQEKALTRFEDQESDLPQLLARHSAEVRNLKERLRHKQDSNHRSEQKIKDLRDDLEKKEHQVSKLQKIVRDKNLAERDELNRKLMRTEQMLLDKEKKVTELNKHLELVQGSSTRQLNAERARHKETQDKLSSLQEEYERLQNKLKEKEKELDIRNIYSNRL 220          
BLAST of SMED30027186 vs. TrEMBL
Match: A0A1S3IZ48 (lebercilin isoform X5 OS=Lingula unguis OX=7574 GN=LOC106168658 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 5.225e-17
Identity = 80/223 (35.87%), Postives = 134/223 (60.09%), Query Frame = 3
Query:  327 QRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI-KMPHRIPGSGSDRHACSTCLG 992
            +R+LSARK KI++  N I ++ +QI DL +ENKTLK    +QD+ L + + ++SD+P++++ H  EV  L+EQ+K+ K+  +   K+ +E++ +  K +  L K   L  +K LGER+ L  +L + + +LE   K  +   KH+E L+K+ + E+     + K+ + Q  E     + +K + +EKEK LEI+NIYS+RI K PH++P S +   A     G
Sbjct:   44 RRVLSARKLKISEMRNEIEDMHQQIADLKLENKTLKRLQAKQDRELQRFEDKESDLPQLIKGHADEVRTLREQIKKLKEKSSRTEKKLREAEDDVTKTKKQLKKLEDLSHDKKLGERDDLNRKLAKAENELEEKTKRCQDLEKHVEILKKAQRHEVAVEINKHKETQKQLLEMRDMYERLKESYREKEKELEIKNIYSNRIVKPPHKLPSSETSPLASPPSGG 266          
BLAST of SMED30027186 vs. TrEMBL
Match: A0A1S3IYH8 (lebercilin isoform X4 OS=Lingula unguis OX=7574 GN=LOC106168658 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 5.262e-17
Identity = 78/211 (36.97%), Postives = 131/211 (62.09%), Query Frame = 3
Query:  327 QRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI-KMPHRIPGS 956
            +R+LSARK KI++  N I ++ +QI DL +ENKTLK    +QD+ L + + ++SD+P++++ H  EV  L+EQ+K+ K+  +   K+ +E++ +  K +  L K   L  +K LGER+ L  +L + + +LE   K  +   KH+E L+K+ + E+     + K+ + Q  E     + +K + +EKEK LEI+NIYS+RI K PH++P S
Sbjct:  108 RRVLSARKLKISEMRNEIEDMHQQIADLKLENKTLKRLQAKQDRELQRFEDKESDLPQLIKGHADEVRTLREQIKKLKEKSSRTEKKLREAEDDVTKTKKQLKKLEDLSHDKKLGERDDLNRKLAKAENELEEKTKRCQDLEKHVEILKKAQRHEVAVEINKHKETQKQLLEMRDMYERLKESYREKEKELEIKNIYSNRIVKPPHKLPSS 318          
BLAST of SMED30027186 vs. TrEMBL
Match: A0A1S3J0C6 (lebercilin isoform X3 OS=Lingula unguis OX=7574 GN=LOC106168658 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 6.043e-17
Identity = 78/211 (36.97%), Postives = 131/211 (62.09%), Query Frame = 3
Query:  327 QRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI-KMPHRIPGS 956
            +R+LSARK KI++  N I ++ +QI DL +ENKTLK    +QD+ L + + ++SD+P++++ H  EV  L+EQ+K+ K+  +   K+ +E++ +  K +  L K   L  +K LGER+ L  +L + + +LE   K  +   KH+E L+K+ + E+     + K+ + Q  E     + +K + +EKEK LEI+NIYS+RI K PH++P S
Sbjct:  123 RRVLSARKLKISEMRNEIEDMHQQIADLKLENKTLKRLQAKQDRELQRFEDKESDLPQLIKGHADEVRTLREQIKKLKEKSSRTEKKLREAEDDVTKTKKQLKKLEDLSHDKKLGERDDLNRKLAKAENELEEKTKRCQDLEKHVEILKKAQRHEVAVEINKHKETQKQLLEMRDMYERLKESYREKEKELEIKNIYSNRIVKPPHKLPSS 333          
BLAST of SMED30027186 vs. TrEMBL
Match: A0A1S3IZ43 (lebercilin isoform X2 OS=Lingula unguis OX=7574 GN=LOC106168658 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 6.190e-17
Identity = 78/211 (36.97%), Postives = 131/211 (62.09%), Query Frame = 3
Query:  327 QRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI-KMPHRIPGS 956
            +R+LSARK KI++  N I ++ +QI DL +ENKTLK    +QD+ L + + ++SD+P++++ H  EV  L+EQ+K+ K+  +   K+ +E++ +  K +  L K   L  +K LGER+ L  +L + + +LE   K  +   KH+E L+K+ + E+     + K+ + Q  E     + +K + +EKEK LEI+NIYS+RI K PH++P S
Sbjct:  123 RRVLSARKLKISEMRNEIEDMHQQIADLKLENKTLKRLQAKQDRELQRFEDKESDLPQLIKGHADEVRTLREQIKKLKEKSSRTEKKLREAEDDVTKTKKQLKKLEDLSHDKKLGERDDLNRKLAKAENELEEKTKRCQDLEKHVEILKKAQRHEVAVEINKHKETQKQLLEMRDMYERLKESYREKEKELEIKNIYSNRIVKPPHKLPSS 333          
BLAST of SMED30027186 vs. Ensembl Cavefish
Match: lca5 (lebercilin LCA5 [Source:NCBI gene;Acc:103033771])

HSP 1 Score: 78.1814 bits (191), Expect = 1.736e-14
Identity = 67/209 (32.06%), Postives = 124/209 (59.33%), Query Frame = 3
Query:  312 LEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQY--EVQC-RESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            L++  +R+LSAR  KI++  N +SEL+   D+L  EN+ L+    R +KAL K    +S+I +++ +H  E   L+E+L+R+++      +  +E+D++  + R+ L K  QL  ++NLGER+ L  +L   Q + + S++ ++   K+LE  + S +R++   R++      E+Q  RE  ++L  +   LK KE+ L+ +NIY++RI
Sbjct:  162 LDLVTKRLLSARLLKISELKNALSELRTHADELQRENRLLRQLQLRHEKALHKYSDTESEISQLISRHNNETHVLRERLRRSQERERTAERSYREADAQLQRCRSQLQKLQQLADDQNLGERDELSRKLTHAQARAQESDRRVKELEKNLELSKGSFQRQLAGERRKTHDAMQEIQALREETEKLSAI---LKGKERELDARNIYANRI 367          
BLAST of SMED30027186 vs. Ensembl Cavefish
Match: lca5 (lebercilin LCA5 [Source:NCBI gene;Acc:103033771])

HSP 1 Score: 78.1814 bits (191), Expect = 1.736e-14
Identity = 67/209 (32.06%), Postives = 124/209 (59.33%), Query Frame = 3
Query:  312 LEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQY--EVQC-RESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            L++  +R+LSAR  KI++  N +SEL+   D+L  EN+ L+    R +KAL K    +S+I +++ +H  E   L+E+L+R+++      +  +E+D++  + R+ L K  QL  ++NLGER+ L  +L   Q + + S++ ++   K+LE  + S +R++   R++      E+Q  RE  ++L  +   LK KE+ L+ +NIY++RI
Sbjct:  162 LDLVTKRLLSARLLKISELKNALSELRTHADELQRENRLLRQLQLRHEKALHKYSDTESEISQLISRHNNETHVLRERLRRSQERERTAERSYREADAQLQRCRSQLQKLQQLADDQNLGERDELSRKLTHAQARAQESDRRVKELEKNLELSKGSFQRQLAGERRKTHDAMQEIQALREETEKLSAI---LKGKERELDARNIYANRI 367          
BLAST of SMED30027186 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010615.1 (pep scaffold:Pmarinus_7.0:GL477304:118413:123523:-1 gene:ENSPMAG00000009611.1 transcript:ENSPMAT00000010615.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.485e-16
Identity = 59/205 (28.78%), Postives = 123/205 (60.00%), Query Frame = 3
Query:  315 EVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRI 929
            ++ ++R+ SAR H      N +SEL+ ++D+   EN+ LK   +RQ+KAL++ +S++ D+P++L +H AE   L+E L+R ++   +  ++ + +  E    R  L +  +L  ++ LGER  L   L   + +L+ SE+ ++   K+L+    S++R++   R++ ++ + Q    ++E++ +   LK+KE+ L+++NIY+ R+
Sbjct:    2 DLVSRRVHSARVHAAVTLRNEVSELEARLDEATRENRALKQLQHRQEKALARFESQEGDLPQLLARHAAETRALREGLRRAREAERDAARRLRAAQDELATTREGLQRLQRLSEQRGLGEREELARSLARAETRLDESERRVKDLEKNLDLTTNSYQRQLAAERRKTQEAQAQVTALQEEIERLTQKLKDKERELDVKNIYASRL 206          
BLAST of SMED30027186 vs. Ensembl Nematostella
Match: EDO32244 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL7])

HSP 1 Score: 77.0258 bits (188), Expect = 2.096e-16
Identity = 49/127 (38.58%), Postives = 77/127 (60.63%), Query Frame = 3
Query:  309 QLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTK-DLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNIL 686
            Q+    QR LSA + ++T  +N + ELQ+++DDL  EN+ LK    RQ++ L  +D  ++ +P +L++H AE+  L+E+LKR K DL+  E K+  + D+E   LR+ L+   QL   K L ER  L
Sbjct:   11 QVSTVVQRALSANRKRVTKLHNTVEELQQEVDDLRKENRMLKKVNMRQERDLRHVDQEEAALPMLLQRHSAEMRTLRERLKRNKQDLIRKE-KEAHDHDAEINILRDKLSHFKQLANNKKLEEREKL 136          
BLAST of SMED30027186 vs. Ensembl Medaka
Match: lca5 (lebercilin LCA5 [Source:NCBI gene;Acc:101164200])

HSP 1 Score: 81.2629 bits (199), Expect = 2.006e-15
Identity = 73/249 (29.32%), Postives = 141/249 (56.63%), Query Frame = 3
Query:  312 LEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRIKMP----------HRIPGSGSDRHACSTCLGVTNDQLLDKLNF 1028
            L++  +R+LSAR  KI +  N ++ELQ++++DL  EN+ LK    RQ+KAL   D  +S+I  +L +H  E+  L+E+L+RT++   +  ++ K+++ +  K R ++ +  +L+ ++ LG R+ L  +L E + + + +++ ++   ++LE    S +R+I + +K+    + + R  ++EL  +   LKEKE+ L+ +NIY++R+              +IP SGS +       GV  D     L+F
Sbjct:  169 LDLVTKRMLSARLLKINELRNALTELQQRMEDLKKENRVLKQLQVRQEKALRHYDDTESEISLLLSRHSNEIHVLRERLRRTQERERSSEQRLKDAEEQLQKSRATIARLKKLVDQRELGTRDELSRRLDEEKIRTQEAQQKIKDLERNLELTNSSFQRQIVSEKKKTVCAQEEVRTLQEELQRLTNKLKEKERDLDAKNIYANRLAKASKKDSDGGTKRKIPSSGSTK-------GVQTDDRSSSLDF 410          
BLAST of SMED30027186 vs. Ensembl Medaka
Match: lca5 (lebercilin LCA5 [Source:NCBI gene;Acc:101164200])

HSP 1 Score: 81.2629 bits (199), Expect = 2.006e-15
Identity = 73/249 (29.32%), Postives = 141/249 (56.63%), Query Frame = 3
Query:  312 LEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRIKMP----------HRIPGSGSDRHACSTCLGVTNDQLLDKLNF 1028
            L++  +R+LSAR  KI +  N ++ELQ++++DL  EN+ LK    RQ+KAL   D  +S+I  +L +H  E+  L+E+L+RT++   +  ++ K+++ +  K R ++ +  +L+ ++ LG R+ L  +L E + + + +++ ++   ++LE    S +R+I + +K+    + + R  ++EL  +   LKEKE+ L+ +NIY++R+              +IP SGS +       GV  D     L+F
Sbjct:  169 LDLVTKRMLSARLLKINELRNALTELQQRMEDLKKENRVLKQLQVRQEKALRHYDDTESEISLLLSRHSNEIHVLRERLRRTQERERSSEQRLKDAEEQLQKSRATIARLKKLVDQRELGTRDELSRRLDEEKIRTQEAQQKIKDLERNLELTNSSFQRQIVSEKKKTVCAQEEVRTLQEELQRLTNKLKEKERDLDAKNIYANRLAKASKKDSDGGTKRKIPSSGSTK-------GVQTDDRSSSLDF 410          
BLAST of SMED30027186 vs. Planmine SMEST
Match: SMESG000022949.1 (SMESG000022949.1)

HSP 1 Score: 1147.5 bits (2967), Expect = 0.000e+0
Identity = 638/639 (99.84%), Postives = 639/639 (100.00%), Query Frame = 3
Query:   84 MSDYTQGNXXXXXXXXXXXXXNHKNIGSRKATSSQPIPRKTEHIYRNFKQVSGTAKXXXXXXXXKMMPQKRFTESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRIKMPHRIPGSGSDRHACSTCLGVTNDQLLDKLNFNNLNGKSNPNKIXXXXXXXXXXXXXRYLDPEKIKDDIRRILEEEILSGRIKPIESQMNYQSPVLPRDNIQQEREPSPELALSTHDSFNTGRAVESEIFDKEPQTQIESVNDGVENLKEDLEKFDRDQKQKQILLSKLSAIDQXXXXXXXXXXXXKADLKYSYPNDKDFVENDLSINEIETIPAIDIKKPTKTSYKFNETIENLHQGIPVNVNNSDVNFRRRTSDSKRMPTSAKSEAVQRQIEASMSQKNNSNLDQAADEVLPPLTESERLNKERNLMSELFGETQTNGTFKSRKVNLLWDQGELVDRFSHTNPTNISSRDFNKS 2000
            MSDYTQGNSFYESDSFESDSENHKNIGSRKATSSQPIPRKTEHIYRNFKQVSGTAKNRQRNNNRKMMPQKRFTESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQEKLESSEKSLEVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINLKEKEKLLEIQNIYSHRIKMPHRIPGSGSDRHACSTCLGVTNDQLLDKLNFNNLNGKSNPNKINYSSNQSDVSSNSRYLDPEKIKDDIRRILEEEILSGRIKPIESQMNYQSPVLPRDNIQQEREPSPELALSTHDSFNTGRAVESEIFDKEPQTQIESVNDGVENLKEDLEKFDRDQKQKQILLSKLSAIDQS+STLTSIESTEKADLKYSYPNDKDFVENDLSINEIETIPAIDIKKPTKTSYKFNETIENLHQGIPVNVNNSDVNFRRRTSDSKRMPTSAKSEAVQRQIEASMSQKNNSNLDQAADEVLPPLTESERLNKERNLMSELFGETQTNGTFKSRKVNLLWDQGELVDRFSHTNPTNISSRDFNKS
Sbjct:    1 MSDYTQGNSFYESDSFESDSENHKNIGSRKATSSQPIPRKTEHIYRNFKQVSGTAKNRQRNNNRKMMPQKRFTESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQEKLESSEKSLEVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINLKEKEKLLEIQNIYSHRIKMPHRIPGSGSDRHACSTCLGVTNDQLLDKLNFNNLNGKSNPNKINYSSNQSDVSSNSRYLDPEKIKDDIRRILEEEILSGRIKPIESQMNYQSPVLPRDNIQQEREPSPELALSTHDSFNTGRAVESEIFDKEPQTQIESVNDGVENLKEDLEKFDRDQKQKQILLSKLSAIDQSKSTLTSIESTEKADLKYSYPNDKDFVENDLSINEIETIPAIDIKKPTKTSYKFNETIENLHQGIPVNVNNSDVNFRRRTSDSKRMPTSAKSEAVQRQIEASMSQKNNSNLDQAADEVLPPLTESERLNKERNLMSELFGETQTNGTFKSRKVNLLWDQGELVDRFSHTNPTNISSRDFNKS 639          
BLAST of SMED30027186 vs. Planmine SMEST
Match: SMESG000022949.1 (SMESG000022949.1)

HSP 1 Score: 1127.46 bits (2915), Expect = 0.000e+0
Identity = 638/675 (94.52%), Postives = 639/675 (94.67%), Query Frame = 3
Query:   84 MSDYTQGNXXXXXXXXXXXXXNHKNIGSRKATSSQPIPRKTEHIYR------------------------------------NFKQVSGTAKXXXXXXXXKMMPQKRFTESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRIKMPHRIPGSGSDRHACSTCLGVTNDQLLDKLNFNNLNGKSNPNKIXXXXXXXXXXXXXRYLDPEKIKDDIRRILEEEILSGRIKPIESQMNYQSPVLPRDNIQQEREPSPELALSTHDSFNTGRAVESEIFDKEPQTQIESVNDGVENLKEDLEKFDRDQKQKQILLSKLSAIDQXXXXXXXXXXXXKADLKYSYPNDKDFVENDLSINEIETIPAIDIKKPTKTSYKFNETIENLHQGIPVNVNNSDVNFRRRTSDSKRMPTSAKSEAVQRQIEASMSQKNNSNLDQAADEVLPPLTESERLNKERNLMSELFGETQTNGTFKSRKVNLLWDQGELVDRFSHTNPTNISSRDFNKS 2000
            MSDYTQGNSFYESDSFESDSENHKNIGSRKATSSQPIPRKTEHIYR                                    NFKQVSGTAKNRQRNNNRKMMPQKRFTESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQEKLESSEKSLEVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINLKEKEKLLEIQNIYSHRIKMPHRIPGSGSDRHACSTCLGVTNDQLLDKLNFNNLNGKSNPNKINYSSNQSDVSSNSRYLDPEKIKDDIRRILEEEILSGRIKPIESQMNYQSPVLPRDNIQQEREPSPELALSTHDSFNTGRAVESEIFDKEPQTQIESVNDGVENLKEDLEKFDRDQKQKQILLSKLSAIDQS+STLTSIESTEKADLKYSYPNDKDFVENDLSINEIETIPAIDIKKPTKTSYKFNETIENLHQGIPVNVNNSDVNFRRRTSDSKRMPTSAKSEAVQRQIEASMSQKNNSNLDQAADEVLPPLTESERLNKERNLMSELFGETQTNGTFKSRKVNLLWDQGELVDRFSHTNPTNISSRDFNKS
Sbjct:    1 MSDYTQGNSFYESDSFESDSENHKNIGSRKATSSQPIPRKTEHIYRKKFHDLCLSIGMKIFRSGKSFSRDFSIQSYGINLFRNFKQVSGTAKNRQRNNNRKMMPQKRFTESQLEVTAQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQEKLESSEKSLEVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINLKEKEKLLEIQNIYSHRIKMPHRIPGSGSDRHACSTCLGVTNDQLLDKLNFNNLNGKSNPNKINYSSNQSDVSSNSRYLDPEKIKDDIRRILEEEILSGRIKPIESQMNYQSPVLPRDNIQQEREPSPELALSTHDSFNTGRAVESEIFDKEPQTQIESVNDGVENLKEDLEKFDRDQKQKQILLSKLSAIDQSKSTLTSIESTEKADLKYSYPNDKDFVENDLSINEIETIPAIDIKKPTKTSYKFNETIENLHQGIPVNVNNSDVNFRRRTSDSKRMPTSAKSEAVQRQIEASMSQKNNSNLDQAADEVLPPLTESERLNKERNLMSELFGETQTNGTFKSRKVNLLWDQGELVDRFSHTNPTNISSRDFNKS 675          
BLAST of SMED30027186 vs. Planmine SMEST
Match: SMESG000031296.1 (SMESG000031296.1)

HSP 1 Score: 110.538 bits (275), Expect = 5.791e-25
Identity = 99/317 (31.23%), Postives = 182/317 (57.41%), Query Frame = 3
Query:  324 AQRILSARKHKITDQNNLISELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHRIKMPHRIPGSGSDRHACSTCL-----------GVTNDQLLDKLN-FNNLNGKSNPNKIXXXXXXXXXXXXXRYLDPEKIKDDIRRILEEEILSGRIKPIESQMNYQS-----PVLP 1223
            +Q+I+SA+  ++  Q N I  L+ Q++ +  EN+TL++Q ++Q++ L +ID++  +I K++EQH+AE+   K+Q+++ K  + +E   RKE+++E++ L+ +L K+ ++I  K L ++  L+ QL E  E L  ++  L+ T   L+ L+ ++K E+ N +KQ K Y  +C E E +++ + + L+EKEKLLEIQNIYS+R+    ++     +   CS C              T  + L  +N  +N   K+  ++     ++ D    +RY    KI +DIR+I+ EEI  G +  I + +N  +     P++P
Sbjct:   60 SQQIISAKLLRLPMQKNEIQNLKGQLEIITSENRTLRTQNFKQERELIQIDNQDLNITKLIEQHEAEIQIFKDQIRKAKTTITHEQSLRKEAENESINLKTALNKSKEIISNKGLIDKAELRRQLDEALENLSYTKNLLQKTQSKLDYLDGNYKVELLNCKKQSKSYLEKCEELESKINFLNVALREKEKLLEIQNIYSNRLN-KTKLTRKCENAAPCSNCTIRNKEKNLKSKSRTETKFLSCINKCDNFIKKNECSQQIVFHDKKDPVEFNRY----KILEDIRKIISEEIKLGNLTIIYNPVNSSNDQLLIPMIP 371          
BLAST of SMED30027186 vs. Planmine SMEST
Match: SMESG000004781.1 (SMESG000004781.1)

HSP 1 Score: 62.003 bits (149), Expect = 1.043e-9
Identity = 71/215 (33.02%), Postives = 127/215 (59.07%), Query Frame = 3
Query:  321 TAQRILSARKHKITDQNNLISE---LQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTNLKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNILQLQLVETQXXXXXXXXXXXVTSKHLENLEKSHKREIYNLRKQLKQYEVQCRESEKELDLVKINXXXXXXXXXIQNIYSHR-IKMPHRIPG 953
            + Q++L A + +I   N LISE   L++Q+ +   E KT+++Q   Q++ L+K++SR SD+P I+ ++ +E+ +L+EQL+R K+ L+   +Q+ + D E +K +  + K   L+ ++ L ER  L  ++    E LE+  K      + +E L K +  ++     + K+ +    E+  EL  ++ +LKEK KLLE+QNIYS R ++ PHR+ G
Sbjct:  105 STQKLLEASQLEI---NELISENADLRRQLLESSNELKTVQNQNKIQERYLNKVNSRDSDVPTIISRYNSELHSLQEQLRRKKEKLDTVERQKTDLDFELVKAKKKIEKLKALVADRQLQEREDLSKKIANLNESLEAEIKKNSDLERSMELLTKKYSYQMALETNKFKELKQSYTETLMELKNIRSSLKEKNKLLEMQNIYSKRVVRAPHRLSG 316          
The following BLAST results are available for this feature:
BLAST of SMED30027186 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LCA51.217e-1635.61lebercilin LCA5 [Source:HGNC Symbol;Acc:HGNC:31923... [more]
LCA51.217e-1635.61lebercilin LCA5 [Source:HGNC Symbol;Acc:HGNC:31923... [more]
LCA51.682e-1633.79lebercilin LCA5 [Source:HGNC Symbol;Acc:HGNC:31923... [more]
LCA5L4.495e-1431.00lebercilin LCA5 like [Source:HGNC Symbol;Acc:HGNC:... [more]
LCA5L4.495e-1431.00lebercilin LCA5 like [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of SMED30027186 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027186 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027186 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lca51.603e-1231.40lebercilin LCA5 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
lca54.798e-1231.40lebercilin LCA5 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
lca56.427e-1231.55lebercilin LCA5 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
back to top
BLAST of SMED30027186 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000020390.15.557e-1332.06lebercilin-like [Source:NCBI gene;Acc:100497171][more]
ENSXETT00000034181.16.156e-1332.06lebercilin-like [Source:NCBI gene;Acc:100497171][more]
ENSXETT00000020383.19.475e-1332.06lebercilin-like [Source:NCBI gene;Acc:100497171][more]
atg4d1.088e-1230.14autophagy related 4D, cysteine peptidase [Source:X... [more]
atg4d1.173e-1230.14autophagy related 4D, cysteine peptidase [Source:X... [more]
back to top
BLAST of SMED30027186 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lca59.946e-1833.33Leber congenital amaurosis 5 (human) [Source:MGI S... [more]
Lca51.278e-1733.33Leber congenital amaurosis 5 (human) [Source:MGI S... [more]
Lca51.497e-1733.33Leber congenital amaurosis 5 (human) [Source:MGI S... [more]
Lca52.188e-1144.74Leber congenital amaurosis 5 (human) [Source:MGI S... [more]
Lca5l2.914e-1127.15Leber congenital amaurosis 5-like [Source:MGI Symb... [more]
back to top
BLAST of SMED30027186 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5U2Y9|LCA5_RAT1.438e-1732.88Lebercilin OS=Rattus norvegicus OX=10116 GN=Lca5 P... [more]
sp|Q80ST9|LCA5_MOUSE8.061e-1733.33Lebercilin OS=Mus musculus OX=10090 GN=Lca5 PE=1 S... [more]
sp|Q86VQ0|LCA5_HUMAN5.845e-1635.61Lebercilin OS=Homo sapiens OX=9606 GN=LCA5 PE=1 SV... [more]
sp|B0CM36|LCA5L_PAPAN1.063e-1331.44Lebercilin-like protein OS=Papio anubis OX=9555 GN... [more]
sp|Q4R3Q7|LCA5L_MACFA2.116e-1331.44Lebercilin-like protein OS=Macaca fascicularis OX=... [more]
back to top
BLAST of SMED30027186 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3YX782.753e-1737.32Lebercilin domain-containing protein (Fragment) OS... [more]
A0A1S3IZ485.225e-1735.87lebercilin isoform X5 OS=Lingula unguis OX=7574 GN... [more]
A0A1S3IYH85.262e-1736.97lebercilin isoform X4 OS=Lingula unguis OX=7574 GN... [more]
A0A1S3J0C66.043e-1736.97lebercilin isoform X3 OS=Lingula unguis OX=7574 GN... [more]
A0A1S3IZ436.190e-1736.97lebercilin isoform X2 OS=Lingula unguis OX=7574 GN... [more]
back to top
BLAST of SMED30027186 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lca51.736e-1432.06lebercilin LCA5 [Source:NCBI gene;Acc:103033771][more]
lca51.736e-1432.06lebercilin LCA5 [Source:NCBI gene;Acc:103033771][more]
back to top
BLAST of SMED30027186 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010615.12.485e-1628.78pep scaffold:Pmarinus_7.0:GL477304:118413:123523:-... [more]
back to top
BLAST of SMED30027186 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027186 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO322442.096e-1638.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027186 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lca52.006e-1529.32lebercilin LCA5 [Source:NCBI gene;Acc:101164200][more]
lca52.006e-1529.32lebercilin LCA5 [Source:NCBI gene;Acc:101164200][more]
back to top
BLAST of SMED30027186 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000022949.10.000e+099.84SMESG000022949.1[more]
SMESG000022949.10.000e+094.52SMESG000022949.1[more]
SMESG000031296.15.791e-2531.23SMESG000031296.1[more]
SMESG000004781.11.043e-933.02SMESG000004781.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027186 ID=SMED30027186|Name=SMED30027186|organism=Schmidtea mediterranea sexual|type=transcript|length=2232bp
AAGTTTCGTGTTGCAAGCAGTATCCAACAATATTTTAAATCAACTATTTT
GTGGATAAATTGTAGTCGACTCAAGTAATTTAGATGTCTGATTATACCCA
AGGAAATAGTTTCTATGAATCAGATTCATTTGAATCTGATTCAGAAAATC
ACAAAAATATTGGTTCCAGAAAAGCTACAAGTTCACAACCGATTCCAAGG
AAGACAGAACATATCTATAGAAATTTCAAACAGGTTTCAGGCACGGCTAA
AAATCGTCAAAGAAACAATAATCGGAAAATGATGCCCCAAAAACGTTTCA
CAGAGTCACAATTAGAAGTGACGGCTCAGAGAATTCTTTCAGCCCGAAAA
CACAAAATTACTGACCAGAACAACTTGATTTCTGAATTGCAGAAACAAAT
TGACGATCTACTAGTGGAAAATAAAACATTAAAATCCCAGACATATCGGC
AAGATAAAGCATTGTCTAAGATTGACAGTAGACAATCTGATATACCGAAA
ATACTCGAGCAACACCAAGCCGAAGTAACCAATTTAAAGGAGCAATTAAA
ACGAACCAAAGATTTGTTAAATAATGAAATGAAGCAAAGAAAAGAATCTG
ACAGTGAAGCCCTAAAATTACGCAACTCTCTAACGAAAGCTAATCAGTTG
ATATTTGAAAAGAATCTCGGTGAACGAAACATTTTACAATTACAATTAGT
TGAGACTCAAGAAAAATTAGAAAGTAGCGAGAAATCCCTTGAGGTAACAA
GCAAGCATTTGGAGAATTTGGAAAAGTCCCACAAACGAGAAATATATAAC
TTGAGAAAGCAACTTAAACAATACGAAGTCCAATGTCGGGAATCGGAAAA
AGAGCTTGATTTAGTCAAAATCAATCTGAAGGAAAAAGAAAAGCTCCTTG
AAATCCAGAATATTTATAGCCATCGGATCAAAATGCCTCATAGGATACCC
GGATCGGGCAGTGATCGTCACGCTTGCTCAACATGCTTAGGCGTTACAAA
TGATCAGCTGCTTGATAAACTGAATTTCAATAATTTGAATGGAAAATCTA
ATCCAAACAAGATAAATTACTCTTCCAATCAAAGTGATGTTTCTAGCAAT
TCAAGGTATCTTGATCCAGAGAAAATTAAAGATGATATTCGAAGAATTCT
GGAAGAAGAAATTCTATCTGGCCGGATAAAGCCTATCGAATCACAAATGA
ATTATCAATCACCCGTGCTACCAAGGGATAATATACAACAGGAACGAGAG
CCCTCTCCTGAACTAGCACTATCAACTCATGACTCTTTTAATACTGGGCG
AGCAGTGGAATCGGAAATATTCGACAAAGAACCCCAAACTCAAATAGAAT
CTGTCAATGACGGGGTTGAAAATCTCAAGGAGGACTTGGAGAAATTCGAT
CGAGACCAGAAACAAAAGCAAATTCTATTGAGTAAATTAAGCGCGATTGA
CCAAAGCGAATCAACATTAACCAGCATTGAATCGACAGAGAAAGCCGACC
TGAAATATTCCTATCCAAACGACAAAGATTTCGTTGAAAATGATTTATCA
ATTAATGAAATCGAAACCATTCCAGCCATCGATATAAAAAAGCCGACCAA
AACCAGCTACAAATTCAATGAAACTATAGAGAATTTGCACCAGGGAATCC
CTGTCAACGTCAACAATTCCGATGTGAATTTCCGGCGTCGCACATCTGAC
TCGAAACGGATGCCGACATCAGCAAAATCCGAAGCCGTCCAAAGGCAAAT
CGAAGCTTCAATGAGTCAGAAAAACAATAGCAATCTTGATCAAGCGGCCG
ATGAGGTTTTACCGCCTCTCACTGAATCGGAACGTTTGAATAAAGAACGA
AACTTGATGTCGGAATTGTTCGGAGAAACTCAAACCAACGGCACCTTTAA
ATCTCGAAAGGTAAACTTGCTCTGGGATCAAGGAGAACTTGTTGATAGAT
TTTCTCATACAAATCCAACGAATATTTCATCGAGAGATTTCAATAAATCA
GAAGATCTCGAAGAGATTTTGCTATAAGAATTAGTTTTTACTTGAAAATG
TTGCCGAATTCATTATTTGTTGCAATTAGTCCTTTCTTGACCAATAAATA
TCAAGCGCTGTGGAAATTAATTTAGTAGACGTTCTAGTGATGATTGTGAT
GTACAAAACATTATAAAAATGATGTCTTAATTACAATTTTAAGTCTTTCA
ATAACCAATATAAGAAGTGCATTGTGTTGTTG
back to top

protein sequence of SMED30027186-orf-1

>SMED30027186-orf-1 ID=SMED30027186-orf-1|Name=SMED30027186-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=648bp
MSDYTQGNSFYESDSFESDSENHKNIGSRKATSSQPIPRKTEHIYRNFKQ
VSGTAKNRQRNNNRKMMPQKRFTESQLEVTAQRILSARKHKITDQNNLIS
ELQKQIDDLLVENKTLKSQTYRQDKALSKIDSRQSDIPKILEQHQAEVTN
LKEQLKRTKDLLNNEMKQRKESDSEALKLRNSLTKANQLIFEKNLGERNI
LQLQLVETQEKLESSEKSLEVTSKHLENLEKSHKREIYNLRKQLKQYEVQ
CRESEKELDLVKINLKEKEKLLEIQNIYSHRIKMPHRIPGSGSDRHACST
CLGVTNDQLLDKLNFNNLNGKSNPNKINYSSNQSDVSSNSRYLDPEKIKD
DIRRILEEEILSGRIKPIESQMNYQSPVLPRDNIQQEREPSPELALSTHD
SFNTGRAVESEIFDKEPQTQIESVNDGVENLKEDLEKFDRDQKQKQILLS
KLSAIDQSESTLTSIESTEKADLKYSYPNDKDFVENDLSINEIETIPAID
IKKPTKTSYKFNETIENLHQGIPVNVNNSDVNFRRRTSDSKRMPTSAKSE
AVQRQIEASMSQKNNSNLDQAADEVLPPLTESERLNKERNLMSELFGETQ
TNGTFKSRKVNLLWDQGELVDRFSHTNPTNISSRDFNKSEDLEEILL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026188Lebercilin-like
IPR028933Lebercilin_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015031protein transport
Vocabulary: molecular function
TermDefinition
GO:0032403protein complex binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 198..271
NoneNo IPR availableCOILSCoilCoilcoord: 92..119
NoneNo IPR availableCOILSCoilCoilcoord: 421..448
NoneNo IPR availableCOILSCoilCoilcoord: 141..172
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..73
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 382..401
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..73
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..15
IPR028933Lebercilin domainPFAMPF15619Lebercilincoord: 81..271
e-value: 5.3E-38
score: 130.6
IPR026188Lebercilin-likePANTHERPTHR16650C21ORF13-RELATEDcoord: 7..620