Multidrug resistance-associated protein 1

Overview
NameMultidrug resistance-associated protein 1
Smed IDSMED30027178
Length (bp)5109
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multidrug resistance-associated protein 1 (SMED30027178) t-SNE clustered cells

Violin plots show distribution of expression levels for Multidrug resistance-associated protein 1 (SMED30027178) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multidrug resistance-associated protein 1 (SMED30027178) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multidrug resistance-associated protein 1 (SMED30027178) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027178

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30027178SMESG000000275.1 SMESG000000273.1 SMESG000000262.1 SMESG000000250.1 SMESG000000247.1 SMESG000000245.1 dd_Smed_v4_9208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027178SMESG000000275.1 SMESG000000273.1 SMESG000000262.1 SMESG000000250.1 SMESG000000247.1 SMESG000000245.1 dd_Smed_v4_9208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30027178SMESG000000275.1 SMESG000000273.1 SMESG000000262.1 SMESG000000250.1 SMESG000000247.1 SMESG000000245.1 SMED30027178smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
enteric muscle cellSMED30027178SMESG000000275.1 SMESG000000273.1 SMESG000000262.1 SMESG000000250.1 SMESG000000247.1 SMESG000000245.1 dd_Smed_v4_9208_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC2 (ATP binding cassette subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:53])

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 576/1444 (39.89%), Postives = 871/1444 (60.32%), Query Frame = 3
Query:  690 ASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLL--------QNSTASVAHL----MEDEDKLTNPDNRS-----------PGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPS---GGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGL----WLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVV--CFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNN 4925
            AS LS +TYSW D+ I K +++ +T E   D+   DE  K   ++ K F   +K    + R  L         QNS A +  L     + +D L   D              P   L  +L + + + LL +   K V+D   +  P LLK+L+ +  +R    WIGY  AI      ++ S      F +   L +++R A++  +Y+K L L+N  R ++T GE VNLMSVDA+++M+   F     S  LQIVL+I  L++E+  ++ AG+G++V   P+N +L    +      +K KD R+KI+ EIL+GIK+LK +AWE SF D++ NLR  E++ +L  S    VV  ++++ P L+ + TF  YVL    NI+  +KAF S+TLFN+LRFP+ +LP  ++  + A VS +R+ +YL G++L+ + I H         N+D A++  + SF+W+ + + T+ ++N +I  G+LVA++G VG+GKSSLISA+LGEM  ++G ++++GT AYV Q++WIQN ++K+NILF  ++NEK Y+ ++EAC+L  DLE LPGGD  EIGE+GINLSGGQKQR+SLARA YQN DIYLLDDPLSAVDAHVG+H+F  V+  NG+LK KTR+LVTH +++LP+VDE++VL  NG+I E+GS+  LL    EF + ++ ++ H    +  +   G +   D+  L         +S  E++ E+     +       +       SN                 RH+K   NS              + T    S +  +E  +           +L+++E   +G VK++ Y   +++ GL    ++ +A V    AF G    SN+WL  +T DS I N++ +        P   + +R      + +Y  +GL   + V    +W++F  G ++AS ++HK+LL ++LR+PM FFDTTP+GRI+NRF+ DI  +D  +P ++   ++C   + +++++I   TP F I +IPL I+Y  +Q+FY+ TSRQ RRLDS+  SP+++HF+ET+ G+ +IRAF+ QQ F   N+  ID + K  F   +S RWL++R+E++G L VF + L  +I R +L+   VG  +S +L IT+ LNWL+R  +E+ETN VA+ERI EY+K+ +EA W  +  P   WP+ G I F +Y +RYR  L LVL+ I       +KIGVVGRTGAGKSSL   LFR++EAAGG IIID ++I++IGLHDLR++LTI+PQDP++FSG+LR NLDPF+++ D+EI+++LE AHL+S+V+ L  GL +E  E G NLS+                      GQ+QLLCL RALLRKSK+L+LDEATA+VD+ETD L+  TI+  F   TVI IAHR++TI+D+D ++V++NG+I+E  SP+ LL +    +    +  + N
Sbjct:  198 ASFLSSITYSWYDSIILKGYKRPLTLE---DVWEVDEEMKTKTLVSK-FETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKALFKTFYMVLLKSFLLKLVNDIFTFVSPQLLKLLISFASDRDTYLWIGYLCAILLFTAALIQSFCLQCYFQLCFKLGVKVRTAIMASVYKKALTLSNLARKEYTVGETVNLMSVDAQKLMDVTNFMHMLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINAILSTKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKELKNLLAFSQLQCVVIFVFQLTPVLVSVVTFSVYVLVDSNNILDAQKAFTSITLFNILRFPLSMLPMMISSMLQASVSTERLEKYLGGDDLDTSAIRHD-------CNFDKAMQFSEASFTWEHDSEATVRDVNLDIMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNILFGTEFNEKRYQQVLEACALLPDLEMLPGGDLAEIGEKGINLSGGQKQRISLARATYQNLDIYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPQVDEIVVL-GNGTIVEKGSYSALLAKKGEFAKNLKTFLRHTGPEEEATVHDGSEEEDDDYGL---------ISSVEEIPEDAASITMRRENSFRRTLSRSSRSNG----------------RHLKSLRNS--------------LKTRNVNSLKEDEELVKG---------QKLIKKEFIETGKVKFSIYLEYLQAIGLFSIFFIILAFVMNSVAFIG----SNLWLSAWTSDSKIFNSTDY--------PASQRDMR------VGVYGALGLAQGIFVFIAHFWSAF--GFVHASNILHKQLLNNILRAPMRFFDTTPTGRIVNRFAGDISTVDDTLPQSLRSWITCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMFYVSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSWITSNRWLAIRLELVGNLTVFFSALMMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTSEIETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGITCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTIIPQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSI----------------------GQRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIEN 1539          

HSP 2 Score: 87.0409 bits (214), Expect = 2.874e-16
Identity = 72/251 (28.69%), Postives = 119/251 (47.41%), Query Frame = 3
Query: 1965 AAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEY-IEHNNRAK 2675
              I+  +    ++ E  L L  I  +IG  + + +VG+ G GKSSL + +   +    G + + G              +  + Q+  + + SL+ N+    +Y+++     +E   LKS +  L  G   E+ E G NLS GQ+Q + L RA+ +   I +LD+  +AVD     +L +  I N       T I + H L+ +   D+V+VLD NG I E GS ++LL+    F    +E  IE+ N  K
Sbjct: 1298 GKIQFNNYQVRYRPELDLVLRGITCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTIIPQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIGQRQLLCLGRALLRKSKILVLDEATAAVDLET-DNLIQTTIQNE--FAHCTVITIAHRLHTIMDSDKVMVLD-NGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTK 1544          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC3 (ATP binding cassette subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:54])

HSP 1 Score: 990.719 bits (2560), Expect = 0.000e+0
Identity = 583/1523 (38.28%), Postives = 893/1523 (58.63%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLT-HCF---SSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKL---TNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVL-WEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDE-SALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA-PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            ++ ++ +++ +T++LA L  +  R        +L IFW    +  ++     I  LL  +   I +   F +  I F  +++ L   CF     F   + V PN  P PE  A  LS+L + W        +R  + ++  + L+ +D S      L + +  + K +   K       ++A+       ED++     P  R P ++   +L   +G   L++  FK + D   +  P LL IL+ +I N     W G+ +A       ++ SL     +    +  ++ R  ++G+IYRK L + N ++   T GEIVNLMSVDA+R M+   F     S PLQI+LAI  L+Q +  ++ AG+  +V   PLNG +   M+ F   ++K KD RIK+++EILNGIKVLK+YAWE SFL ++  +R  E++ +LR +A         W   PFL+ L T   YV     N++  EKAFVS++LFN+LR P+ +LP  +++   A VSLKRI Q+L  EEL+   +  +  +   A      I I  G+F+W ++   TL++++ ++ +G LVA+VG VG GKSSL+SA+LGEM ++ G V ++G++AYV Q+AWIQN +L+EN+LF +  N K Y+  +EAC+L +DLE LPGGD+TEIGE+GINLSGGQ+QRVSLARAVY + DI+LLDDPLSAVD+HV +H+F++VI   G+L  KTR+LVTHG+++LP+ D ++VL ++G +SE G +  LL+    F  F+  Y    ++        HL D  +AL  A++  ++    ED +   TD     P   + +    R  +A                        S+ G  E +    PR     S+  Q+++           K    L +EE+A  GTV+ + +    K+ GL   +A   +Y   +   + +N+WL  +T D+ + ++ Q+                  T   + +Y  +G+    +V     +   G I A++V+H+ LL + +RSP  FFDTTPSGRI+N FSKDI  +D ++   I   L+  F   ++++VI+  TP F + I+PLA+LY L+Q FY  TSRQ +RL+S++ SP+++HF+ET+ G ++IRA+   + F+ ++ T +D + +  +    S RWLS+ +E +G  +V  A LF++IGR SL   LVGLS+SYSLQ+T  LNW++R  ++LE+N VA+ER++EYSK  +EA W +  + P + WP  G + F++Y +RYR GL LVL++++LH HGG+K+G+VGRTGAGKSS+ L LFR++EAA G I ID +N++ IGLHDLR +LTI+PQDP++FSGTLR NLDPF S+ +++I+ +LE +HL ++VS    GLD++C EGG NLSV                      GQ+QL+CLARALLRKS++L+LDEATA++D+ETD L+  TIR  F   TV+ IAHR+NTI+D   ++V++ G + E DSP NL+A + GIF  +
Sbjct:  104 VFFVTPLVVGVTMLLATLLIQYERLQGVQSSGVLIIFWFLCVVCAIVPFRSKI--LLAKAEGEISDPFRFTTFYIHFALVLSALILACFREKPPFFSAKNVDPN--PYPETSAGFLSRLFFWWFTKMAIYGYRHPLEEKDLWSLKEEDRSQMVVQQLLEAWRKQEKQTARHK-------ASAAPGKNASGEDEVLLGARPRPRKPSFLK--ALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGFLVAGLMFLCSMMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRFMDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQMKLKDSRIKLMSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQ-LLRTAAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLKRIQQFLSQEELDPQSVERKTISPGYA------ITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDADIFLLDDPLSAVDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVL-ADGQVSEMGPYPALLQRNGSFANFLCNYAPDEDQG-------HLEDSWTALEGAED--KEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSAL-----------------------SSDG--EGQGRPVPRRHLGPSEKVQVTEA----------KADGALTQEEKAAIGTVELSVFWDYAKAVGLCTTLAICLLYVGQSAAAIGANVWLSAWTNDA-MADSRQN-----------------NTSLRLGVYAALGILQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSGRILNCFSKDIYVVDEVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAVLYTLVQRFYAATSRQLKRLESVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYIISNRWLSIGVEFVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERVKEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGSYSEEDIWWALELSHLHTFVSSQPAGLDFQCSEGGENLSV----------------------GQRQLVCLARALLRKSRILVLDEATAAIDLETDNLIQATIRTQFDTCTVLTIAHRLNTIMDYTRVLVLDKGVVAEFDSPANLIA-ARGIFYGM 1520          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC3 (ATP binding cassette subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:54])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 400/1159 (34.51%), Postives = 634/1159 (54.70%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLT-HCF---SSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKL---TNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVL-WEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDE-SALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLID 3815
            ++ ++ +++ +T++LA L  +  R        +L IFW    +  ++     I  LL  +   I +   F +  I F  +++ L   CF     F   + V PN  P PE  A  LS+L + W        +R  + ++  + L+ +D S      L + +  + K +   K       ++A+       ED++     P  R P ++   +L   +G   L++  FK + D   +  P LL IL+ +I N     W G+ +A       ++ SL     +    +  ++ R  ++G+IYRK L + N ++   T GEIVNLMSVDA+R M+   F     S PLQI+LAI  L+Q +  ++ AG+  +V   PLNG +   M+ F   ++K KD RIK+++EILNGIKVLK+YAWE SFL ++  +R  E++ +LR +A         W   PFL+ L T   YV     N++  EKAFVS++LFN+LR P+ +LP  +++   A VSLKRI Q+L  EEL+   +  +  +   A      I I  G+F+W ++   TL++++ ++ +G LVA+VG VG GKSSL+SA+LGEM ++ G V ++G++AYV Q+AWIQN +L+EN+LF +  N K Y+  +EAC+L +DLE LPGGD+TEIGE+GINLSGGQ+QRVSLARAVY + DI+LLDDPLSAVD+HV +H+F++VI   G+L  KTR+LVTHG+++LP+ D ++VL ++G +SE G +  LL+    F  F+  Y    ++        HL D  +AL  A++  ++    ED +   TD     P   + +    R  +A                        S+ G  E +    PR     S+  Q+   T+   D         L +EE+A  GTV+ + +    K+ GL   +A   +Y   +   + +N+WL  +T D+ + ++ Q+                  T   + +Y  +G+    +V     +   G I A++V+H+ LL + +RSP  FFDTTPSGRI+N FSKDI  +D ++   I   L+  F   ++++VI+  TP F + I+PLA+LY L+Q FY  TSRQ +RL+S++ SP+++HF+ET+ G ++IRA+   + F+ ++ T +D
Sbjct:  104 VFFVTPLVVGVTMLLATLLIQYERLQGVQSSGVLIIFWFLCVVCAIVPFRSKI--LLAKAEGEISDPFRFTTFYIHFALVLSALILACFREKPPFFSAKNVDPN--PYPETSAGFLSRLFFWWFTKMAIYGYRHPLEEKDLWSLKEEDRSQMVVQQLLEAWRKQEKQTARHK-------ASAAPGKNASGEDEVLLGARPRPRKPSFL--KALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGFLVAGLMFLCSMMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRFMDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQMKLKDSRIKLMSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQ-LLRTAAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLKRIQQFLSQEELDPQSVERKTISPGYA------ITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDADIFLLDDPLSAVDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVL-ADGQVSEMGPYPALLQRNGSFANFLCNYAPDEDQG-------HLEDSWTALEGAED--KEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSAL-----------------------SSDG--EGQGRPVPRRHLGPSEKVQV---TEAKAD-------GALTQEEKAAIGTVELSVFWDYAKAVGLCTTLAICLLYVGQSAAAIGANVWLSAWTNDA-MADSRQN-----------------NTSLRLGVYAALGILQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSGRILNCFSKDIYVVDEVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAVLYTLVQRFYAATSRQLKRLESVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVD 1179          

HSP 2 Score: 82.8037 bits (203), Expect = 5.744e-15
Identity = 76/303 (25.08%), Postives = 130/303 (42.90%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVM-HTI--REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            LN L +  + L    V+L+RI+++    S+ E D  +    +      IT       + + LP  L ++++    G  + VVG  G GKSSL  AL   +E   G +              ++  +  +PQ   I + TL+EN+    +       Q+LE   L + +  L  G   E GE G+NLS                       GQ+Q + LARA+   + + +LD+  ++VD    + +  H I         T +++ H I+ +  TD I+V+ +G++ E+  P   L   +G F
Sbjct:  582 LNMLPQLISNLTQASVSLKRIQQFL---SQEELDPQSVERKTISPGYAITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGKV-------------HMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADLEMLPGGDQTEIGEKGINLS----------------------GGQRQRVSLARAVYSDADIFLLDDPLSAVDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEM-GPYPALLQRNGSF 845          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 557.755 bits (1436), Expect = 7.511e-171
Identity = 320/799 (40.05%), Postives = 466/799 (58.32%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLL--DASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFS---KDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDN-----RSPG--W--VLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALG 2720
            ++++S  +L IT++LA    ++ RR       I+  FWL A +  L  L   I+  L  DA     R+         F L L+  +  CFS  S    + +  PN  PCPE  AS LS++T+ W+   I + +R+ +     + L ++D S +   +L K +  K + +  RK+   +  S+   A   E      N +      +SP   W   LF  L + +G   L++  FK +HD  +++ P +LK+L++++ +     W GYF  +       L +L  +  F I  +  +RI+ A+IG +YRK L + N  R   T GEIVNLMSVDA+R M+   +     S PLQ++LA+ LL+  +  ++ AG+ ++V   P+N ++    + +    +K KD RIK++ EILNGIKVLK+YAWE +F DK+  +R  E++ + + +    V    W   PFL+ L TF  YV   E NI+  + AFVSL LFN+LRFP+ +LP  ++  + A VSLKR+  +L  EEL    I  R   D    N   +I +R+ +F+W + D  TLN I F I  G LVA+VG+VG GKSSL+SA+L EM ++ G V+++G++AYV Q+AWIQN SL+ENILF     E +Y  +I+AC+L  DLE LP GD TEIGE+G+NLSGGQKQRVSLARAVY N DIYL DDPLSAVDAHVG+H+FENVI   G+LK+KTRILVTH +++LP+VD ++V+ S G ISE GS+++LL     F +F++ Y            G  + DE   G
Sbjct:    4 VFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRD---ITFYVYFSLLLIQLVLSCFSDRSPLFSETIHDPN--PCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNW--KKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTN---SITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVM-SGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGSTVMDEEEAG 791          

HSP 2 Score: 517.694 bits (1332), Expect = 3.017e-156
Identity = 287/620 (46.29%), Postives = 415/620 (66.94%), Query Frame = 3
Query: 3048 QLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLN-NAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            +L+E ++A +G VK + Y   +K+ GL++   ++ ++       + SN WL  +T+D  I N +Q                 E TK  + +Y  +G+   + V  Y  + ++G I AS+ +H  LL S+LRSPM FF+ TPSG ++NRFSK+++ +D +IP  I   +  LF V  + IVI+  TP  AI I PL ++Y+ +Q FY+ +SRQ +RL+S++ SPV++HF ETL GV++IRAF+EQ+ F + +   +D++ K  +    + RWL++R+E +G  +V  A LF++I R SL+A LVGLS+SYSLQ+T +LNWL+R  +E+ETN VA+ER++EYS+   EA W +   AP  SWP  G + F++Y LRYRE L  VL++IN+  +GG+K+G+VGRTGAGKSSL L LFR+ E+A G IIID INI+ IGLHDLR ++TI+PQDPV+FSG+LR NLDPFS + D+E++ SLE AHL+ +VS L + LD+EC EGG NLSV                      GQ+QL+CLARALLRK+K+L+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ GEI E  +P +LL    G+F S+
Sbjct:  855 KLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDP-IVNGTQ-----------------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSV----------------------GQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSM 1433          

HSP 3 Score: 88.5817 bits (218), Expect = 9.525e-17
Identity = 77/276 (27.90%), Postives = 130/276 (47.10%), Query Frame = 3
Query: 1863 VSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQG-------------TIAYVSQEAWIQNKSLKENI-LFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQE 2648
            V+++R+ +Y   E+    +I  ++    S++     +E R+    ++++    L +IN  I  G+ V IVG+ G GKSSL   +        G + + G              I  + Q+  + + SL+ N+  F+Q  +E+ +  + E   LK  +  LP   + E  E G NLS GQ+Q V LARA+ +   I +LD+  +AVD      L ++ I      +D T + + H LN +     V+VLD  G I E G+  DLL+    F    ++
Sbjct: 1168 VAVERLKEYSETEKEAPWQI--QETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSL-ELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLET-DDLIQSTIRTQ--FEDCTVLTIAHRLNTIMDYTRVIVLD-KGEIQEYGAPSDLLQQRGLFYSMAKD 1436          

HSP 4 Score: 79.7221 bits (195), Expect = 4.408e-14
Identity = 74/304 (24.34%), Postives = 127/304 (41.78%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQS-LETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            LN L    + +    V+L+R+R +          +   P        +IT ++    +    P  L  I      G  + VVG+ G GKSSL  AL   ++   G +              ++  +  +PQ   I + +LREN+  F    ++  ++S ++   L   +  L  G   E GE GVNLS                       GQKQ + LARA+   + + + D+  ++VD    + +   +   +   +  T I++ H ++ +   D+I+VM  G+I E+ S + LLA  DG F
Sbjct:  495 LNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVA-------------IKGSVAYVPQQAWIQNDSLRENI-LFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLS----------------------GGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLA-RDGAF 761          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 557.755 bits (1436), Expect = 7.511e-171
Identity = 320/799 (40.05%), Postives = 466/799 (58.32%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLL--DASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFS---KDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDN-----RSPG--W--VLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALG 2720
            ++++S  +L IT++LA    ++ RR       I+  FWL A +  L  L   I+  L  DA     R+         F L L+  +  CFS  S    + +  PN  PCPE  AS LS++T+ W+   I + +R+ +     + L ++D S +   +L K +  K + +  RK+   +  S+   A   E      N +      +SP   W   LF  L + +G   L++  FK +HD  +++ P +LK+L++++ +     W GYF  +       L +L  +  F I  +  +RI+ A+IG +YRK L + N  R   T GEIVNLMSVDA+R M+   +     S PLQ++LA+ LL+  +  ++ AG+ ++V   P+N ++    + +    +K KD RIK++ EILNGIKVLK+YAWE +F DK+  +R  E++ + + +    V    W   PFL+ L TF  YV   E NI+  + AFVSL LFN+LRFP+ +LP  ++  + A VSLKR+  +L  EEL    I  R   D    N   +I +R+ +F+W + D  TLN I F I  G LVA+VG+VG GKSSL+SA+L EM ++ G V+++G++AYV Q+AWIQN SL+ENILF     E +Y  +I+AC+L  DLE LP GD TEIGE+G+NLSGGQKQRVSLARAVY N DIYL DDPLSAVDAHVG+H+FENVI   G+LK+KTRILVTH +++LP+VD ++V+ S G ISE GS+++LL     F +F++ Y            G  + DE   G
Sbjct:    4 VFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRD---ITFYVYFSLLLIQLVLSCFSDRSPLFSETIHDPN--PCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNW--KKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTN---SITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVM-SGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGSTVMDEEEAG 791          

HSP 2 Score: 517.694 bits (1332), Expect = 3.017e-156
Identity = 287/620 (46.29%), Postives = 415/620 (66.94%), Query Frame = 3
Query: 3048 QLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLN-NAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            +L+E ++A +G VK + Y   +K+ GL++   ++ ++       + SN WL  +T+D  I N +Q                 E TK  + +Y  +G+   + V  Y  + ++G I AS+ +H  LL S+LRSPM FF+ TPSG ++NRFSK+++ +D +IP  I   +  LF V  + IVI+  TP  AI I PL ++Y+ +Q FY+ +SRQ +RL+S++ SPV++HF ETL GV++IRAF+EQ+ F + +   +D++ K  +    + RWL++R+E +G  +V  A LF++I R SL+A LVGLS+SYSLQ+T +LNWL+R  +E+ETN VA+ER++EYS+   EA W +   AP  SWP  G + F++Y LRYRE L  VL++IN+  +GG+K+G+VGRTGAGKSSL L LFR+ E+A G IIID INI+ IGLHDLR ++TI+PQDPV+FSG+LR NLDPFS + D+E++ SLE AHL+ +VS L + LD+EC EGG NLSV                      GQ+QL+CLARALLRK+K+L+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ GEI E  +P +LL    G+F S+
Sbjct:  855 KLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDP-IVNGTQ-----------------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSV----------------------GQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSM 1433          

HSP 3 Score: 88.5817 bits (218), Expect = 9.525e-17
Identity = 77/276 (27.90%), Postives = 130/276 (47.10%), Query Frame = 3
Query: 1863 VSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQG-------------TIAYVSQEAWIQNKSLKENI-LFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQE 2648
            V+++R+ +Y   E+    +I  ++    S++     +E R+    ++++    L +IN  I  G+ V IVG+ G GKSSL   +        G + + G              I  + Q+  + + SL+ N+  F+Q  +E+ +  + E   LK  +  LP   + E  E G NLS GQ+Q V LARA+ +   I +LD+  +AVD      L ++ I      +D T + + H LN +     V+VLD  G I E G+  DLL+    F    ++
Sbjct: 1168 VAVERLKEYSETEKEAPWQI--QETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSL-ELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLET-DDLIQSTIRTQ--FEDCTVLTIAHRLNTIMDYTRVIVLD-KGEIQEYGAPSDLLQQRGLFYSMAKD 1436          

HSP 4 Score: 79.7221 bits (195), Expect = 4.408e-14
Identity = 74/304 (24.34%), Postives = 127/304 (41.78%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQS-LETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            LN L    + +    V+L+R+R +          +   P        +IT ++    +    P  L  I      G  + VVG+ G GKSSL  AL   ++   G +              ++  +  +PQ   I + +LREN+  F    ++  ++S ++   L   +  L  G   E GE GVNLS                       GQKQ + LARA+   + + + D+  ++VD    + +   +   +   +  T I++ H ++ +   D+I+VM  G+I E+ S + LLA  DG F
Sbjct:  495 LNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVA-------------IKGSVAYVPQQAWIQNDSLRENI-LFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLS----------------------GGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLA-RDGAF 761          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 959.518 bits (2479), Expect = 0.000e+0
Identity = 582/1519 (38.31%), Postives = 885/1519 (58.26%), Query Frame = 3
Query:  372 IMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVL-TSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSW-KKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISN-NGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAV--PIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKS-PRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFS--LTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            ++ Y   C+ LVL +     R R +     ++ ++WL   +  +  L   I   L    Y I +    L    +    +     CF+    +  +  N   CPE  AS L++LT+ W     Y   +K +  E  +DL  +D   K  NI+     + I      +R  + +N  A++            P N      + I + + Y   LL    +K + D   +  P LL+ L+ +I++++   WIG  +A+      +L S+  +  F     L + IR+ L   +Y KTL L+NE R   T+G IVNLMSVD +RI +   F   F S PLQI+L++  L++ +  ++ AG  +++   P N  +   M+     ++K+KD RIK+++EILNG+KVLK+Y+WEKS    +  +R+ E+R + ++S       + W   PFL+ + TF  YVL   E N++TP+  FV+L LFN+LRFP+ V     + ++    S  R+ ++   EE++         T  +    D+AI++  GSF+W  KE+   L++I F I RG+LVAIVG+VG+GKSSL+ A+LGEM++++GSV V G++AYV Q AWIQN SL+ NILF + Y+ K Y+++IE C+L  DLE LP  D TEIGE+GINLSGGQKQRVSLARAVYQN +I LLDDPLSAVD+HVG+H+FENVIS   G L  KTR+L+THGL +L   D+V+VL    +ISE G++++L+     F +F++E++   ++ K  S         + G+         D+++V E + D    SPA+   IQ   S  +    D+ +  I   +       K  + ++S + + E+ +S    ++P  ++ +  K+T            +QL+E+E   +G VK+  Y    ++ G+ + +    +Y A + L VFSN++L  +++D      ++ I L+ +GS         +T+  + IY ++G+     VC       +G + AS+++H  LL +++RSPM FFD TP GRI+NRF KDIE +D  +P +I   +  +F V +++ VII+ TPW  I  + L  +Y+++  FY+ TSRQ +RL+S + SP+++HF E++QG + IRA+     F   +Q  +D++    +    + RWL++R+E++G L+V ++   ++  R S  L+A LVGLS+SY+L IT+ LNW +R  +ELETN VA+ERI EY+  P+E     + AP  SWP NG I+ K++ +RYR GL LVL  +  H    +KIG+VGRTGAGKSSL LALFR++EA GG I ID  NI+ + L  LR RLTI+PQDPV+FSGT+R NLDPF +  DD+I+++L  AHL S+V  L EGL +   EGG NLSV                      GQ+QL+CLARALLRK+KVL+LDEA A+VDVETD L+  TIRE F+  TV+ IAHR+NT++D+D ++V++ G + E D+PK LL+  DGIF S+
Sbjct:  113 LVQYAGFCLALVLTI---ACRNRGI-ITSGVITLYWLLVVVCGVPELRYYITGRL-YKEYEIHSCRAALYVFAYVCSALELFLSCFADTPSNGYIGKNS--CPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERD---KAENIIPSFIENLIPEVEGYRR-KIKKNPEAAI------------PKNHPS---ILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQ-------TSIAYGGTDSAIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDE-TISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRS--------VSFGE---------DSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLH------KDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTK-----------TQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDD------AKEIALSGNGS-------SSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDIEAIDQTLPHSIRAMVMTIFNVISTVFVIIWATPWAGIGFLVLGFVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEGNNSQSLAPK-SWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSV----------------------GQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSM 1527          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-2 (pep chromosome:WBcel235:X:563719:572701:-1 gene:WBGene00003408.1 transcript:F57C12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-2)

HSP 1 Score: 954.51 bits (2466), Expect = 0.000e+0
Identity = 561/1438 (39.01%), Postives = 856/1438 (59.53%), Query Frame = 3
Query:  624 CFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYV-LTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELN-LTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNN-GILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFE---DEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFS--LTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA---PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            CF+    D  +  ++  CPE  AS +++LT+ W     Y   +K + +E  +DL   D   K  N++   F   +K   +    ++ ++ +A++            P N  P +V  I + + Y   LL    +K   D   +  P LLK L+ +I++++   WIG  +     F   L S+  +  +     L + +R+ L   +Y K L L+NE R   T G IVNLMSVD ++I +       F S PLQI L+I  L++ +  A  AGL +++   P+NGL+   M+K  T ++K KD RIK+++EILNG+KVLK+Y+WE+S  + +  +R+ E+  + ++S     +   W   PFL  + +F+ YV L  E N++TPE  FV+L+LF++LR P+ ++     +++   VS  R+ ++   EE++  T I+H +         D+AIE+ +G FSW  ++  TL  I+F+I +G+LVAIVGKVG+GKSSL+ A+LGEM++++GSV + G IAYV Q+AWIQN SL+ NILF + Y+ + YED+++ C+LK DL  LP GD TEIGE+GINLSGGQKQRVSLARAVYQN DI LLDDPLSAVD+HVG+H+FENVIS++ G L  KTR+LVTHGL +L   D+++VL   G+ISE G++++LL +   F +F++E++   ++ +    G+  S     G+   +LR L                 P + ++R +SH    +                      E++++   E   D   +S  + +P SQ  +        ++ +  +  +QL+E+E   +G VK+  Y    ++  + + +    +Y   +GL + SN +L   ++ +   N +                     K  + IY ++G+  + VV       T+G + AS+++H  LL +++RSPM FFD TP GRI+NR  KDIE +D  +P  I      +F V A+++VI++ TPW  IA   L+++Y+++  FYI TSRQ +RL+S + SP+++HF E++QG + IRAF     F   +Q  +D      +    + RWL++R+E++G L+V +A   ++  R S  L+A LVGLS+SY+L IT+ LNW +R  +ELETN V++ERI+EY+  P+E     NN+    + SWP  G I+ K++ +RYR GL LVL  I+ H    +K+G+VGRTGAGKSSL LALFR++EA GGSI ID INI+ + L  LR  LTI+PQDPV+FSGT++ NLDPFS++ D +++++LE AHL+ +V  L +GL+++  EGG NLSV                      GQ+QL+CLARALLRK+KVL+LDEA A+VDVETD L+  TIRE F+  TV+ IAHR+NT++D+D ++V++ G + E DSPKNLLA  DGIF S+
Sbjct:  192 CFADVPSD--MYKSESSCPEYTASFINRLTFQWFTGLAYLGNKKSLENEDLWDLNEID---KAENLIPS-FMQNLKPRIDEYHQNIKKDPSAAL------------PKNH-PSFV--IPIFKTYKYTLLAGFFYKLCFDMLQFLAPQLLKQLIGFIEDKNQPVWIGCSIVGIMFFSSFLQSMFLHQYYHSMFRLGMHVRSVLTSAVYSKALNLSNEARKGKTIGAIVNLMSVDIQKIQDMAPTIMLFWSAPLQIFLSIYFLWKFLGVAALAGLVVLILALPVNGLIAIQMRKCQTEQMKLKDERIKMMSEILNGMKVLKLYSWERSMENMVLKIRERELHILKKLSYFMAAIVFSWICAPFLASVISFVVYVYLDPENNVLTPEITFVALSLFDILRMPLAMVAMVYGEAVQCSVSNTRLKEFFAAEEMSPQTSISHGE--------TDSAIEVENGLFSWSSDEDPTLREISFKIQKGQLVAIVGKVGSGKSSLLHALLGEMNKLSGSVQINGNIAYVPQQAWIQNMSLRNNILFNKPYDLENYEDVVKNCALKEDLANLPAGDRTEIGEKGINLSGGQKQRVSLARAVYQNPDIILLDDPLSAVDSHVGKHIFENVISSSTGCLASKTRVLVTHGLTYLKHCDQLIVL-KEGTISELGTYQELLNNSGAFAEFLEEFLIEESKTR----GRVASIGDGSGEVDEILRDLGQ-------------VKPGI-LKRLESHLSQESDK--------------------EDTSARAIEYSRDSSRRSVLLHSPRSQHEENEALLGAISEDVPAQENTQLIEKETVETGKVKFEVYIAYFQAISIPITLLFFFLYVGSSGLGILSNFYLAKLSDHAKSGNRTS-----------------SDAKMELGIYAVLGMGQSFVVLIASIILTIGVLRASRILHAGLLGNIMRSPMAFFDVTPIGRILNRIGKDIEAIDRTLPDVIRHMSMTIFNVVATLVVIMWATPWAGIAFAILSVIYFIVLRFYISTSRQLKRLESASRSPIYSHFQESIQGASSIRAFGVVDNFIKQSQQRVDDHLIAYYPSIVANRWLAVRLEMVGNLIVLSAAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVSVERIKEYTVTPTEG----NNSRRLAAKSWPEKGEISIKNFSVRYRPGLDLVLHGISAHIAPSEKVGIVGRTGAGKSSLTLALFRIIEADGGSIEIDGINIANLQLEQLRSCLTIVPQDPVLFSGTMKMNLDPFSAYSDSQVWEALENAHLKPFVKSLQDGLEHKISEGGENLSV----------------------GQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLIQKTIREQFKECTVLTIAHRLNTVMDSDRLLVLDKGRVAEFDSPKNLLANPDGIFYSM 1518          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 949.118 bits (2452), Expect = 0.000e+0
Identity = 580/1519 (38.18%), Postives = 881/1519 (58.00%), Query Frame = 3
Query:  372 IMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVL-TSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSW-KKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISN-NGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAV--PIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKS-PRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFS--LTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            ++ Y   C+ LVL +     R R +     ++ ++WL   +  +  L   I   L    Y I +    L    +    +     CF+    +  +  N   CPE  AS L++LT+ W     Y   +K +  E  +DL  +D   K  NI+     + I      +R  + +N  A++            P N      + I + + Y   LL    +K + D   +  P LL+ L+ +I++++   WIG  +A+      +L S+  +  F     L + IR+ L   +Y KTL L+NE R   T+G IVNLMSVD +RI +   F   F S PLQI+L++  L++ +  ++ AG  +++   P N  +   M+     ++K+KD RIK+++EILNG+KVLK+Y+WEKS    +  +R+ E+R + ++S       + W   PFL+ + TF  YVL   E N++TP+  FV+L LFN+LRFP+ V     + ++    S  R+ ++   EE++         T  +    D+AI++  GSF+W  KE+   L++I F I RG+LVAIVG+VG+GKSSL+ A+LGEM++++GSV V G++AYV Q AWIQN SL+ NILF + Y+ K Y+++IE C+L  DLE LP  D TEIGE+GINLSGGQKQRVSLARAVYQN +I LLDDPLSAVD+HVG+H+FENVIS   G L  KTR+L+THGL +L   D+V+VL  + +ISE G++++L+     F +F++E++   ++ K  S         + G+         D+++V E + D    SPA+   IQ   S  +    D+ +  I   +       K  + ++S + + E+ +S    ++P  ++ +  K+T            +QL+E+E   +G VK+  Y    ++ G+ + +    +Y A + L VFSN++L  +++D      ++ I L+ +GS         +T+  + IY ++G+     VC       +G + AS+++H  LL +++RSPM FFD TP GRI+NRF KD++ +D  +P NI D L     + A ++   Y TP+    I+ +AI  + I  FY+ TSRQ +RL+S + SP+++HF E++QG + IRA+     F   +Q  +D++    +    + RWL++R+E++G L+V ++   ++  R S  L+A LVGLS+SY+L IT+ LNW +R  +ELETN VA+ERI EY+  P+E     + AP  SWP NG I+ K++ +RYR GL LVL  +  H    +KIG+VGRTGAGKSSL LALFR++EA GG I ID  NI+ + L  LR RLTI+PQDPV+FSGT+R NLDPF +  DD+I+++L  AHL S+V  L EGL +   EGG NLSV                      GQ+QL+CLARALLRK+KVL+LDEA A+VDVETD L+  TIRE F+  TV+ IAHR+NT++D+D ++V++ G + E D+PK LL+  DGIF S+
Sbjct:  113 LVQYAGFCLALVLTI---ACRNRGI-ITSGVITLYWLLVVVCGVPELRYYITGRL-YKEYEIHSCRAALYVFAYVCSALELFLSCFADTPSNGYIGKNS--CPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERD---KAENIIPSFIENLIPEVEGYRR-KIKKNPEAAI------------PKNHPS---ILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQ-------TSIAYGGTDSAIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVL-KDETISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRS--------VSFGE---------DSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLH------KDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTK-----------TQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDD------AKEIALSGNGS-------SSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDMDVVDERLPDNIGDFLLTFSELVACVVFTSYATPFAIFPIVLIAIGCFAILRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEGNNSQSLAPK-SWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSV----------------------GQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSM 1527          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 579/1519 (38.12%), Postives = 878/1519 (57.80%), Query Frame = 3
Query:  372 IMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVL-TSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSW-KKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISN-NGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAV--PIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKS-PRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFS--LTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            ++ Y   C+ LVL +     R R +     ++ ++WL   +  +  L   I   L    Y I +    L    +    +     CF+    +  +  N   CPE  AS L++LT+ W     Y   +K +  E  +DL  +D   K  NI+     + I      +R  + +N  A++            P N      + I + + Y   LL    +K + D   +  P LL+ L+ +I++++   WIG  +A+      +L S+  +  F     L + IR+ L   +Y KTL L+NE R   T+G IVNLMSVD +RI +   F   F S PLQI+L++  L++ +  ++ AG  +++   P N  +   M+     ++K+KD RIK+++EILNG+KVLK+Y+WEKS    +  +R+ E+R + ++S       + W   PFL+ + TF  YVL   E N++TP+  FV+L LFN+LRFP+ V     + ++    S  R+ ++   EE++         T  +    D+AI++  GSF+W  KE+   L++I F I RG+LVAIVG+VG+GKSSL+ A+LGEM++++GSV V G++AYV Q AWIQN SL+ NILF + Y+ K Y+++IE C+L  DLE LP  D TEIGE+GINLSGGQKQRVSLARAVYQN +I LLDDPLSAVD+HVG+H+FENVIS   G L  KTR+L+THGL +L   D+V+VL  + +ISE G++++L+     F +F++E++   ++ K  S         + G+         D+++V E + D    SPA+   IQ   S  +    D+ +  I   +       K  + ++S + + E+ +S    ++P  ++ +  K+T            +QL+E+E   +G VK+  Y    ++ G+ + +    +Y A + L VFSN++L  +++D      ++ I L+ +GS         +T+  + IY ++G+     VC       +G + AS+++H  LL +++RSPM FFD TP GRI+NRF KDI+ +D+ +P  I   +  +        V IY TP  +  I  + I YY +  FY+ TSRQ +RL+S + SP+++HF E++QG + IRA+     F   +Q  +D++    +    + RWL++R+E++G L+V ++   ++  R S  L+A LVGLS+SY+L IT+ LNW +R  +ELETN VA+ERI EY+  P+E     + AP  SWP NG I+ K++ +RYR GL LVL  +  H    +KIG+VGRTGAGKSSL LALFR++EA GG I ID  NI+ + L  LR RLTI+PQDPV+FSGT+R NLDPF +  DD+I+++L  AHL S+V  L EGL +   EGG NLSV                      GQ+QL+CLARALLRK+KVL+LDEA A+VDVETD L+  TIRE F+  TV+ IAHR+NT++D+D ++V++ G + E D+PK LL+  DGIF S+
Sbjct:  113 LVQYAGFCLALVLTI---ACRNRGI-ITSGVITLYWLLVVVCGVPELRYYITGRL-YKEYEIHSCRAALYVFAYVCSALELFLSCFADTPSNGYIGKNS--CPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERD---KAENIIPSFIENLIPEVEGYRR-KIKKNPEAAI------------PKNHPS---ILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQ-------TSIAYGGTDSAIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVL-KDETISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRS--------VSFGE---------DSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLH------KDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTK-----------TQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDD------AKEIALSGNGS-------SSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDIDVIDYRLPSCIMTFVGAIVQAVTIFAVPIYATPLSSFPITIVLIGYYFLLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEGNNSQSLAPK-SWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSV----------------------GQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSM 1527          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 943.34 bits (2437), Expect = 0.000e+0
Identity = 578/1519 (38.05%), Postives = 882/1519 (58.06%), Query Frame = 3
Query:  372 IMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVL-TSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSW-KKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISN-NGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAV--PIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKS-PRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFS--LTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            ++ Y   C+ LVL +     R R +     ++ ++WL   +  +  L   I   L    Y I +    L    +    +     CF+    +  +  N   CPE  AS L++LT+ W     Y   +K +  E  +DL  +D   K  NI+     + I      +R  + +N  A++            P N      + I + + Y   LL    +K + D   +  P LL+ L+ +I++++   WIG  +A+      +L S+  +  F     L + IR+ L   +Y KTL L+NE R   T+G IVNLMSVD +RI +   F   F S PLQI+L++  L++ +  ++ AG  +++   P N  +   M+     ++K+KD RIK+++EILNG+KVLK+Y+WEKS    +  +R+ E+R + ++S       + W   PFL+ + TF  YVL   E N++TP+  FV+L LFN+LRFP+ V     + ++    S  R+ ++   EE++         T  +    D+AI++  GSF+W  KE+   L++I F I RG+LVAIVG+VG+GKSSL+ A+LGEM++++GSV V G++AYV Q AWIQN SL+ NILF + Y+ K Y+++IE C+L  DLE LP  D TEIGE+GINLSGGQKQRVSLARAVYQN +I LLDDPLSAVD+HVG+H+FENVIS   G L  KTR+L+THGL +L   D+V+VL  + +ISE G++++L+     F +F++E++   ++ K  S         + G+         D+++V E + D    SPA+   IQ   S  +    D+ +  I   +       K  + ++S + + E+ +S    ++P  ++ +  K+T            +QL+E+E   +G VK+  Y    ++ G+ + +    +Y A + L VFSN++L  +++D      ++ I L+ +GS         +T+  + IY ++G+     VC       +G + AS+++H  LL +++RSPM FFD TP GRI+NRF KD++ +D  IP  +S  +         I +I++ TP     ++PL I+Y+++  FY+ TSRQ +RL+S + SP+++HF E++QG + IRA+     F   +Q  +D++    +    + RWL++R+E++G L+V ++   ++  R S  L+A LVGLS+SY+L IT+ LNW +R  +ELETN VA+ERI EY+  P+E     + AP  SWP NG I+ K++ +RYR GL LVL  +  H    +KIG+VGRTGAGKSSL LALFR++EA GG I ID  NI+ + L  LR RLTI+PQDPV+FSGT+R NLDPF +  DD+I+++L  AHL S+V  L EGL +   EGG NLSV                      GQ+QL+CLARALLRK+KVL+LDEA A+VDVETD L+  TIRE F+  TV+ IAHR+NT++D+D ++V++ G + E D+PK LL+  DGIF S+
Sbjct:  113 LVQYAGFCLALVLTI---ACRNRGI-ITSGVITLYWLLVVVCGVPELRYYITGRL-YKEYEIHSCRAALYVFAYVCSALELFLSCFADTPSNGYIGKNS--CPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERD---KAENIIPSFIENLIPEVEGYRR-KIKKNPEAAI------------PKNHPS---ILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQ-------TSIAYGGTDSAIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVL-KDETISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRS--------VSFGE---------DSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLH------KDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTK-----------TQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDD------AKEIALSGNGS-------SSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDVDGVDTDIPRTMSMFIRTAVSSIEIIAIILWATPLAISLLLPLFIVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEGNNSQSLAPK-SWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSV----------------------GQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSM 1527          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090025)

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 566/1423 (39.78%), Postives = 851/1423 (59.80%), Query Frame = 3
Query:  678 PEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISH-NRKRYD-LLQNSTASVAHLMEDEDKLTNPDNRSPGWV-LFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNR-SDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTD-------RLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL---NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            PE+ AS LS++TY W D    K +R  + ++  +DLR QD  ++   I    +   ++ ++ N+ R +   Q S  +V      E+     + R  G   +   + + +G   L     K   D   +A P +L +++ +++ + ++  W G   A+         +      F    I+ +RIR ALI  IYRK LR++N  + + T GEIVNLM+VDA+R M    +     S PLQI LA+  L+Q++  ++ AGL +++   P+NG++ + ++ +   ++K+KD R+K++ E+L+GIKVLK+YAWE SF  ++ ++RD E+  +   +        LW   PFL+ L TF  YVL  E N++   K FVSL+LFN+LRFP+ +LP  +T+ +   VS+ RI ++L  EEL+   + H     DS+  +  +IE  +G FSW   D++TL NIN E+ +G LVA+VG VG+GKSS++ A LGEM ++ G V+  G +AYV Q+AWIQN ++++NILF Q Y+ K Y  +I+AC+L++D++ L  GD TEIGE+GINLSGGQKQR+SLARAVY + D+YLLDDPLSAVDAHVG+H+FE VI   GIL  K+R+LVTHG+ +LP+VD + V+   G ISE G+F  L+K+   F  F+   I+H                    +   + RQ+S   DV E +        A+ + R +S                             +S S    D       +M  G   R+ +K  D +         +   +   +L+E E++ +G V++A Y   IKS G++L +AT+ +   F   Q+ SN+WL  +  D ++ N +                +R+    Y+ +Y   G        F   +  +GS++A+KV+H  LL +VLR+PM  FDTTP GRI++RFSKD+E++D  +P  I+D + C F V A+I+VI   TP F   I+P+A LYY  Q FY+ TSRQ  RL+S++ SP+++HF+ET+ G + IRA+     F   +   +DK+   K+    + RWL++R+E++G L++  A LF+++G       LVGLS+SY+LQ+T+ LNWL+R  +++ETN V++ERI+EY +   EA W+L    N P + WP  G + F+++ +RYREGL LVL+ ++ +  GG+K+G+VGRTGAGKSSL LALFR++EAAGG I ID ++I+++GLH LR RLTI+PQDPV+FSG+LR NLDPF    DDEI+++LE +HL+S+V  L+ GL++E  EGG NLSV                      GQ+QL+CLARALLRK+KVL+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTILD+D ++V++ G+I+E  SP  LL      F S+
Sbjct:  225 PELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGNVTF----ENPHGEKNGRKKGMASIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLH-----DSSKPHPMSIE--NGEFSWG--DEITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKM-GEISESGTFDQLVKNKGAFADFI---IQHLQEGN-----------EEEEELNQIKRQISSTADVPELLGT---VEKAIKLARTES---------------------------LSDSISVTSADS------LMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTG---------------LRDM---YLGVYGAFGFGQGFTSFFSDLAPALGSLHAAKVLHSMLLENVLRAPMTMFDTTPVGRILSRFSKDVESVDQKMPQVINDCIWCAFEVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGG-QTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKN-WPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSV----------------------GQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSM 1541          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090020)

HSP 1 Score: 987.638 bits (2552), Expect = 0.000e+0
Identity = 564/1423 (39.63%), Postives = 848/1423 (59.59%), Query Frame = 3
Query:  678 PEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISH-NRKRYD-LLQNSTASVAHLMEDEDKLTNPDNRSPGWV-LFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNR-SDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTD-------RLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL---NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            PE+ AS LS++TY W D    K +R  + ++  +DLR QD  ++   I    +   ++ ++ N+ R +   Q S  +V      E+     + R  G   +   + + +G   L     K   D   +A P +L +++ +++ + ++  W G   A+         +      F    I+ +RIR ALI  IYRK LR++N  + + T GEIVNLM+VDA+R M    +     S PLQI LA+  L+Q++  ++ AGL +++   P+NG++ + ++ +   ++K+KD R+K++ E+L+GIKVLK+YAWE SF  ++ ++RD E+  +   +        LW   PFL+ L TF  YVLTSE N ++ EK  VS+ LF+L++ P+ +LP    D     VS+ RI ++L  EEL+   + H     DS+  +  +IE  +G FSW   D++TL NIN E+ +G LVA+VG VG+GKSS++ A LGEM ++ G V+  G +AYV Q+AWIQN ++++NILF Q Y+ K Y  +I+AC+L++D++ L  GD TEIGE+GINLSGGQKQR+SLARAVY + D+YLLDDPLSAVDAHVG+H+FE VI   GIL  K+R+LVTHG+ +LP+VD + V+   G ISE G+F  L+K+   F  F+   I+H                    +   + RQ+S   DV E +        A+ + R +S                             +S S    D       +M  G   R+ +K  D +         +   +   +L+E E++ +G V++A Y   IKS G++L +AT+ +   F   Q+ SN+WL  +  D ++ N +                +R+    Y+ +Y   G        F   +  +GS++A+KV+H  LL +VLR+PM  FDTTP GRI++RFSKD+E++D  +P  I+D + C F V A+I+VI   TP F   I+P+A LYY  Q FY+ TSRQ  RL+S++ SP+++HF+ET+ G + IRA+     F   +   +DK+   K+    + RWL++R+E++G L++  A LF+++G       LVGLS+SY+LQ+T+ LNWL+R  +++ETN V++ERI+EY +   EA W+L    N P + WP  G + F+++ +RYREGL LVL+ ++ +  GG+K+G+VGRTGAGKSSL LALFR++EAAGG I ID ++I+++GLH LR RLTI+PQDPV+FSG+LR NLDPF    DDEI+++LE +HL+S+V  L+ GL++E  EGG NLSV                      GQ+QL+CLARALLRK+KVL+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTILD+D ++V++ G+I+E  SP  LL      F S+
Sbjct:  225 PELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGNVTF----ENPHGEKNGRKKGMASIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLTSEANQLSVEKVLVSIALFDLMKLPLTILPMLSVDIAETQVSVNRINKFLNSEELDPNSVLH-----DSSKPHPMSIE--NGEFSWG--DEITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKM-GEISESGTFDQLVKNKGAFADFI---IQHLQEGN-----------EEEEELNQIKRQISSTADVPELLGT---VEKAIKLARTES---------------------------LSDSISVTSADS------LMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTG---------------LRDM---YLGVYGAFGFGQGFTSFFSDLAPALGSLHAAKVLHSMLLENVLRAPMTMFDTTPVGRILSRFSKDVESVDQKMPQVINDCIWCAFEVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGG-QTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKN-WPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSV----------------------GQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSM 1541          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090022)

HSP 1 Score: 984.171 bits (2543), Expect = 0.000e+0
Identity = 562/1423 (39.49%), Postives = 848/1423 (59.59%), Query Frame = 3
Query:  678 PEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISH-NRKRYD-LLQNSTASVAHLMEDEDKLTNPDNRSPGWV-LFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNR-SDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTD-------RLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL---NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            PE+ AS LS++TY W D    K +R  + ++  +DLR QD  ++   I    +   ++ ++ N+ R +   Q S  +V      E+     + R  G   +   + + +G   L     K   D   +A P +L +++ +++ + ++  W G   A+         +      F    I+ +RIR ALI  IYRK LR++N  + + T GEIVNLM+VDA+R M    +     S PLQI LA+  L+Q++  ++ AGL +++   P+NG++ + ++ +   ++K+KD R+K++ E+L+GIKVLK+YAWE SF  ++ ++RD E+  +   +        LW   PFL+ L TF  YVL  E N++   K FVSL+LFN+LRFP+ +LP  +T+ +   VS+ RI ++L  EEL+   + H     DS+  +  +IE  +G FSW   D++TL NIN E+ +G LVA+VG VG+GKSS++ A LGEM ++ G V+  G +AYV Q+AWIQN ++++NILF Q Y+ K Y  +I+AC+L++D++ L  GD TEIGE+GINLSGGQKQR+SLARAVY + D+YLLDDPLSAVDAHVG+H+FE VI   GIL  K+R+LVTHG+ +LP+VD + V+   G ISE G+F  L+K+   F  F+   I+H                    +   + RQ+S   DV E +        A+ + R +S                             +S S    D       +M  G   R+ +K  D +         +   +   +L+E E++ +G V++A Y   IKS G++L +AT+ +   F   Q+ SN+WL  +  D ++ N +                +R+    Y+ +Y   G        F   + ++G +  S+++H+ LL   LR PME FDTTP GRI+NRFSKDI+ +D+++P NI   +   ++V A+I+VI   TP F   I+P+A LYY  Q FY+ TSRQ  RL+S++ SP+++HF+ET+ G + IRA+     F   +   +DK+   K+    + RWL++R+E++G L++  A LF+++G       LVGLS+SY+LQ+T+ LNWL+R  +++ETN V++ERI+EY +   EA W+L    N P + WP  G + F+++ +RYREGL LVL+ ++ +  GG+K+G+VGRTGAGKSSL LALFR++EAAGG I ID ++I+++GLH LR RLTI+PQDPV+FSG+LR NLDPF    DDEI+++LE +HL+S+V  L+ GL++E  EGG NLSV                      GQ+QL+CLARALLRK+KVL+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTILD+D ++V++ G+I+E  SP  LL      F S+
Sbjct:  225 PELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGNVTF----ENPHGEKNGRKKGMASIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLH-----DSSKPHPMSIE--NGEFSWG--DEITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKM-GEISESGTFDQLVKNKGAFADFI---IQHLQEGN-----------EEEEELNQIKRQISSTADVPELLGT---VEKAIKLARTES---------------------------LSDSISVTSADS------LMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTG---------------LRDM---YLGVYGAFGFGQVATNFFSSLAISLGCLKCSQLLHQTLLYYNLRWPMELFDTTPLGRIVNRFSKDIDTIDNVLPFNIRVVIGQAYMVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGG-QTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKN-WPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSV----------------------GQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSM 1541          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090023)

HSP 1 Score: 983.786 bits (2542), Expect = 0.000e+0
Identity = 564/1423 (39.63%), Postives = 846/1423 (59.45%), Query Frame = 3
Query:  678 PEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISH-NRKRYD-LLQNSTASVAHLMEDEDKLTNPDNRSPGWV-LFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNR-SDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTD-------RLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL---NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            PE+ AS LS++TY W D    K +R  + ++  +DLR QD  ++   I    +   ++ ++ N+ R +   Q S  +V      E+     + R  G   +   + + +G   L     K   D   +A P +L +++ +++ + ++  W G   A+         +      F    I+ +RIR ALI  IYRK LR++N  + + T GEIVNLM+VDA+R M    +     S PLQI LA+  L+Q++  ++ AGL +++   P+NG++ + ++ +   ++K+KD R+K++ E+L+GIKVLK+YAWE SF  ++ ++RD E+  +   +        LW   PFL+ L TF  YVL  E N++   K FVSL+LFN+LRFP+ +LP  +T+ +   VS+ RI ++L  EEL+   + H     DS+  +  +IE  +G FSW   D++TL NIN E+ +G LVA+VG VG+GKSS++ A LGEM ++ G V+  G +AYV Q+AWIQN ++++NILF Q Y+ K Y  +I+AC+L++D++ L  GD TEIGE+GINLSGGQKQR+SLARAVY + D+YLLDDPLSAVDAHVG+H+FE VI   GIL  K+R+LVTHG+ +LP+VD + V+   G ISE G+F  L+K+   F  F+   I+H                    +   + RQ+S   DV E +        A+ + R +S                             +S S    D       +M  G   R+ +K  D +         +   +   +L+E E++ +G V++A Y   IKS G++L +AT+ +   F   Q+ SN+WL  +  D ++ N +                +R+    Y+ +Y   G        F   +  +G I  SKV+H+ LL  V R PME FDTTP GR++NRFSKD++ +D+++PM     +S  F V A+I+VI   TP F   I+P+A LYY  Q FY+ TSRQ  RL+S++ SP+++HF+ET+ G + IRA+     F   +   +DK+   K+    + RWL++R+E++G L++  A LF+++G       LVGLS+SY+LQ+T+ LNWL+R  +++ETN V++ERI+EY +   EA W+L    N P + WP  G + F+++ +RYREGL LVL+ ++ +  GG+K+G+VGRTGAGKSSL LALFR++EAAGG I ID ++I+++GLH LR RLTI+PQDPV+FSG+LR NLDPF    DDEI+++LE +HL+S+V  L+ GL++E  EGG NLSV                      GQ+QL+CLARALLRK+KVL+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTILD+D ++V++ G+I+E  SP  LL      F S+
Sbjct:  225 PELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGNVTF----ENPHGEKNGRKKGMASIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLH-----DSSKPHPMSIE--NGEFSWG--DEITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKM-GEISESGTFDQLVKNKGAFADFI---IQHLQEGN-----------EEEEELNQIKRQISSTADVPELLGT---VEKAIKLARTES---------------------------LSDSISVTSADS------LMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTG---------------LRDM---YLGVYGAFGFGQVTSYFFCSLTLALGCIFCSKVLHETLLSYVFRWPMELFDTTPLGRVVNRFSKDVDTIDNVLPMLWRMVISQAFAVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGG-QTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKN-WPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSV----------------------GQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSM 1541          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090026)

HSP 1 Score: 979.163 bits (2530), Expect = 0.000e+0
Identity = 559/1423 (39.28%), Postives = 845/1423 (59.38%), Query Frame = 3
Query:  678 PEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISH-NRKRYD-LLQNSTASVAHLMEDEDKLTNPDNRSPGWV-LFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNR-SDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTD-------RLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL---NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            PE+ AS LS++TY W D    K +R  + ++  +DLR QD  ++   I    +   ++ ++ N+ R +   Q S  +V      E+     + R  G   +   + + +G   L     K   D   +A P +L +++ +++ + ++  W G   A+         +      F    I+ +RIR ALI  IYRK LR++N  + + T GEIVNLM+VDA+R M    +     S PLQI LA+  L+Q++  ++ AGL +++   P+NG++ + ++ +   ++K+KD R+K++ E+L+GIKVLK+YAWE SF  ++ ++RD E+  +   +        LW   PFL+ L TF  YVL  E N++   K FVSL+LFN+LRFP+ +LP  +T+ +   VS+ RI ++L  EEL+   + H     DS+  +  +IE  +G FSW   D++TL NIN E+ +G LVA+VG VG+GKSS++ A LGEM ++ G V+  G +AYV Q+AWIQN ++++NILF Q Y+ K Y  +I+AC+L++D++ L  GD TEIGE+GINLSGGQKQR+SLARAVY + D+YLLDDPLSAVDAHVG+H+FE VI   GIL  K+R+LVTHG+ +LP+VD + V+   G ISE G+F  L+K+   F  F+   I+H                    +   + RQ+S   DV E +        A+ + R +S                             +S S    D       +M  G   R+ +K  D +         +   +   +L+E E++ +G V++A Y   IKS G++L +AT+ +   F   Q+ SN+WL  +  D ++ N +                +R+    Y+ +Y   G    +         ++G + +++ +H  LL   LR PME FD TP GRI+NRFSKD++ +D+ +P+N+   +  LF V A+I+VI   TP F   I+P+A LYY  Q FY+ TSRQ  RL+S++ SP+++HF+ET+ G + IRA+     F   +   +DK+   K+    + RWL++R+E++G L++  A LF+++G       LVGLS+SY+LQ+T+ LNWL+R  +++ETN V++ERI+EY +   EA W+L    N P + WP  G + F+++ +RYREGL LVL+ ++ +  GG+K+G+VGRTGAGKSSL LALFR++EAAGG I ID ++I+++GLH LR RLTI+PQDPV+FSG+LR NLDPF    DDEI+++LE +HL+S+V  L+ GL++E  EGG NLSV                      GQ+QL+CLARALLRK+KVL+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTILD+D ++V++ G+I+E  SP  LL      F S+
Sbjct:  225 PELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGNVTF----ENPHGEKNGRKKGMASIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLH-----DSSKPHPMSIE--NGEFSWG--DEITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKM-GEISESGTFDQLVKNKGAFADFI---IQHLQEGN-----------EEEEELNQIKRQISSTADVPELLGT---VEKAIKLARTES---------------------------LSDSISVTSADS------LMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTG---------------LRDM---YLGVYGAFGFGQVVTGYLSTLILSLGCVYSARYMHNVLLHGTLRWPMEMFDITPLGRIVNRFSKDVDTIDNTLPLNLRVVILQLFAVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGG-QTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKN-WPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSV----------------------GQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSM 1541          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:ZFIN;Acc:ZDB-GENE-050517-16])

HSP 1 Score: 1006.9 bits (2602), Expect = 0.000e+0
Identity = 599/1550 (38.65%), Postives = 906/1550 (58.45%), Query Frame = 3
Query:  348 NSLIDGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSS----FSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNT-NILEKIFYDKIKISHNRKRYDLLQNST-------ASVAHLMEDEDK----LTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFG--VLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVL-WEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEY-----IEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKP-ISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWD-LNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSL 4919
             S I  +Y ++ +I+ +T++LA    +  R        +LFIFW  + +  ++     I+         +R          F   L+  +  CF+     FS   ++ PN   CPE  A  LS++T+ W      K ++  + ++  + L + D S      +L +   +K K +H+    ++ +  T       A   H+ E  ++    L+    +S       +L R +G   L+  AFK + D   +  P LL++L+ + +      W GY  A+AFL FG  +L +L  +  F    +  +R+R  +IG IYRK L + NE +   T GE+VNLMSVDA+R M+   F     S PLQI LA+  L+Q +  ++ AG+ ++V   P N  +    + +   ++K+KD RIK++ EILNGIKVLK+YAWE SF DKI  +R  E+ ++LR +A    +  + W   PFL+ L +F  +V   E N++  EKAFVSL+LFN+LRFP+ +LP  ++  + A VSLKR+  +L  +EL+   ++ +  T + A      + + +G FSW K D++ L+NIN  + +G L+A+VG VG GK+SLISA+LGEM +++G +S++G++AYV Q+AWIQN +L++NILF + Y E+ Y  ++EAC+L  DLE LPGGD TEIGE+GINLSGGQ+QRVSLARA+Y   D+YLLDDPLSAVDAHV +H+F++VI   G LK KTRILVTHG+++LP+V+ +LVL  +G +SE GS++DLL+    F +F++ Y     IE +    +    +    E AL    +++    DNE VV E     +   ++         +SN                                  D ++P+ M   S+ R+ S+     T     +P + +L++ E   +G VK   Y   +K+ G  L +    +Y   +   + +N WL  +T D+ + N +Q +L               QT+  + +Y  +G+   ++V F   +  +G I A++ +H+ LL +  ++P  FFDTTP+GRIINRFSKDI  +D ++P  +   L   F   +++IVII  TP FA  I PLA++Y+ +Q FY+ TSRQ +RL+S++ SP+++HF+E++ G ++IRA+     F  ++   +D++ K  +    S RWL +RIE +G  +V  A LF++ G+  L+  LVGLS+SY+LQ+T  LNW++R  ++LE+N VA+ER++EYS+  +EA W+ L   P   WP  GN+ F DY +RYREGL LVLKNI+L   GG+KIG+VGRTGAGKSS+ L LFRL+EAA G I+ID + IS IGLHDLR +LTI+PQ+PV+FSGTLR NLDPF  + D+E++++LE +HLQ +V+  +  L+ EC EGG NLSV                      GQ+QL+CLARALLRK+++L+LDEATA+VD+ETD L+  TIR  FQ  TV  IAHR+NTI+D   ++V++ G+I E D+P NL+      F    D  L
Sbjct:   95 GSKISPIYFVTPLIVGMTMLLATFLIQFERLKGVQSSGVLFIFWTLSVVFAIVPFRSKIMHANTEVKDKLR---FTTFYIYFSFTLLELILSCFNEKPPLFS-SAVMDPNV--CPETTAGFLSRMTFWWFTRMAIKGYKSPLENKDLWSLNKNDSSELVVPGLLNQWEVEKSK-AHSSDDQNVKEQVTFTKPGSGAESNHVNESPEEAEVLLSKQQQKSRQPSFLWALLRAFGPYFLIGSAFKLLQDLITFINPQLLRMLIAFTKQSDVPSWWGY--ALAFLMFGTSLLQTLILHQHFQYCFVTGMRLRTGIIGAIYRKALVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIFLALFFLWQNLGPSVLAGVAVMVLLIPFNAFIAMKTRTYQVEQMKYKDDRIKLMNEILNGIKVLKLYAWEPSFRDKILQIRQKEL-HVLRKTAYLSALSTMAWTSAPFLVALTSFAVFVNVDEKNVLDAEKAFVSLSLFNILRFPLNMLPQVISSIVQASVSLKRLQDFLNHDELDPESVDRKSNTTEYA------VSVVNGKFSWAKRDQVILDNINVLVPQGSLLAVVGHVGCGKTSLISALLGEMEKLDGQISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLLDDPLSAVDAHVAKHIFDHVIGPEGALKGKTRILVTHGISFLPQVNNILVL-VDGRVSEMGSYQDLLRQNGAFAEFLRNYSLEDIIEDDELTVSFDEEEEEFPEDALSNHTDMV----DNEPVVNEARRQFMRQMSI---------MSN----------------------------------DVENPKKM---SRRRRCSERKHPETPTEKKEPKVEKLIQAETTETGRVKLQVYWEYVKAIGPLLALFICFLYGCQSAAAIGANFWLSEWTNDA-LHNRTQEML---------------QTR--VGVYAALGISQGILVMFSSFTLALGKIQAARKLHQVLLENKFQTPQSFFDTTPTGRIINRFSKDIYVVDEVLPSTLLMFLGTFFASLSTMIVIISSTPVFAFVIAPLALIYFFVQRFYVATSRQLKRLESVSRSPIYSHFSESITGTSVIRAYGRNAAFVLMSDNKVDENQKSYYPGIVSNRWLGVRIEFIGNCIVLFAALFAVTGKDKLSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETQTEAPWEVLEKKPPPDWPPLGNVEFVDYSVRYREGLDLVLKNISLKVRGGEKIGIVGRTGAGKSSMTLCLFRLLEAAAGEIVIDDVKISEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFERYSDEEVWKALELSHLQKFVTNQAAKLELECSEGGENLSV----------------------GQRQLVCLARALLRKTRILVLDEATAAVDLETDDLIQSTIRTEFQDCTVFTIAHRLNTIMDYTRVLVLDKGQIAEFDTPTNLMNQKGLFFGMAKDAGL 1537          

HSP 2 Score: 73.559 bits (179), Expect = 2.674e-12
Identity = 67/250 (26.80%), Postives = 111/250 (44.40%), Query Frame = 3
Query: 4185 LVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVM-HTI--REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNN 4925
            ++L NIN+    G  + VVG  G GK+SL  AL   +E   G I              +R  +  +PQ   I + TLR+N+     + + +    LE   L   +  L  G   E GE G+NLS                       GQ+Q + LARAL  ++ V +LD+  ++VD    + +  H I      +  T I++ H I+ +   + I+V+ +G + E+ S ++LL  +    + L + SL +
Sbjct:  654 VILDNINVLVPQGSLLAVVGHVGCGKTSLISALLGEMEKLDGQI-------------SIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLS----------------------GGQRQRVSLARALYSEADVYLLDDPLSAVDAHVAKHIFDHVIGPEGALKGKTRILVTHGISFLPQVNNILVLVDGRVSEMGSYQDLLRQNGAFAEFLRNYSLED 868          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1523])

HSP 1 Score: 981.474 bits (2536), Expect = 0.000e+0
Identity = 572/1441 (39.69%), Postives = 863/1441 (59.89%), Query Frame = 3
Query:  678 PEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPD------------------------NRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSP----AVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            PE  A+ LS++T++W ++ ++K F++ +  E  +DL + D +       E +   ++K + N  +    +      A       K  + D                        +  P   L  ++ + +   LL +  FK + D   +A P LLK+++ + QN+    W GY  A+  +    + S+     F    IL +++R A++  +Y+K L ++N+ R + T+GEIVNLMS DA+R  +   F     SCPLQI L+I  L+ E+  ++ +GL ++V   P+NG L    ++F    +K+KD R+KI+ ++LNGIK+LK YAWE SF  ++  +R+ E++ + + +    V   ++   P L+ LATF  +V  S  NI+  EKAF S++LFN+LRFP+ +LP  ++  +   VS KR+ ++L G++L+ T + H         +  AA+ + +G+++W+++ +  L  ++ +I  G+LVA+VG VG+GK+SL+SA+LGE+H I G++++ G++AYV Q+AWIQN +LK+NILF    +E+ Y+ +I+AC+L+ DL+ LPG D+TEIGE+GINLSGGQKQRVSLARAVY + D+YLLDDPLSAVD+HVG+HLFE VI  NG+L+DKTRILVTHG+++LP VDE++VL  +G +SE GS++ L      F +F++ Y +  +   N        D+ A      +  ++    + +E   D    SP    +  ++R +S R S    + + S+                 NS +   +DP+                          DK   +L+E+E   +G VK++ Y   + + G W    +   Y       +  N+WL ++T+DS I+  +Q           +   IR+     + ++  +GL    +V F       GSI+AS+ +H  LL ++L+ PM FFDTTPSGRI+NRF+KDI  +D +IPM+    + CL  V  ++ VI   TP F   ++P+A++YY +Q FY+ TSRQ RRLDS++ SP+++HF ET+ G+++IRA+  Q  F   N+  ID++ K  +    S RWL++R+E LG L+VF A LF++I R SL + LVGLSISY+L +T+ LNWL+R  +ELETN VA+ER+REY++I +EA W  +  P D WP+ GNI F+DY +RYR  L LVL  +       +KIG+VGRTGAGKSSL   LFR+VEAA G I+ID I+I+T+GLHDLR RLTI+PQDPV+FSGTLR NLDPF +  D EI+  LE AHL+ +V GL  GL++E  EGG NLS+                      GQ+QLLCLARALLRKS++LILDEATA+VD+ETD L+  TIR  F   TV+ IAHR+NTILD+  ++V+++G+IVE DSP  LL+   G F S+ + +
Sbjct:  208 PEAKATFLSRITFNWFNSMVWKGFKRPLVQEDMWDLNKNDSTHFICQTFEDVMAKELKKARNNLQKKKSKKRKTVDAEGQNGLAKGVSQDVLVMETETEKESKKKKKKKQKDSDSDYPQSWLVTTIVKSFKGVLLESALFKLLQDLLSFASPQLLKLMIAFTQNKDSYAWTGYLYAVLLVLVAFVQSVVLQQYFQRCFILGMKVRTAIMAAVYKKALVVSNDSRKESTAGEIVNLMSADAQRFNDVTNFIHLLWSCPLQIALSIAFLWIELGPSVLSGLLVMVLMVPINGWLATKSRQFQMQNMKFKDSRMKIVNDLLNGIKILKYYAWETSFEAQVQEIREKELKVMRKFAYLSSVSTFIFSCAPALVSLATFAVFVSVSPDNILDAEKAFTSISLFNILRFPLAMLPQLISIMVQTSVSKKRLEKFLSGDDLDTTTVTHNS-------SITAAVSMTNGTYAWERDTEPVLKQVSLDIKPGRLVAVVGAVGSGKTSLVSALLGELHSIKGNININGSVAYVPQQAWIQNATLKDNILFGSSVDEERYQSVIKACALEPDLDLLPGRDQTEIGEKGINLSGGQKQRVSLARAVYSSADVYLLDDPLSAVDSHVGKHLFEKVIGPNGLLRDKTRILVTHGISFLPYVDEIVVL-VHGVVSEIGSYESLRASKGAFSEFLETYGKDESNKDN--------DKKAAAAQTPVYEEIETLPEGLETQAD---GSPEDIVSSTLKRENSLRHSQRHSKRNGSVKV-------------RKNSSLRAQKDPE--------------------------DKKGQRLIEKEMMETGRVKFSVYLQYLSAMGWWYVGFSFVFYFIQNVAVIGQNLWLSDWTDDS-IEYFNQT----------YPNHIRDTR---IGVFGALGLAQGFLVFFGTILLADGSISASRTLHTSLLTNILKVPMMFFDTTPSGRIVNRFAKDIFTVDEMIPMSFRSWILCLLGVLGTLFVICLATPIFTAVVVPMAVVYYFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYGHQDRFLKHNEDTIDQNLKSVYPWIVSNRWLAMRLESLGNLVVFFAALFAVISRDSLNSGLVGLSISYALNVTQTLNWLVRMTSELETNIVAVERVREYAEIQNEAPWVTSVRPPDDWPSAGNIRFEDYKVRYRPELELVLHGVTCDIQSTEKIGIVGRTGAGKSSLTNCLFRIVEAADGRILIDDIDIATLGLHDLRSRLTIIPQDPVLFSGTLRMNLDPFQTFSDAEIWSVLELAHLKEYVRGLPTGLEHEVSEGGENLSL----------------------GQRQLLCLARALLRKSRILILDEATAAVDLETDDLIQSTIRREFSHCTVLTIAHRLNTILDSSRVMVLDSGKIVEFDSPNELLS-KPGHFSSMAEDA 1553          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1523])

HSP 1 Score: 981.089 bits (2535), Expect = 0.000e+0
Identity = 574/1441 (39.83%), Postives = 864/1441 (59.96%), Query Frame = 3
Query:  678 PEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPD------------------------NRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSP----AVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            PE  A+ LS++T++W ++ ++K F++ +  E  +DL + D +       E +   ++K + N  +    +      A       K  + D                        +  P   L  ++ + +   LL +  FK + D   +A P LLK+++ + QN+    W GY  A+  +    + S+     F    IL +++R A++  +Y+K L ++N+ R + T+GEIVNLMS DA+R  +   F     SCPLQI L+I  L+ E+  ++ +GL ++V   P+NG L    ++F    +K+KD R+KI+ ++LNGIK+LK YAWE SF  ++  +R+ E++ + + +    V   ++   P L+ LATF  +V  S  NI+  EKAF S++LFN+LRFP+ +LP  ++  +   VS KR+ ++L G++L+ T + H     DS+    AA+ + +G+++W+++ +  L  ++ +I  G+LVA+VG VG+GK+SL+SA+LGE+H I G++++ G++AYV Q+AWIQN +LK+NILF    +E+ Y+ +I+AC+L  DL+ LPG D+TEIGE+GINLSGGQKQRVSLARAVY + D+YLLDDPLSAVD+HVG+HLFE VI  NG+L+DKTRILVTHG+++LP VDE++VL  +G +SE GS++ L      F +F++ Y +  +   N        D+ A      +  ++    + +E   D    SP    +  ++R +S R S    + + S+                 NS +   +DP+                          DK   +L+E+E   +G VK++ Y   + + G W    +   Y       +  N+WL ++T+DS I+  +Q           +   IR+     + ++  +GL    +V F       GSI+AS+ +H  LL ++L+ PM FFDTTPSGRI+NRF+KDI  +D +IPM+    + CL  V  ++ VI   TP F   ++P+A++YY +Q FY+ TSRQ RRLDS++ SP+++HF ET+ G+++IRA+  Q  F   N+  ID++ K  +    S RWL++R+E LG L+VF A LF++I R SL + LVGLSISY+L +T+ LNWL+R  +ELETN VA+ER+REY++I +EA W  +  P D WP+ GNI F+DY +RYR  L LVL  +       +KIG+VGRTGAGKSSL   LFR+VEAA G I+ID I+I+T+GLHDLR RLTI+PQDPV+FSGTLR NLDPF +  D EI+  LE AHL+ +V GL  GL++E  EGG NLS+                      GQ+QLLCLARALLRKS++LILDEATA+VD+ETD L+  TIR  F   TV+ IAHR+NTILD+  ++V+++G+IVE DSP  LL+   G F S+ + +
Sbjct:  194 PEAKATFLSRITFNWFNSMVWKGFKRPLVQEDMWDLNKNDSTHFICQTFEDVMAKELKKARNNLQKKKSKKRKTVDAEGQNGLAKGVSQDVLVMETETEKESKKKKKKKQKDSDSDYPQSWLVTTIVKSFKGVLLESALFKLLQDLLSFASPQLLKLMIAFTQNKDSYAWTGYLYAVLLVLVAFVQSVVLQQYFQRCFILGMKVRTAIMAAVYKKALVVSNDSRKESTAGEIVNLMSADAQRFNDVTNFIHLLWSCPLQIALSIAFLWIELGPSVLSGLLVMVLMVPINGWLATKSRQFQMQNMKFKDSRMKIVNDLLNGIKILKYYAWETSFEAQVQEIREKELKVMRKFAYLSSVSTFIFSCAPALVSLATFAVFVSVSPDNILDAEKAFTSISLFNILRFPLAMLPQLISIMVQTSVSKKRLEKFLSGDDLDTTTVTH-----DSSIT--AAVSMTNGTYAWERDTEPVLKQVSLDIKPGRLVAVVGAVGSGKTSLVSALLGELHSIKGNININGSVAYVPQQAWIQNATLKDNILFGSSVDEERYQSVIKACALGPDLDLLPGRDQTEIGEKGINLSGGQKQRVSLARAVYSSADVYLLDDPLSAVDSHVGKHLFEKVIGPNGLLRDKTRILVTHGISFLPYVDEIVVL-VHGVVSEIGSYESLRASKGAFSEFLETYGKDESNKDN--------DKKAAAAQTPVYEEIETLPEGLETQAD---GSPEDIVSSTLKRENSLRHSQRHSKRNGSVKV-------------RKNSSLRAQKDPE--------------------------DKKGQRLIEKEMMETGRVKFSVYLQYLSAMGWWYVGFSFVFYFIQNVAVIGQNLWLSDWTDDS-IEYFNQT----------YPNHIRDTR---IGVFGALGLAQGFLVFFGTILLADGSISASRTLHTSLLTNILKVPMMFFDTTPSGRIVNRFAKDIFTVDEMIPMSFRSWILCLLGVLGTLFVICLATPIFTAVVVPMAVVYYFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYGHQDRFLKHNEHTIDQNLKSVYPWIVSNRWLAMRLESLGNLVVFFAALFAVISRDSLNSGLVGLSISYALNVTQTLNWLVRMTSELETNIVAVERVREYAEIQNEAPWVTSVRPPDDWPSAGNIRFEDYKVRYRPELELVLHGVTCDIQSTEKIGIVGRTGAGKSSLTNCLFRIVEAADGRILIDDIDIATLGLHDLRSRLTIIPQDPVLFSGTLRMNLDPFQTFSDAEIWSVLELAHLKEYVRGLPTGLEHEVSEGGENLSL----------------------GQRQLLCLARALLRKSRILILDEATAAVDLETDDLIQSTIRREFSHCTVLTIAHRLNTILDSSRVMVLDSGKIVEFDSPNELLS-KPGHFSSMAEDA 1539          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc12 (ATP-binding cassette, sub-family C (CFTR/MRP), member 12 [Source:ZFIN;Acc:ZDB-GENE-050517-25])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 469/1447 (32.41%), Postives = 759/1447 (52.45%), Query Frame = 3
Query:  690 ASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMP-FLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSIL-------SIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDF-TDDSAFNYDAAIEIRDGSFSW---------------------KKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPG---SQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSM-CIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLN---ISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAF-KEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIG-RFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREY-SKIPSEAEWDLNNA--PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            A   S  ++SW+   +++ FR  + DE S  L   D +  N    ++++ +++       R  L + S ++V                         + R      +++     +  F+++  P  L+  +L Y++ +S+   + + + +    F     L E    F  S+L       ++R++ A   + ++K + L +      T GE +N+++ D  R+ + +IF  F L  P+ +++ II     + Y    G+ + + F P+   +  L+  F    +   D R++ + E+L  IK++KMYAWE+SF   IT++R  E   + +      +   L  I+P L  + TF+ +  TS    + P  A+  + +FN +R  M +LP+ +     A V+L R+ + ++ +       N + + T D   N D A+ +   +FSW                     K E + +L NI+  + +G L+ + G VG+GK+SLIS+IL +MH ++GSVS  GT+AYVSQ+AWI + ++++NIL  + ++E  Y  +I AC LK DL  LP GD+TEIGERGINLSGGQKQRVSLARAVY NRDI+LLDDPLSAVDAHVG+H+FE  I     LK K+ ILVTH L +                         L+ C+E M      I+          G H    S L K K    QL  N                V +++N+    S                        E+++S     ++PK+  I  P    S  +  + ET +++     K   QLV  E A  G+V W TY   C  + G  L    V ++    G   FSN WL  + +     N+S +   N   IS +P  S        +Y ++Y +I + M ++      +FT  ++ +S  +H  + + +L SPM FFDTTP+GR++NRFSKD + +D ++P N+ + L    IV  +++ I  V P+  IA++ L +++  I   +  + R  +R+++++ SP  +  T T+QG++ I A+ K QQY +   + L D +S    +  +  RWLS  +++L   +     LF ++    ++  SL GL++SY++Q+T  L +++R  TE+E    ++ER+ EY +   SE    + +A  P+  WP  G ITFK+Y +RYR+  P+VL N+N+    G+K+G+VGRTG+GKSSL +ALFRL E A G+I+ID ++I  +GL DLR +L+++PQDPV+F GT+R NLDPF+++KD+E++ +LE  +++  +S L E L     E G N SV                      G++QL+C+ARALLR SK+++LDEATAS+D ETD L+ HTIR+ FQ  T++ IAHRINT+L++D I+VM+ G+++E D P++L+   + +F SL
Sbjct:   72 AGFFSFTSFSWMTPMMWRLFRNRL-DEDSLFLSPHDGAHINGERFQRLWDEEVA------RVGLEKASLSAV-------------------------IMRFQKTRFIVSFLASVMFAFAVFVGPSILVYEILNYVE-QSEPSTVVHGVGVCVALF-----LTEFSKAFFASVLWAVNLRTAVRVKGAFSMLAFKKIISLRS--LTTITVGETINVLTSDGYRLFDAVIFGTFLLCVPVLLIICIIYACFILGYTALIGILVYLIFLPIQFSIARLIGVFRRRAVSVTDKRVRTMNEVLTCIKLIKMYAWEESFEKSITDIRKNEKLLLQKAGYVQSLNSSLTTIVPTLATIVTFIVH--TSLKLPLLPSTAYTIIAVFNCMRMSMGLLPFSVKAVAEAKVALTRLKRIMLVQ-------NPKGYLTQDK--NMDLALVMEKATFSWSPTDDKNTSQMPENPSQNGKHKAESQPSLRNISLTLSKGSLLGVCGNVGSGKTSLISSILEQMHLLSGSVSANGTLAYVSQQAWIFHGTVRDNILMGEPFDEARYASVINACCLKPDLAILPYGDQTEIGERGINLSGGQKQRVSLARAVYSNRDIFLLDDPLSAVDAHVGKHIFEECIKKE--LKGKSVILVTHQLQY-------------------------LEFCDEVMLLDNGEIKE--------AGTH----SDLMKTKGRYSQLITN----------------VHLEQNNERADSKPQT--------------------EHNDSEQTNPDEPKANGIENPAFDMSDEKPATNETPKDSSETKGKK-DQLVTREVAQEGSVTWRTYHQYCQAAGGYILLFLVVLLFTLLVGSTAFSNWWLSYWLDQGSGNNSSSNATSNSGNISENPDLS--------FYQMVYGVIIIAMIVLSILKGYTFTKVTLRSSSKLHDTMFKRILGSPMSFFDTTPTGRLVNRFSKDQDEVDAVLPFNMENFLQFCLIVTFTLLTICIVFPFLLIAVVILGLIFATILYVFQRSIRHMKRMENVSRSPWISLTTSTIQGLSTIHAYDKRQQYIERF-KMLSDNNSNHFMLFNAGTRWLSFWLDVLSATVTLIVSLFVVLSPNETINPSLKGLALSYTIQLTGILQFVVRLSTEVEAKFTSVERLLEYITSCVSEGPRRVKDANIPA-GWPQEGTITFKNYSMRYRDNTPIVLDNLNITIRPGEKLGIVGRTGSGKSSLGVALFRLAEPAEGTILIDDMDICKLGLKDLRSQLSVIPQDPVLFIGTVRYNLDPFNNYKDEELWLALEKTYMKDTISKLPEKLQSPVVENGENFSV----------------------GERQLMCMARALLRNSKIILLDEATASIDSETDSLIQHTIRDGFQHCTMLTIAHRINTVLESDRILVMDQGKVIEFDPPQDLIQRPNSLFASL 1359          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-15])

HSP 1 Score: 546.969 bits (1408), Expect = 5.384e-168
Identity = 316/850 (37.18%), Postives = 481/850 (56.59%), Query Frame = 3
Query:  348 NSLIDGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSS----FSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYD---KIKISHNRKRY-----------DLLQN-----------------STASVAHLMEDEDKLTNPDNRS-------------PGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDF--TDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESAL-GKAKNLLRQ 2744
             + +  +Y++S  +L +T++LA    +  R        ++  FWL   +   +     I+  L+  P ++           + L L++ +  C S     FS+   V+ +  PCPE  AS LSK+T+ W+   + K +++ + ++  + L  +D+S +    L + +     K+K S  R R+           DLLQN                 +  S       E K   P   S             P   LF +L R +G   L++  +K +HD  ++  P +L++L+ ++ + S   W GYF          L +L     F +  +  +R+R A++G +YRK L + N  R   T GEIVNLMSVDA+R M+ I +     S PLQ++LA+  L+Q +  ++ AG+ ++V   PLN ++    + +   ++K KD RIK++ E+LNGIKVLK+YAWE +F  K++ +R++E+R + +++    +    W   PFL+ L+TF  YVL  E NI+  +KAFVSL LFN+LRFP+ +LP  ++  + A VS++R+  +L  EEL+   +       T DS       I I DG+FSW K+D  TL  IN  I  G LVA+VG VG+GKSSL+SA+LGEMH+  GSVS++G++AYV Q+AWIQN +LK+NILF ++  + +Y+ ++EAC+L  DLE LPGGD TEIGE+G+NLSGGQKQRVS+ARAVY N  +YLLDDPLSAVDAHVG+H+FE VI   G+L+ +TR+LVTHGL++LP+ D +LV+  +G I+E GS+ +LL     F +F++ Y          S G  +  +    G    LLRQ
Sbjct:   99 GATVAPVYLVSPTMLGVTMLLATFLIQYERMKGVQSSGVMLNFWLITIVCATITFRSKIMHALN-DPASVGVFRYTTFYIYYTLLLISLILACLSDQPPLFSE---VVKDSNPCPESGASFLSKITFWWITGLMVKGYKRPLEEKDLWSLNNEDKSERVVPQLVRRWDQECVKVKRSDRRVRFLIVFSKTIKTVDLLQNWLILWLVYVFCARPVDKTLYSPKRSTRGEKKDGQPVEESEILLAKALQKTGEPS--LFFALCRTFGPYFLVSSLYKIIHDVLMFVGPEILRLLILFVNDSSAPTWHGYFYTALLFVCTCLQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGASVLAGVAVMVLMVPLNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKGKVSAIRESELRVLKKMAYLGAISTFTWVCAPFLVALSTFAVYVLVDENNILDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMQRLRVFLSHEELDDDNVERPAISGTPDS-------IRIADGAFSWSKDDPPTLKRINVSIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGSVSIKGSVAYVPQQAWIQNATLKDNILFGRETKDSWYQKVVEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSVARAVYCNCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGLLQGRTRVLVTHGLSFLPQADLILVM-VDGEITEMGSYTELLGRQGAFAEFLRTYTNTEQEEGEESLGDAVPRKGLENGGPAALLRQ 934          

HSP 2 Score: 222.631 bits (566), Expect = 4.193e-58
Identity = 138/394 (35.03%), Postives = 219/394 (55.58%), Query Frame = 3
Query: 2904 KYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSE 4085
            K  EN        +   S      G  +++     D    +      S+L E ++A +G VK + +   +K+ GL L I ++ ++       + SN WL  +T+D  + N                   + + +  + +Y  +G+   + V  Y  S +VG I AS+ +H+ +L +VLRSPM FF+ TPSG ++NRF+K+ + +D +IP  I   +  +F V  S  VI+  TP  AI I PL +LY+ +Q FY+ +SRQ +RL+S++ SPV+ HF ETL G ++IRAF EQQ F   +   +D + K  F    + RWL++R+E +G  +V  A LF+++ R +L+  ++GLSISY+LQ+T  LNWL+R  +ELETN VA+ER++EY     E
Sbjct:  921 KGLENGGPAALLRQSQISLNATGAGKTTQKTEANDDAAATKTKSAEASRLTEADKANTGRVKLSVFWEYMKAIGLPLSIFSIFLFFCHHLSSLGSNYWLSLWTDDPVVNNT------------------QPKREMRLGVYGALGISQGIAVFCYSVSVSVGGILASRYLHQTMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQMKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIKESDGRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARNNLSPGIMGLSISYALQVTASLNWLVRMSSELETNIVAVERVKEYGDTEKE 1296          

HSP 3 Score: 81.6481 bits (200), Expect = 6.962e-15
Identity = 79/299 (26.42%), Postives = 129/299 (43.14%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA--PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLA 4877
            LN L    + +    V+++R+R +    S  E D +N   P+ S   + +I   D    + +  P  LK IN+    G  + VVG  G+GKSSL  AL   +    GS+              ++  +  +PQ   I + TL++N+      KD    + +E   L   +  L  G   E GE GVNLS                       GQKQ + +ARA+     V +LD+  ++VD    + +   +   +   Q  T +++ H ++ +   D+I+VM +GEI E+ S   LL 
Sbjct:  631 LNMLPMVISSMVQASVSMQRLRVFL---SHEELDDDNVERPAISGTPD-SIRIADGAFSWSKDDPPTLKRINVSIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGSV-------------SIKGSVAYVPQQAWIQNATLKDNILFGRETKDSWYQKVVEACALLPDLEILPGGDTTEIGEKGVNLS----------------------GGQKQRVSVARAVYCNCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGLLQGRTRVLVTHGLSFLPQADLILVMVDGEITEMGSYTELLG 890          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 599/1531 (39.12%), Postives = 896/1531 (58.52%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXX------XXXMNFLTHCFSSFSKDRLVLPNKI-PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDES-TKNTNIL-----EKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFIS-LARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKN----PSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDK--PISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA-PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            +Y ++ +IL IT++ A + A+  R        +L IFW  AT+       C II        + R G +              L ++  L  CF         + ++I PCPE  A  LS+LT+ W        +++ + D+  + L   D S    TN++     EK    ++++S+++K   +L N T   A+    E  +   DN+ P    F+  L R +G   L+   FK   D   +  P LL IL+ +I+N+    W G+ +A+      ++ +L  +  F    +  +R+R+A+ G+IYRK+L + N  +   T GE+VNLMSVDA+R  +   F     S PLQI LA+  L+Q +  ++ AG+ ++V   P+N  +    + F   ++++KD RIK++ EILNGIKVLK+YAWE SF  K+  +R+ E+  + + +    +    W   PFL+ L TF  YV   E NI+  EKAFVSL+LFN+LRFP+ +LP  +++   A VS+KRI  +L  +EL+L  +     T D     +A I + +G+FSW K     L NIN  +  G LVA+VG+VG GKSSL+SA+LGEM +  G VSV+G++AYV Q+AWIQN +LK+NILF +  NEK Y+ ++EAC+L +DLE LPGGD+TEIGE+GINLSGGQKQRVSLARAV+ N D+YLLDDPLSAVDAHV +H+F+NVI  +G+L+ KTR+LVTHG+++LP+VD ++VL  +G ++E GS+++LLK    F +F++ Y   +   +     P   + L  E  L    +    L+DNE V  E     +   ++      SH +S                                              ++ R   K+  +N   L+ K  P  +L++ E   +G VK   +   +K+ GL + +    +Y+      + +N+WL ++T +  I    Q+                  T+  + +Y  +G+   L+V     S  +  I A++ +H  LL + + +P  F+DTTP GRIINRFSKDI  +D +IP  I   L+  F   +++IVI+  TP FA+ IIPLAI Y  +Q FY+ TSRQ +RL+S++ SP+++HF+ET+ G ++IRA+  Q  F  L+   +D++ K  +    S RWL +R+E +G  +V  A LF+++GR  L+  LVGLS+SY+LQ+T  LNW++R  ++LETN VA+ER++EY++  +EA W + +  P + WP+ G +   +Y +RYR GL LVLKN+NL  +GG+K+G+VGRTGAGKSS+ L LFR++E A G + ID +NIS IGL DLR RLTI+PQDPV+FSGTLR NLDPF+ + DDEI+++LE ++L+ +V+G    L+YEC EGG NLSV                      GQ+QL+CLARALLRK+++LILDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ G I E D+P NL+A+  GIF
Sbjct:  104 VYFVTPLILGITMITATVLAQYERLRGVQSSGVLIIFWFLATV-------CAIIPFRSKVMASARQGQVTDKFRFTTFFLYFSLLVIELLLSCFKEARPFFSPVRDEINPCPESDAGFLSRLTFWWFTKMAILGYKRPLEDKDLWSLNEDDTSNVVVTNLIKEWEKEKSNLAQMQVSYSKKPEAVL-NHTDEKAY----ESDVLIVDNKKPKEPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCIAVLMFLTSLVQTLILHQHFQYCFVTGMRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFLANDELDLNAV-----TKDKTLPGNA-ITVHNGTFSWAKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVL-VDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEVEEEDITIPDEEEVLLAEETLSTHTD----LADNEPVANEARKKFIRQISILSDGEPSHAMS----------------------------------------------TRRRFTEKKPSEN---LVAKQPPTEKLIQTETTETGRVKMTVFWQYMKAVGLAISVFICFLYSCQNAAAIGANVWLSDWTNEPVINQTQQN------------------TQMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKPPEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSV----------------------GQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIALK-GIF 1521          

HSP 2 Score: 88.5817 bits (218), Expect = 1.018e-16
Identity = 78/315 (24.76%), Postives = 137/315 (43.49%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNNDL 4931
            LN L +  + L    V+++RI+ +    +  E DLN    D       IT  +    + +    +L+NINL    G  + VVG+ G GKSSL  AL   +E   G +              +R  +  +PQ   I + TL++N+    +  +    + LE   L + +  L  G   E GE G+NLS                       GQKQ + LARA+   + V +LD+  ++VD    + +   +       +  T +++ H I+ +   D IVV+ +G + E+ S + LL  +    + L + + ++++
Sbjct:  590 LNMLPQVISNLAQASVSIKRIQNFL---ANDELDLNAVTKDKTLPGNAITVHNGTFSWAKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEV-------------SVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLS----------------------GGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEV 866          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 1002.66 bits (2591), Expect = 0.000e+0
Identity = 595/1534 (38.79%), Postives = 892/1534 (58.15%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXX------XXXMNFLTHCFSS----FSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDES-TKNTNIL-----EKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFIS-LARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKN----PSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDK--PISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA-PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            +Y ++ +IL IT++ A + A+  R        +L IFW  AT+       C II        + R G +              L ++  L  CF      FS  R  +    P  +    +L+    + L +Y     ++ + D+  + L   D S    TN++     EK    ++++S+++K   +L N T   A+    E  +   DN+ P    F+  L R +G   L+   FK   D   +  P LL IL+ +I+N+    W G+ +A+      ++ +L  +  F    +  +R+R+A+ G+IYRK+L + N  +   T GE+VNLMSVDA+R  +   F     S PLQI LA+  L+Q +  ++ AG+ ++V   P+N  +    + F   ++++KD RIK++ EILNGIKVLK+YAWE SF  K+  +R+ E+  + + +    +    W   PFL+ L TF  YV   E NI+  EKAFVSL+LFN+LRFP+ +LP  +++   A VS+KRI  +L  +EL+L  +     T D     +A I + +G+FSW K     L NIN  +  G LVA+VG+VG GKSSL+SA+LGEM +  G VSV+G++AYV Q+AWIQN +LK+NILF +  NEK Y+ ++EAC+L +DLE LPGGD+TEIGE+GINLSGGQKQRVSLARAV+ N D+YLLDDPLSAVDAHV +H+F+NVI  +G+L+ KTR+LVTHG+++LP+VD ++VL  +G ++E GS+++LLK    F +F++ Y   +   +     P   + L  E  L    +    L+DNE V  E     +   ++      SH +S                                              ++ R   K+  +N   L+ K  P  +L++ E   +G VK   +   +K+ GL + +    +Y+      + +N+WL ++T +  I    Q+                  T+  + +Y  +G+   L+V     S  +  I A++ +H  LL + + +P  F+DTTP GRIINRFSKDI  +D +IP  I   L+  F   +++IVI+  TP FA+ IIPLAI Y  +Q FY+ TSRQ +RL+S++ SP+++HF+ET+ G ++IRA+  Q  F  L+   +D++ K  +    S RWL +R+E +G  +V  A LF+++GR  L+  LVGLS+SY+LQ+T  LNW++R  ++LETN VA+ER++EY++  +EA W + +  P + WP+ G +   +Y +RYR GL LVLKN+NL  +GG+K+G+VGRTGAGKSS+ L LFR++E A G + ID +NIS IGL DLR RLTI+PQDPV+FSGTLR NLDPF+ + DDEI+++LE ++L+ +V+G    L+YEC EGG NLSV                      GQ+QL+CLARALLRK+++LILDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ G I E D+P NL+A+  GIF
Sbjct:  107 VYFVTPLILGITMITATVLAQYERLRGVQSSGVLIIFWFLATV-------CAIIPFRSKVMASARQGQVTDKFRFTTFFLYFSLLVIELLLSCFKEARPFFSPVRDEIVRISPYFKKEVHLLAHTRLALLHSY-----KRPLEDKDLWSLNEDDTSNVVVTNLIKEWEKEKSNLAQMQVSYSKKPEAVL-NHTDEKAY----ESDVLIVDNKKPKEPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCIAVLMFLTSLVQTLILHQHFQYCFVTGMRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFLANDELDLNAV-----TKDKTLPGNA-ITVHNGTFSWAKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVL-VDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEVEEEDITIPDEEEVLLAEETLSTHTD----LADNEPVANEARKKFIRQISILSDGEPSHAMS----------------------------------------------TRRRFTEKKPSEN---LVAKQPPTEKLIQTETTETGRVKMTVFWQYMKAVGLAISVFICFLYSCQNAAAIGANVWLSDWTNEPVINQTQQN------------------TQMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKPPEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSV----------------------GQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIALK-GIF 1522          

HSP 2 Score: 88.1965 bits (217), Expect = 1.117e-16
Identity = 78/315 (24.76%), Postives = 137/315 (43.49%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNNDL 4931
            LN L +  + L    V+++RI+ +    +  E DLN    D       IT  +    + +    +L+NINL    G  + VVG+ G GKSSL  AL   +E   G +              +R  +  +PQ   I + TL++N+    +  +    + LE   L + +  L  G   E GE G+NLS                       GQKQ + LARA+   + V +LD+  ++VD    + +   +       +  T +++ H I+ +   D IVV+ +G + E+ S + LL  +    + L + + ++++
Sbjct:  591 LNMLPQVISNLAQASVSIKRIQNFL---ANDELDLNAVTKDKTLPGNAITVHNGTFSWAKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEV-------------SVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLS----------------------GGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEV 867          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 1000.73 bits (2586), Expect = 0.000e+0
Identity = 594/1535 (38.70%), Postives = 890/1535 (57.98%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXX------XXXMNFLTHCFSSFSKDRLVLPNKI-PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDES-TKNTNIL---EKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFIS-LARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLT-LN-----NINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKN----PSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDK--PISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA-PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            +Y ++ +IL IT++ A + A+  R        +L IFW  AT+       C II        + R G +              L ++  L  CF         + ++I PCPE  A  LS+LT+ W        +++ + D+  + L   D S    TN++   EK   + +++S+++K   +L N T   A+    E  +   DN+ P    F+  L R +G   L+   FK   D   +  P LL IL+ +I+N+    W G+ +A+      ++ +L  +  F    +  +R+R+A+ G+IYRK+L + N  +   T GE+VNLMSVDA+R  +   F     S PLQI LA+  L+Q +  ++ AG+ ++V   P+N  +    + F   ++++KD RIK++ EILNGIKVLK+YAWE SF  K+  +R+ E+  + + +    +    W   PFL+ L TF  YV   E NI+  EKAFVSL+LFN+LRFP+ +LP  +++   A VS+KRI  +L  +EL+L  +                   +D +   K E   + LN     NIN  +  G LVA+VG+VG GKSSL+SA+LGEM +  G VSV+G++AYV Q+AWIQN +LK+NILF +  NEK Y+ ++EAC+L +DLE LPGGD+TEIGE+GINLSGGQKQRVSLARAV+ N D+YLLDDPLSAVDAHV +H+F+NVI  +G+L+ KTR+LVTHG+++LP+VD ++VL  +G ++E GS+++LLK    F +F++ Y   +   +     P   + L  E  L    +    L+DNE V  E     +   ++      SH +S                                              ++ R   K+  +N   L+ K  P  +L++ E   +G VK   +   +K+ GL + +    +Y+      + +N+WL ++T +  I    Q+                  T+  + +Y  +G+   L+V     S  +  I A++ +H  LL + + +P  F+DTTP GRIINRFSKDI  +D +IP  I   L+  F   +++IVI+  TP FA+ IIPLAI Y  +Q FY+ TSRQ +RL+S++ SP+++HF+ET+ G ++IRA+  Q  F  L+   +D++ K  +    S RWL +R+E +G  +V  A LF+++GR  L+  LVGLS+SY+LQ+T  LNW++R  ++LETN VA+ER++EY++  +EA W + +  P + WP+ G +   +Y +RYR GL LVLKN+NL  +GG+K+G+VGRTGAGKSS+ L LFR++E A G + ID +NIS IGL DLR RLTI+PQDPV+FSGTLR NLDPF+ + DDEI+++LE ++L+ +V+G    L+YEC EGG NLSV                      GQ+QL+CLARALLRK+++LILDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ G I E D+P NL+A+  GIF
Sbjct:   95 VYFVTPLILGITMITATVLAQYERLRGVQSSGVLIIFWFLATV-------CAIIPFRSKVMASARQGQVTDKFRFTTFFLYFSLLVIELLLSCFKEARPFFSPVRDEINPCPESDAGFLSRLTFWWFTKMAILGYKRPLEDKDLWSLNEDDTSNVVVTNLIKEWEKEKSNLMQVSYSKKPEAVL-NHTDEKAY----ESDVLIVDNKKPKEPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCIAVLMFLTSLVQTLILHQHFQYCFVTGMRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFLANDELDLNAVT------------------KDKTLPGKDEGNCSDLNVIKCYNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVL-VDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEVEEEDITIPDEEEVLLAEETLSTHTD----LADNEPVANEARKKFIRQISILSDGEPSHAMS----------------------------------------------TRRRFTEKKPSEN---LVAKQPPTEKLIQTETTETGRVKMTVFWQYMKAVGLAISVFICFLYSCQNAAAIGANVWLSDWTNEPVINQTQQN------------------TQMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKPPEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSV----------------------GQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIALK-GIF 1504          

HSP 2 Score: 79.337 bits (194), Expect = 6.452e-14
Identity = 77/316 (24.37%), Postives = 135/316 (42.72%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSD-SWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNNDL 4931
            LN L +  + L    V+++RI+ +    +  E DLN    D + P        D ++       +   NINL    G  + VVG+ G GKSSL  AL   +E   G +              +R  +  +PQ   I + TL++N+    +  +    + LE   L + +  L  G   E GE G+NLS                       GQKQ + LARA+   + V +LD+  ++VD    + +   +       +  T +++ H I+ +   D IVV+ +G + E+ S + LL  +    + L + + ++++
Sbjct:  579 LNMLPQVISNLAQASVSIKRIQNFL---ANDELDLNAVTKDKTLPGKDEGNCSDLNV-------IKCYNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEV-------------SVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLS----------------------GGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEV 849          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 999.964 bits (2584), Expect = 0.000e+0
Identity = 589/1525 (38.62%), Postives = 892/1525 (58.49%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXX------XXXMNFLTHCFSSFSKDRLVLPNKI-PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDES-TKNTNIL---EKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFIS-LARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDK--PISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA-PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            +Y ++ +IL IT++ A + A+  R        +L IFW  AT+       C II        + R G +              L ++  L  CF         + ++I PCPE  A  LS+LT+ W        +++ + D+  + L   D S    TN++   EK   + +++S+++K   +L N T   A+    E  +   DN+ P    F+  L R +G   L+   FK   D   +  P LL IL+ +I+N+    W G+ +A+      ++ +L  +  F    +  +R+R+A+ G+IYRK+L + N  +   T GE+VNLMSVDA+R  +   F     S PLQI LA+  L+Q +  ++ AG+ ++V   P+N  +    + F   ++++KD RIK++ EILNGIKVLK+YAWE SF  K+  +R+ E+  + + +    +    W   PFL+ L TF  YV   E NI+  EKAFVSL+LFN+LRFP+ +LP  +++   A VS+KRI  +L  +EL+L  +     T D            D +++   +    +++IN  +  G LVA+VG+VG GKSSL+SA+LGEM +  G VSV+G++AYV Q+AWIQN +LK+NILF +  NEK Y+ ++EAC+L +DLE LPGGD+TEIGE+GINLSGGQKQRVSLARAV+ N D+YLLDDPLSAVDAHV +H+F+NVI  +G+L+ KTR+LVTHG+++LP+VD ++VL  +G ++E GS+++LLK    F +F++ Y   ++  +       L++E+      +    L+DNE V  E     +   ++      SH +S                                              ++ R   K+  +N   L+ K  P  +L++ E   +G VK   +   +K+ GL + +    +Y+      + +N+WL ++T +  I    Q+                  T+  + +Y  +G+   L+V     S  +  I A++ +H  LL + + +P  F+DTTP GRIINRFSKDI  +D +IP  I   L+  F   +++IVI+  TP FA+ IIPLAI Y  +Q FY+ TSRQ +RL+S++ SP+++HF+ET+ G ++IRA+  Q  F  L+   +D++ K  +    S RWL +R+E +G  +V  A LF+++GR  L+  LVGLS+SY+LQ+T  LNW++R  ++LETN VA+ER++EY++  +EA W + +  P + WP+ G +   +Y +RYR GL LVLKN+NL  +GG+K+G+VGRTGAGKSS+ L LFR++E A G + ID +NIS IGL DLR RLTI+PQDPV+FSGTLR NLDPF+ + DDEI+++LE ++L+ +V+G    L+YEC EGG NLSV                      GQ+QL+CLARALLRK+++LILDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ G I E D+P NL+A+  GIF
Sbjct:  124 VYFVTPLILGITMITATVLAQYERLRGVQSSGVLIIFWFLATV-------CAIIPFRSKVMASARQGQVTDKFRFTTFFLYFSLLVIELLLSCFKEARPFFSPVRDEINPCPESDAGFLSRLTFWWFTKMAILGYKRPLEDKDLWSLNEDDTSNVVVTNLIKEWEKEKSNLMQVSYSKKPEAVL-NHTDEKAY----ESDVLIVDNKKPKEPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCIAVLMFLTSLVQTLILHQHFQYCFVTGMRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFLANDELDLNAV-----TKDKTLPGKDEGNCSDLNYTLHFKPFCFIHSINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVL-VDGRVTEMGSYQELLKQNGAFSEFLRNY-AFDDEVEEEDITILLAEETL-----STHTDLADNEPVANEARKKFIRQISILSDGEPSHAMS----------------------------------------------TRRRFTEKKPSEN---LVAKQPPTEKLIQTETTETGRVKMTVFWQYMKAVGLAISVFICFLYSCQNAAAIGANVWLSDWTNEPVINQTQQN------------------TQMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKPPEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSV----------------------GQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIALK-GIF 1534          

HSP 2 Score: 83.9593 bits (206), Expect = 2.499e-15
Identity = 80/319 (25.08%), Postives = 142/319 (44.51%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSD-SWP--NNGNITFKDYDLRYREGLPLV-LKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNNDL 4931
            LN L +  + L    V+++RI+ +    +  E DLN    D + P  + GN +  +Y L ++   P   + +INL    G  + VVG+ G GKSSL  AL   +E   G +              +R  +  +PQ   I + TL++N+    +  +    + LE   L + +  L  G   E GE G+NLS                       GQKQ + LARA+   + V +LD+  ++VD    + +   +       +  T +++ H I+ +   D IVV+ +G + E+ S + LL  +    + L + + ++++
Sbjct:  608 LNMLPQVISNLAQASVSIKRIQNFL---ANDELDLNAVTKDKTLPGKDEGNCSDLNYTLHFK---PFCFIHSINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEV-------------SVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLS----------------------GGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEV 885          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 971.459 bits (2510), Expect = 0.000e+0
Identity = 584/1527 (38.24%), Postives = 878/1527 (57.50%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPC-----PEVYASILSKLTYSWLDAYIYKW----FRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFIS-LARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKN----PSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDK--PISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA-PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            +Y ++ +IL IT++ A + A+  R        +L IFW  AT+       C II        + R G +               T  F  FS   LV+   + C     P    S +S+     +    ++     +++ + D+  + L   D S    N+   +  + IK     K+  L  N T   A+    E  +   DN+ P    F+  L R +G   L+   FK   D   +  P LL IL+ +I+N+    W G+ +A+      ++ +L  +  F    +  +R+R+A+ G+IYRK+L + N  +   T GE+VNLMSVDA+R  +   F     S PLQI LA+  L+Q +  ++ AG+ ++V   P+N  +    + F   ++++KD RIK++ EILNGIKVLK+YAWE SF  K+  +R+ E+  + + +    +    W   PFL+ L TF  YV   E NI+  EKAFVSL+LFN+LRFP+ +LP  +++   A VS+KRI  +L  +EL+L  +     T D            D +++   +    +++IN  +  G LVA+VG+VG GKSSL+SA+LGEM +  G VSV+G++AYV Q+AWIQN +LK+NILF +  NEK Y+ ++EAC+L +DLE LPGGD+TEIGE+GINLSGGQKQRVSLARAV+ N D+YLLDDPLSAVDAHV +H+F+NVI  +G+L+ KTR+LVTHG+++LP+VD ++VL  +G ++E GS+++LLK    F +F++ Y   +   +     P   + L  E  L    +    L+DNE V  E     +   ++      SH +S                                              ++ R   K+  +N   L+ K  P  +L++ E   +G VK   +   +K+ GL + +    +Y+      + +N+WL ++T +  I    Q+                  T+  + +Y  +G+   L+V     S  +  I A++ +H  LL + + +P  F+DTTP GRIINRFSKDI  +D +IP  I   L+  F   +++IVI+  TP FA+ IIPLAI Y  +Q FY+ TSRQ +RL+S++ SP+++HF+ET+ G ++IRA+  Q  F  L+   +D++ K  +    S RWL +R+E +G  +V  A LF+++GR  L+  LVGLS+SY+LQ+T  LNW++R  ++LETN VA+ER++EY++  +EA W + +  P + WP+ G +   +Y +RYR GL LVLKN+NL  +GG+K+G+VGRTGAGKSS+ L LFR++E A G + ID +NIS IGL DLR RLTI+PQDPV+FSGTLR NLDPF+ + DDEI+++LE ++L+ +V+G    L+YEC EGG NLSV                      GQ+QL+CLARALLRK+++LILDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ G I E D+P NL+A+  GIF
Sbjct:  104 VYFVTPLILGITMITATVLAQYERLRGVQSSGVLIIFWFLATV-------CAIIPFRSKVMASARQGQVTDKFR---------FTTFFLYFS--LLVIELLLSCFKEARPHSCLSYISEYGVMMVCFVAFRMAILGYKRPLEDKDLWSLNEDDTS----NV---VVTNLIKEWEKEKKAVL--NHTDEKAY----ESDVLIVDNKKPKEPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCIAVLMFLTSLVQTLILHQHFQYCFVTGMRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFLANDELDLNAV-----TKDKTLPGKDEGNCSDLNYTLHFKPFCFIHSINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVL-VDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEVEEEDITIPDEEEVLLAEETLSTHTD----LADNEPVANEARKKFIRQISILSDGEPSHAMS----------------------------------------------TRRRFTEKKPSEN---LVAKQPPTEKLIQTETTETGRVKMTVFWQYMKAVGLAISVFICFLYSCQNAAAIGANVWLSDWTNEPVINQTQQN------------------TQMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKPPEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSV----------------------GQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIALK-GIF 1499          

HSP 2 Score: 83.5741 bits (205), Expect = 2.700e-15
Identity = 80/319 (25.08%), Postives = 142/319 (44.51%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSD-SWP--NNGNITFKDYDLRYREGLPLV-LKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNNDL 4931
            LN L +  + L    V+++RI+ +    +  E DLN    D + P  + GN +  +Y L ++   P   + +INL    G  + VVG+ G GKSSL  AL   +E   G +              +R  +  +PQ   I + TL++N+    +  +    + LE   L + +  L  G   E GE G+NLS                       GQKQ + LARA+   + V +LD+  ++VD    + +   +       +  T +++ H I+ +   D IVV+ +G + E+ S + LL  +    + L + + ++++
Sbjct:  567 LNMLPQVISNLAQASVSIKRIQNFL---ANDELDLNAVTKDKTLPGKDEGNCSDLNYTLHFK---PFCFIHSINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEV-------------SVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLS----------------------GGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEV 844          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:MGI Symbol;Acc:MGI:102676])

HSP 1 Score: 1022.69 bits (2643), Expect = 0.000e+0
Identity = 598/1525 (39.21%), Postives = 903/1525 (59.21%), Query Frame = 3
Query:  372 IMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLL--DASPYNIRNGXXXXX-XXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILE---KIFYDKIKISHNRKRY----DLLQNSTASVAHLMEDEDKL---TNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLN-NAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            ++S  +L IT++LA    ++ RR       I+  FWL A +  L  L   II  L  DA     R+   +L    +    +++  + C   FS+    + ++ PCPE  AS LS++T+ W+   +   +R+ +     + L ++D S +   +L    K   DK +    R  Y    D  +   +S   + E+ + L   +   +R P   LF  L + +G   L++  +K +HD  ++A P +L++++ ++ +R    W GYF          L +LA +  F I  +  +RI+ A++G +YRK L + N  R   T GEIVNLMSVDA+R M+   +     S PLQ++LA+  L+  +  ++ AG+ +++   PLN ++    + +    +K KD RIK++ EILNGIKVLK+YAWE +F DK+ ++R  E++ + + +    V    W   PFL+ L+TF  +V   E NI+  +KAFVSL LFN+LRFP+ +LP  ++  + A VSLKR+  +L  EEL    I  R            +I +++ +F+W + +  TLN I F I  G LVA+VG+VG GKSSL+SA+L EM ++ G V+++G++AYV Q+AWIQN SL+ENILF     E +Y+ ++EAC+L  DLE LP GD TEIGE+G+NLSGGQKQRVSLARAVY N DIYL DDPLSAVDAHVG+H+FE V+   G+LK+KTRILVTHG+++LP+VD ++V+ S G ISE GS+++LL     F +F++ Y        N        D+S  G  K         E    E    V  +    +QR+    +SN+                       +S+SG    +      +   G++         + T +L++   +Q        +G V+ + Y   +K+ GL++   ++ ++       + SN WL  +T+D  + N +Q                     + + +Y  +G+     +  Y  + ++G I AS+ +H  LL +VLRSPM FF+ TPSG ++NRFSK+++ +D +IP  I   +  LF V  ++I+I+  TP  A+ I PL ++Y+ +Q FY+ +SRQ +RL+S++ SPV++HF ETL GV++IRAF+EQ+ F + +   +D++ K  +    + RWL++R+E +G  +V  A LF++I R SL+A LVGLS+SYSLQIT +LNWL+R  +E+ETN VA+ER++EYS+   EA W +   AP  +WP++G + F+DY LRYRE L LVLK+IN+   GG+K+G+VGRTGAGKSSL L LFR+ E+A G IIID +NI+ IGLH+LR ++TI+PQDPV+FSG+LR NLDPFS + D+E++ +LE AHL+ +VS L + L++EC EGG NLSV                      GQ+QL+CLARALLRK+K+L+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ GE+ E  +P  LL    GIF S+
Sbjct:  107 LVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALLCALAILRSKIISALKKDAHVDVFRDSTFYLYFTLVLVQLVLSCFSDCSPLFSE---TVHDRNPCPESSASFLSRITFWWITGMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEALIVKSPHKDREPS--LFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAPDWQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEG----NSITVKNATFTWARGEPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVM-SGGKISEMGSYQELLDRDGAFAEFLRTY-------ANAEQDLASEDDSVSGSGK---------ESKPVENGMLVTDTVGKHLQRH----LSNS-----------------------SSHSGDTSQQHSSIAELQKAGAK---------EETWKLMEADKAQ--------TGQVQLSVYWNYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDPPVVNGTQ-----------------ANRNFRLSVYGALGILQGAAIFGYSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSV----------------------GQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVRECGAPSELL-QQRGIFYSM 1521          

HSP 2 Score: 90.8929 bits (224), Expect = 1.203e-17
Identity = 75/275 (27.27%), Postives = 128/275 (46.55%), Query Frame = 3
Query: 1863 VSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQE 2648
            V+++R+ +Y   E+    +I  ++    S + +   +E RD    ++++  L L +IN  I  G+ V IVG+ G GKSSL   +        G + + G              I  + Q+  + + SL+ N+     Y+++     +E   LK  +  LP     E  E G NLS GQ+Q V LARA+ +   I +LD+  +AVD     +L ++ I      +D T + + H LN +     V+VLD  G + E G+  +LL+    F    ++
Sbjct: 1256 VAVERLKEYSETEKEAPWQI--QETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLET-DNLIQSTIRTQ--FEDCTVLTIAHRLNTIMDYTRVIVLD-KGEVRECGAPSELLQQRGIFYSMAKD 1524          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:MGI Symbol;Acc:MGI:1923658])

HSP 1 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 584/1520 (38.42%), Postives = 897/1520 (59.01%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDAS----PYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKI---PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDK-LTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEW--DLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            ++ ++ +++ IT++LA L  +  R        +L IFWL   I  ++     I+  L       P+             F L     +  CF    K  L  P  +   PCPE  A   S+L++ W        +R+ + D   + L  +D S K   +++++     K  +   R     + TA+    +  ED  L  P  +S       +L R +   LL++  F  + +   +  P LL IL+ +I + +   W G+ LA        + +L  +  +    ++++R+R A+IG+IYRK L + N ++ + T GE+VNLMSVDA+R M+   F     S PLQ++LAI  L+Q +  +  AG+ +IV   PLNG +   M+ +   ++K+KD RIK+++EILNGIKVLK+YAWE SFL+++  +R +E++ + + +    +   +W   PFL+ L T   YV   E N++  EKAFVSL+LFN+L+ P+ +LP  ++    A VSLKRI  +L   EL+   +  +  +   A      I I +G+F+W ++   TL+++N +I +G LVA+VG VG GKSSL+SA+LGEM ++ G VSV+G++AYV Q+AWIQN +L+EN+LF Q  N K Y+  +E C+L +DL+ LPGGD+TEIGE+GINLSGGQ+QRVSLARAVY + +I+LLDDPLSAVD+HV +H+F+ VI   G+L  KTR+LVTHG+++LP+ D ++VL + G +SE G +  LL+    F  F++ Y    ++  + +  Q+ ++E  L             ED +   TD     PA+   R    R  ++                        S+ G  ++      R M P   +  + KE          K    L++EE A +G VK + Y    KS GL   ++   +Y   +   + +N+WL  ++ D++ ++  Q+                 +T   + +Y  +G+   L+V     +  VG+I A++++H+ LL + +RSP  FFDTTPSGRI+NRFSKDI  +D ++   I   L+  F   ++I+VI+  TP F + ++PLA+LY  +Q FY+ TSRQ +RL+SI+ SP+F+HF+ET+ G ++IRA+   Q F+ L+ T +D + K  +   +S RWL + +E +G  +V  A LF++IGR SL   LVGLS+SY+LQ+T  LNW++R  ++LE+N +A+ER++EYSK  +EA W  + N AP + WP  G + F++Y +RYR GL LVLKN+ +H  GG+K+G+VGRTGAGKSS+ L LFR++EAA G I+ID +N++ IGLHDLR +LTI+PQDP++FSGTLR NLDPF  + +++I+++LE +HL ++VS    GLD++C EGG NLSV                      GQ+QL+CLARALLRKS+VL+LDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D + ++V++ G + E DSP NL+A + GIF
Sbjct:  104 VFFVTPLVVGITMLLATLLIQYERLRGVQSSGVLIIFWLLCVICAIIPFRSKILSALAEGKILDPFRFTT-----FYIYFALVFCALILSCFKE--KPPLFSPENLDTNPCPEASAGFFSRLSFWWFTRLAILGYRRPLEDRDLWSLSEEDCSHK---VVQRLLEAWQKQQNQASR-----SQTATAEPKIPGEDAVLLKPRPKSKQPSFLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWWGFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELDPQCVERKTISPGYA------ITIHNGTFTWAQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVL-AGGQVSEMGHYSALLQHDGSFANFLRNYAPDEDQEDHEAALQNANEEVLL------------LEDTLSTHTDLTDNEPAIYEVRKQFMREMSSL-----------------------SSEGEVQN------RTM-PKKHTNSLEKEALVTK----TKETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAAAIGANVWLSAWSNDAE-EHGQQN-----------------KTSVRLGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGFVQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAP-EGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTFVSSQPAGLDFQCAEGGDNLSV----------------------GQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIA-AGGIF 1513          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:MGI Symbol;Acc:MGI:1923658])

HSP 1 Score: 1011.91 bits (2615), Expect = 0.000e+0
Identity = 586/1520 (38.55%), Postives = 895/1520 (58.88%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDAS----PYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKI---PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDK-LTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEW--DLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            ++ ++ +++ IT++LA L  +  R        +L IFWL   I  ++     I+  L       P+             F L     +  CF    K  L  P  +   PCPE  A   S+L++ W        +R+ + D   + L  +D S K   +++++     K  +   R     + TA+    +  ED  L  P  +S       +L R +   LL++  F  + +   +  P LL IL+ +I + +   W G+ LA        + +L  +  +    ++++R+R A+IG+IYRK L + N ++ + T GE+VNLMSVDA+R M+   F     S PLQ++LAI  L+Q +  +  AG+ +IV   PLNG +   M+ +   ++K+KD RIK+++EILNGIKVLK+YAWE SFL+++  +R +E++ + + +    +   +W   PFL+ L T   YV   E N++  EKAFVSL+LFN+L+ P+ +LP  ++    A VSLKRI  +L   EL+   +  +  +   A      I I +G+F+W ++   TL+++N +I +G LVA+VG VG GKSSL+SA+LGEM ++ G VSV+G++AYV Q+AWIQN +L+EN+LF Q  N K Y+  +E C+L +DL+ LPGGD+TEIGE+GINLSGGQ+QRVSLARAVY + +I+LLDDPLSAVD+HV +H+F+ VI   G+L  KTR+LVTHG+++LP+ D ++VL + G +SE G +  LL+    F  F++ Y    ++           D  AL  A   +  L   ED +   TD     PA+   R    R  ++                        S+ G  ++      R M P   +  + KE          K    L++EE A +G VK + Y    KS GL   ++   +Y   +   + +N+WL  ++ D++ ++  Q+                 +T   + +Y  +G+   L+V     +  VG+I A++++H+ LL + +RSP  FFDTTPSGRI+NRFSKDI  +D ++   I   L+  F   ++I+VI+  TP F + ++PLA+LY  +Q FY+ TSRQ +RL+SI+ SP+F+HF+ET+ G ++IRA+   Q F+ L+ T +D + K  +   +S RWL + +E +G  +V  A LF++IGR SL   LVGLS+SY+LQ+T  LNW++R  ++LE+N +A+ER++EYSK  +EA W  + N AP + WP  G + F++Y +RYR GL LVLKN+ +H  GG+K+G+VGRTGAGKSS+ L LFR++EAA G I+ID +N++ IGLHDLR +LTI+PQDP++FSGTLR NLDPF  + +++I+++LE +HL ++VS    GLD++C EGG NLSV                      GQ+QL+CLARALLRKS+VL+LDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D + ++V++ G + E DSP NL+A + GIF
Sbjct:  104 VFFVTPLVVGITMLLATLLIQYERLRGVQSSGVLIIFWLLCVICAIIPFRSKILSALAEGKILDPFRFTT-----FYIYFALVFCALILSCFKE--KPPLFSPENLDTNPCPEASAGFFSRLSFWWFTRLAILGYRRPLEDRDLWSLSEEDCSHK---VVQRLLEAWQKQQNQASR-----SQTATAEPKIPGEDAVLLKPRPKSKQPSFLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWWGFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELDPQCVERKTISPGYA------ITIHNGTFTWAQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVL-AGGQVSEMGHYSALLQHDGSFANFLRNYAPDEDQ----------EDHEALQNANEEVLLL---EDTLSTHTDLTDNEPAIYEVRKQFMREMSSL-----------------------SSEGEVQN------RTM-PKKHTNSLEKEALVTK----TKETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAAAIGANVWLSAWSNDAE-EHGQQN-----------------KTSVRLGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGFVQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAP-EGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTFVSSQPAGLDFQCAEGGDNLSV----------------------GQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIA-AGGIF 1512          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:MGI Symbol;Acc:MGI:1352447])

HSP 1 Score: 969.148 bits (2504), Expect = 0.000e+0
Identity = 574/1432 (40.08%), Postives = 864/1432 (60.34%), Query Frame = 3
Query:  675 CPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHN--RKRYDLLQNSTASVAHLM-----EDEDKLTNPDNRS-----------PGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNED-------VVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLW--LFIATVAI--YAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLC--MTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLA 4877
             P   AS LS +T+SW D+ + K ++  +T E  +D+    ++   T+  + I    ++ +    ++R    Q S    +H +     + +D L   D++            P   L  +L + + + +L +   K  HD  ++  P LLK L+ ++++     W+GY  AI      ++ S      F    +L + +R  +I  +Y+K L L+N  R ++T GE VNLMSVD++++M+   +     S  LQI L+I  L++E+  +I AG+GL+V   P+NG+L   ++K     +K KD R+KI+ EIL+GIK+LK +AWE SF +++ ++R  E+R +LR S    ++  +  + P L+ + TF  YVL    N++  EKAF S+TLFN+LRFP+ +LP  ++  + A VS+ R+ QYL  ++L+L+ I H         ++D A++  + SF+W ++ + T+ ++N +I  G+LVA+VG VG+GKSSLISA+LGEM  ++G ++++G+IAYV Q+AWIQN ++K+NILF  +Y+EK Y+ +IEAC+L  DLE LPGGD  EIGE+GINLSGGQK RVSLARA YQ+ DIY+LDDPLSAVD HVG+H+F  V+  NG+L  KTRILVTHG+++LP+VDE++VL   G+I E+GS+ DL+     F +  + +++H+     P G   + ++             S+ ED        VEEI D    + ++ ++R +S R + +    S S        S  +K     N                         KE      +LI K   + VE     +G VK++ Y   +++ G W  LFI    +  Y AF G    +N+WL  +T DS+ QN + +       SP        Q    + ++  +G+   + L+    W+ +     NASK +H++LL ++LR+PM FFDTTP+GRI+NRF+ DI  +D  +P  +   L C F + +++++I   TP F I IIPL+ILY  +Q+FY+ TSRQ RRLDS+  SP+++HF+ET+ G+ +IRAF+ QQ F   ++  ID + K  F   +S RWL++R+E++G L+VF + L  +I + SLT   VG  +S +L IT+ LNWL+R  +E+ETN VA+ERI EY  + +EA W  +  P   WP  G I F +Y +RYR  L LVLK I  +    +K+GVVGRTGAGKSSL   LFR++E+AGG IIID I+I++IGLHDLR RLTI+PQDP++FSG LR NLDPF+ + D+EI+++LE AHL+S+V+GL  GL +E  EGG NLS+                      GQ+QLLCL RA+LRKSK+L+LDEATA+VD+ETD L+  TIR  F   TVI IAHR++TI+D+D I+V+++G+IVE  SP+ LL+
Sbjct:  192 APSATASFLSSVTFSWYDSTVLKGYKHPLTIEDVWDIEENLKAKSLTSKFKTIMTKDLQKARQALQRRLKKSQQSPEGTSHGLTKKQSQSQDVLVLEDSKKKKKKSEATKDFPKSWLVKALFKTFYVVILKSFILKLAHDILLFLNPQLLKFLIGFVKDPDSYPWVGYIYAILMFSVTLIQSFFLQCYFQFCFVLGMTVRTTIIASVYKKALTLSNLARRQYTIGETVNLMSVDSQKLMDVTNYIHLLWSSVLQIALSIFFLWRELGPSILAGVGLMVLLVPVNGVLATKIRKIQVQNMKNKDKRLKIMNEILSGIKILKYFAWEPSFKEQVNSIRKKELRNLLRFSQLQTILIFILHLTPTLVSVITFSVYVLVDSQNVLNAEKAFTSITLFNILRFPLAMLPMVISSVIQASVSVDRLEQYLGSDDLDLSAIRH-------VCHFDKAVQFSEASFTWDRDLEATIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIAYVPQQAWIQNGTIKDNILFGSEYDEKKYQRVIEACALLPDLEMLPGGDMAEIGEKGINLSGGQKHRVSLARATYQDADIYILDDPLSAVDTHVGKHIFNKVVGPNGLLSGKTRILVTHGIHFLPQVDEIVVL-GKGTILEKGSYSDLMDKKGVFAKNWKTFMKHS----GPEGEATVDND-------------SEEEDGDCGLIPTVEEIPD---DAASLTMRRENSLRRTLSRSSRSGSRRGKSLKSSLKIKSVNALN------------------------KKEEVVKGQKLIKK---EFVE-----TGKVKFSIYLKYLQAVGWWSLLFIVIFYVLNYVAFIG----TNLWLSAWTSDSEKQNGTDN-------SP-------SQRDMRIGVFGALGIAQGIFLLSSSLWSIYACR--NASKTLHRQLLTNILRAPMSFFDTTPTGRIVNRFAGDISTVDDTLPQTLRSWLLCFFGIVSTLVMICMATPIFIIIIIPLSILYVSVQVFYVATSRQLRRLDSVTKSPIYSHFSETVSGLPVIRAFEHQQRFLANSEKQIDTNQKCVFSWITSNRWLAIRLELVGNLIVFCSALLLVIYKNSLTGDTVGFVLSNALNITQTLNWLVRMTSEVETNIVAVERINEYINVDNEAPWVTDKKPPADWPKKGEIQFNNYQVRYRPELDLVLKGITCNIKSTEKVGVVGRTGAGKSSLTNCLFRILESAGGQIIIDGIDIASIGLHDLRGRLTIIPQDPILFSGNLRMNLDPFNKYSDEEIWRALELAHLKSFVAGLQLGLLHEVTEGGDNLSI----------------------GQRQLLCLGRAVLRKSKILVLDEATAAVDLETDSLIQTTIRNEFSQCTVITIAHRLHTIMDSDKIMVLDSGKIVEYGSPEELLS 1521          

HSP 2 Score: 78.9518 bits (193), Expect = 5.815e-14
Identity = 94/387 (24.29%), Postives = 168/387 (43.41%), Query Frame = 3
Query: 1548 TEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGL---TDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYD----AAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRIN-------------GSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQE 2648
            +E ++G+ V++ +  ++ FL       DT  + +     +   + +  E++  LI+  + L  V+    N +T +   V   L N L      L W +   ++     V+++RI +Y+  +       N   +  D     D      I+  +    ++ E  L L  I   I   + V +VG+ G GKSSL + +   +                 G   ++G +  + Q+  + + +L+ N+     Y+++     +E   LKS +  L  G   E+ E G NLS GQ+Q + L RAV +   I +LD+  +AVD      L +  I N       T I + H L+ +   D+++VLDS G I E GS ++LL +   F    +E
Sbjct: 1162 SETVSGLPVIRAFEHQQRFLANSEKQIDTNQKCVFSWITSNRWLAIRLELVGNLIVFCSALLLVIYK--NSLTGDT--VGFVLSNALNITQT-LNWLVRMTSEVETNIVAVERINEYINVD-------NEAPWVTDKKPPADWPKKGEIQFNNYQVRYRPELDLVLKGITCNIKSTEKVGVVGRTGAGKSSLTNCLFRILESAGGQIIIDGIDIASIGLHDLRGRLTIIPQDPILFSGNLRMNLDPFNKYSDEEIWRALELAHLKSFVAGLQLGLLHEVTEGGDNLSIGQRQLLCLGRAVLRKSKILVLDEATAAVDLET-DSLIQTTIRNE--FSQCTVITIAHRLHTIMDSDKIMVLDS-GKIVEYGSPEELLSNMGPFYLMAKE 1532          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc12 (ATP-binding cassette, sub-family C (CFTR/MRP), member 12 [Source:MGI Symbol;Acc:MGI:2441679])

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 465/1454 (31.98%), Postives = 749/1454 (51.51%), Query Frame = 3
Query:  672 PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNY-WIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEE-----------------LNLT-----EINHRD------------FTDDSAFNYDAAIEIRDG--SFSWKK-EDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLF-IATVAIYAAFTGLQVFSNIWLKNFTE-DSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREY--SKIPSEAE-WDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            P P   A +LS  T+SWL   + + ++  +T +T   L   D S  N                  KR+ +L           E+E K   P+  S G V++    R   L  ++A     V   +      L+  +L++I + S  +  IG  L +A         L     + I    +IR++ AL  +I+   L          ++GE++N++S D+  +    +F     + P+ +V+  +  +  +      G+ + + F P+   +  L   F    +   D R++ + E L  IK++KMYAWE+SF++ I ++R  E + + +          L  I+  + +++TF C++       +T   AF  + +FN+++F + +LP+ +     A VSL+R+ + L+ +                   N T     EIN +             F       Y        G  S  W+    K  L+NI+F + +GK++ I G VG+GKSSLISA+LG+M    G V+V G +AYVSQ+AWI + +++ENILF + YN + Y+  +  C L+ DL  LP GD TEIGERG+NLSGGQ+QR+SLARAVY NR +YLLDDPLSAVDAHVG+H+FE  I     LK KT +LVTH L +L   DEV++L+ +G I E+G+ K+L+++   + + +     HN R       +H+                  N  +VE + +    SPA   QR++   +++                               E ++ K P              ET++  D   + P  QL++ E    G V W TY   IK+ G +L     + ++    G   FS  WL  + +  S +  ASQ+   N +       +   +   Y ++Y    + + +       +FT  ++ AS  +H ++   ++RSPM FFDTTP+GR++NRFSKD++ LD  +P +  + L   F+V   ++++  V P   + +  LA+++ ++   +    ++ +++++I+ SP F+H T ++QG+ +I A+ ++    +  +TL D++S        ++RW +LR++IL  ++ F   L   +   S++AS  GLS+SY +Q++  L   +R  TE +    + E +REY  + +P     + +   P D WP+ G ITFKDY +RYR+  PLVL  +NL+   G+ +G+VGRTG+GKSSL +ALFRLVE A G+IIID+++I T+GL DLR +LT++PQDPV+F GT+R NLDP  SH D+ ++  LE   ++  +  L E L  E  E G N SV                      G++QLLC+ARALLR SK+++LDEATAS+D +TD LV  TI+E F++ TV+ IAHR+NT+L+ D+++VMENG+++E D P+ L    D  F  L
Sbjct:   43 PNPVDDAGLLSFATFSWLTPVMIRSYKHTLTVDTLPPLSPYDSSDINA-----------------KRFQIL----------WEEEIKRVGPEKASLGRVVW-KFQRTRVLMDVVANILCIV--MAALGPTVLIHQILQHITSISSGHIGIGICLCLALFTTEFTKVLFWALAWAINYRTAIRLKVALSTLIFENLLSFKT--LTHISAGEVLNILSSDSYSLFEAALFCPLPATIPILMVVCAVYAFFILGSTALVGISVYLIFIPIQMFMAKLNSTFRRSAISVTDKRVQTMNEFLTCIKLIKMYAWEESFINTIHDIRKREKKLLEKAGYVQSGNSALAPIVSTIAIVSTFTCHIFLKRK--LTAPVAFSVIAMFNVMKFSIAILPFSVKAVAEASVSLRRMKKILIAKSPPSYITQPEDPDTILLLANATLTWEQEINRKSDPPKAQIQKRHVFKKQRPELYSEQSRSDQGVASPEWQSGSPKSVLHNISFVVRKGKVLGICGNVGSGKSSLISALLGQMQLQKGVVAVNGPLAYVSQQAWIFHGNVRENILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQRISLARAVYANRQLYLLDDPLSAVDAHVGKHVFEECIKKT--LKGKTVVLVTHQLQFLESCDEVILLE-DGEICEKGTHKELMEERGRYAKLI-----HNLRGLQFKDPEHIY-----------------NVAMVETLKE----SPA---QRDEDAVLASGD-----------------------------EKDEGKEP--------------ETEEFVD--TNAPAHQLIQTESPQEGIVTWKTYHTYIKASGGYLVSFLVLCLFFLMMGSSAFSTWWLGIWLDRGSQVVCASQN---NKTACNVDQTLQDTKHHMYQLVYIASMVSVLMFGIIKGFTFTNTTLMASSSLHNRVFNKIVRSPMSFFDTTPTGRLMNRFSKDMDELDVRLPFHAENFLQQFFMVVFILVIMAAVFPVVLVVLAGLAVIFLILLRIFHRGVQELKQVENISRSPWFSHITSSIQGLGVIHAYDKKDDCISKFKTLNDENSSHLLYFNCALRWFALRMDILMNIVTFVVALLVTLSFSSISASSKGLSLSYIIQLSGLLQVCVRTGTETQAKFTSAELLREYILTCVPEHTHPFKVGTCPKD-WPSRGEITFKDYRMRYRDNTPLVLDGLNLNIQSGQTVGIVGRTGSGKSSLGMALFRLVEPASGTIIIDEVDICTVGLEDLRTKLTMIPQDPVLFVGTVRYNLDPLGSHTDEMLWHVLERTFMRDTIMKLPEKLQAEVTENGENFSV----------------------GERQLLCMARALLRNSKIILLDEATASMDSKTDTLVQSTIKEAFKSCTVLTIAHRLNTVLNCDLVLVMENGKVIEFDKPEVLAEKPDSAFAML 1359          

HSP 2 Score: 80.8777 bits (198), Expect = 1.607e-14
Identity = 65/250 (26.00%), Postives = 111/250 (44.40%), Query Frame = 3
Query: 4167 YREGLPL-VLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMH-TIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHD 4910
            ++ G P  VL NI+     GK +G+ G  G+GKSSL  AL   ++                G+  +   L  + Q   IF G +REN+     +       ++    LQ  ++ L  G   E GE GVNLS                       GQ+Q + LARA+    ++ +LD+  ++VD    + V    I++  +  TV+++ H++  +   D ++++E+GEI E  + K L+       K +H+
Sbjct:  488 WQSGSPKSVLHNISFVVRKGKVLGICGNVGSGKSSLISALLGQMQ-------------LQKGVVAVNGPLAYVSQQAWIFHGNVRENILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLS----------------------GGQRQRISLARAVYANRQLYLLDDPLSAVDAHVGKHVFEECIKKTLKGKTVVLVTHQLQFLESCDEVILLEDGEICEKGTHKELMEERGRYAKLIHN 702          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q8CG09|MRP1_RAT (Multidrug resistance-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Abcc1 PE=1 SV=2)

HSP 1 Score: 1041.18 bits (2691), Expect = 0.000e+0
Identity = 614/1537 (39.95%), Postives = 916/1537 (59.60%), Query Frame = 3
Query:  354 LIDGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLL--DASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFS---KDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKR---------YDLLQNSTASVAHLMEDEDKL---TNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAV--PIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLN-NAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            L+  + ++S  +L IT++LA    +  RR       I+  FWL A +  L  L   II  L  DA     R+   +L   + F   +  +  CFS  S    + +  PN  PCPE  AS LS++T+ W+   + + +R+ +     + L ++D S +   +L   +  K +   +RK+          D  +   +S   + E+ + L   ++  +R P   LF  L + +G   L++  +K +HD  ++A P +L++++ ++ +R    W GY           L +LA +  F I  +  +RI+ A++G +YRK L + N  R   T GEIVNLMSVDA+R M+   +     S PLQ+ LA+  L+  +  ++ AG+ +++   P N ++    + +    +K KD RIK++ EILNGIKVLK+YAWE +F DK+ N+R  E++ + + +    V    W   PFL+ L+TF  +V   E NI+  +KAFVSL LFN+LRFP+ +LP  ++  + A VSLKR+  +L  EEL    I      D    N   +I +++ +F+W +++  TLN I F I  G LVA+VG+VG GKSSL+SA+L EM ++ G V+++G++AYV Q+AWIQN SL+ENILF +   E  Y+ ++EAC+L  DLE LP GD TEIGE+G+NLSGGQKQRVSLARAVY N DIYLLDDPLSAVDAHVG+H+FE V+   G+LK+KTRILVTHG+++LP+VD ++V+ S G ISE GS+++LL     F +FV+ Y             Q L+ E     +KN +  L      VE   + +L + AV  P+QR+ S+  S++           +    +H    E   SGV E+                                   +L+E ++A +G VK + Y   +K+ GL +   ++ ++       + SN WL  +T+D    N +Q                 E   + + +Y  +G+   + V  Y  + ++G I AS+ +H  LL++VLRSPM FF+ TPSG ++NRFSK+++ +D +IP  I   +  LF V  ++I+I+  TP  A+ I PL ++Y+ +Q FY+ +SRQ +RL+S++ SPV++HF ETL GV++IRAF+EQ+ F   +   +D++ K  +    + RWL++R+E +G  +V  A LF++I R SL+A LVGLS+SYSLQIT +LNWL+R  +E+ETN VA+ER++EYS+   EA W +   AP  +WP++G + F+DY LRYRE L LVLK+IN+   GG+K+G+VGRTGAGKSSL L LFR+ E+A G IIID INI+ IGLH+LR ++TI+PQDPV+FSG+LR NLDPFS + D+E++ +LE AHL+ +VS L + L++EC EGG NLSV                      GQ+QL+CLARALLRK+K+L+LDEATA+VD+ETD L+  TIR  F+ STV+ IAHR+NTI+D   ++V++ GEI E  +P  LL    G+F S+
Sbjct:  101 LLAPVLLVSPTLLGITMLLATFLIQFERRKGVQSSGIMLTFWLVALLCALAILRSKIISALKKDAQVDMFRDSAFYLYFTLVF---IQLVLSCFSDSSPLFSETVRDPN--PCPESSASFLSRITFWWITGMMVQGYRQPLKSSDLWSLNKEDTSEEVVPVLVNNW--KKECVKSRKQPVRIVYAPPKDPTKPKGSSQLDVNEEVEALIVKSSHKDRDPS--LFKVLYKTFGPYFLMSFLYKALHDLMMFAGPEILELIINFVNDREAPDWQGYLYTALLFVSACLQTLALHQYFHICFVTGMRIKTAVVGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVTLALYFLWLNLGPSVLAGVAVMILMVPFNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMNIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDEKNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERWSIKDGGGMN---SITVKNATFTWARDEPPTLNGITFAIPDGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGRPLQEHCYKAVMEACALLPDLEILPSGDLTEIGEKGVNLSGGQKQRVSLARAVYCNSDIYLLDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVM-SGGKISEMGSYQELLDRDGAFAEFVRTYANTE---------QDLASED---DSKNGVSGLGKESKPVE---NGILVTDAVGKPLQRHLSNSSSHS-----------VVTNQQHSSTAELQKSGVKEE---------------------------------TWKLMEADKAQTGQVKLSVYWNYMKAIGLCISFLSIFLFLCNHVSALASNYWLSLWTDDRPAVNGTQ-----------------ENRNFRLSVYGALGILQGVAVFGYSMAVSIGGIFASRRLHLDLLQNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEASWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSV----------------------GQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDSTVLTIAHRLNTIMDYTRVIVLDKGEIRECGAPSELL-QQRGVFYSM 1525          

HSP 2 Score: 91.6633 bits (226), Expect = 5.811e-17
Identity = 76/275 (27.64%), Postives = 127/275 (46.18%), Query Frame = 3
Query: 1863 VSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQG-------------TIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQE 2648
            V+++R+ +Y   E+    +I  ++    S + +   +E RD    ++++  L L +IN  I  G+ V IVG+ G GKSSL   +        G + + G              I  + Q+  + + SL+ N+     Y+++     +E   LK  +  LP     E  E G NLS GQ+Q V LARA+ +   I +LD+  +AVD      L ++ I      +D T + + H LN +     V+VLD  G I E G+  +LL+    F    ++
Sbjct: 1260 VAVERLKEYSETEKEASWQI--QETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLET-DDLIQSTIRTQ--FEDSTVLTIAHRLNTIMDYTRVIVLD-KGEIRECGAPSELLQQRGVFYSMAKD 1528          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q6UR05|MRP1_CANLF (Multidrug resistance-associated protein 1 OS=Canis lupus familiaris OX=9615 GN=ABCC1 PE=1 SV=1)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 615/1530 (40.20%), Postives = 913/1530 (59.67%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLL--DASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKI-----PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRY------DLLQNSTASVAHLMEDEDKL---TNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNN-APSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            ++++S  +L IT++LA    ++ RR       I+  FWL A +  L  L   I+  L  DA     R+         F L L+  +  CFS    DR  L ++      PCPE  AS LS++T+ W+   + + +R+ +     + L ++D S +   +L K +  +   S  ++R       D  +    S   + E+ + L   T    R P   LF  L + +G   L++  FK +HD  ++A P +LK+L+ ++ ++    W GY           L +L  +  F I  +  +RI+ A+IG +YRK L + N  R   T GEIVNLMSVDA+R M+   +     S PLQ++LA+ LL+  +  ++ AG+ +++   PLN ++    + +    +K KD RIK++ EILNGIKVLK+YAWE +F DK+  +R  E++ + + +    V    W   PFL+ L+TF  YV   + NI+  +KAFVSL LFN+LRFP+ +LP  ++  + A VSLKR+  +L  EEL    I  R   D    N   +I +++ +F+W + D  TL+ I F I  G LVA+VG+VG GKSSL+SA+L EM ++ G V+++G++AYV Q+AWIQN SL+ENILF +   E++Y+ +IEAC+L  DLE LP GD TEIGE+G+NLSGGQKQRVSLARAVY + DIYL DDPLSAVDAHVG+H+FENVI   G+LK+KTR+LVTH +++LP+VD ++V+ + G ISE GS+++LL     F +F++ Y   +        G  L+  S+ GK    ++Q+ +N  +V ++           +QR                               + SNS  +  +      +    + + ++ K   +N D        +LVE ++A +G VK + Y   +K+ GL++   ++ ++       + SN WL  +T+D  I N +Q                 E TK  + +Y  +G+   + V  Y  + ++G I AS+ +H  LL++VLRSPM FF+ TPSG ++NRFSK+++ +D +IP  I   +  LF V  + I+I+  TP  +I I PL ++Y+ +Q FY+ +SRQ +RL+S++ SPV++HF ETL GV++IRAF+EQ+ F   +   +D++ K  +    + RWL++R+E +G  +V  A LFS+I R SL+A LVGLS+SYSLQ+T +LNWL+R  +E+ETN VA+ER++EYS+   EA W +   AP  +WP  G + F+DY LRYRE L LVLK+IN+  +GG+K+G+VGRTGAGKSSL L LFR+ E+A G IIID INI+ IGLHDLR ++TI+PQDPV+FSG+LR NLDPFS + D+E++ SLE AHL+ +VSGL + L+ EC EGG NLSV                      GQ+QL+CLARALLRK+K+L+LDEATA+VD+ETD L+  TIR  F   TV+ IAHR+NTI+D   ++V++ GEI E   P +LL    G+F S+
Sbjct:  105 VFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLIALLCALAILRSKIMTALKEDAEIDVFRD---VTFYIYFSLVLIQLVLSCFS----DRPPLFSETIHDLNPCPESSASFLSRVTFWWITGLMVRGYRQPLESTDLWSLNKEDTSEQVVPVLVKNWKKECAKSKRQQRKITYSSKDPAKPKGGSQVDVNEEAEVLIVKTPQKEREPS--LFKVLYKTFGPYFLMSFLFKALHDLMMFAGPEILKLLINFVNDKKAPDWQGYLYTALLFICACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVYVTVDKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGAN---SITVKNATFTWARSDPPTLSGITFSIPEGSLVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGRQLQERYYKAVIEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCDSDIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRLLVTHSISYLPQVDVIIVM-TGGKISEMGSYQELLARDGAFAEFLRTYASGDQEQAEQDDG--LTGVSSPGKE---VKQM-ENGMLVTDVA-------GKQLQR-------------------------------QLSNSSSYSGD------VSRHHTSTAELQKAGPKNEDAW------KLVEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFLCNHVASLVSNYWLSLWTDDP-IVNGTQ-----------------EHTKIRLSVYGALGISQGITVFGYSMAVSIGGIFASRRLHVDLLQNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFNVIGACIIILLATPIASIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFSVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQEMAPPSTWPQVGRVEFRDYGLRYRENLDLVLKHINITINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDDINIAKIGLHDLRVKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSGLPDKLNQECAEGGENLSV----------------------GQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFDDCTVLTIAHRLNTIMDYTRVIVLDKGEIRECGQPSDLL-QQRGLFYSM 1524          

HSP 2 Score: 87.4261 bits (215), Expect = 1.050e-15
Identity = 83/280 (29.64%), Postives = 130/280 (46.43%), Query Frame = 3
Query: 1863 VSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVS-----------------VQGTIAYVSQEAWIQNKSLKENI-LFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQE 2648
            V+++R+ +Y   E+    +I  ++    S +     +E RD    +++   L L +IN  I  G+ V IVG+ G GKSSL    LG + RIN S                   ++  I  + Q+  + + SL+ N+  F+Q  +E+ +  + E   LK  +  LP     E  E G NLS GQ+Q V LARA+ +   I +LD+  +AVD      L ++ I       D T + + H LN +     V+VLD  G I E G   DLL+    F    ++
Sbjct: 1259 VAVERLKEYSETEKEAPWQI--QEMAPPSTWPQVGRVEFRDYGLRYRENLDLVLKHINITINGGEKVGIVGRTGAGKSSLT---LG-LFRINESAEGEIIIDDINIAKIGLHDLRVKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSL-ELAHLKDFVSGLPDKLNQECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLET-DDLIQSTIRTQ--FDDCTVLTIAHRLNTIMDYTRVIVLD-KGEIRECGQPSDLLQQRGLFYSMAKD 1527          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|O35379|MRP1_MOUSE (Multidrug resistance-associated protein 1 OS=Mus musculus OX=10090 GN=Abcc1 PE=1 SV=1)

HSP 1 Score: 1022.69 bits (2643), Expect = 0.000e+0
Identity = 598/1525 (39.21%), Postives = 903/1525 (59.21%), Query Frame = 3
Query:  372 IMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLL--DASPYNIRNGXXXXX-XXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILE---KIFYDKIKISHNRKRY----DLLQNSTASVAHLMEDEDKL---TNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLN-NAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            ++S  +L IT++LA    ++ RR       I+  FWL A +  L  L   II  L  DA     R+   +L    +    +++  + C   FS+    + ++ PCPE  AS LS++T+ W+   +   +R+ +     + L ++D S +   +L    K   DK +    R  Y    D  +   +S   + E+ + L   +   +R P   LF  L + +G   L++  +K +HD  ++A P +L++++ ++ +R    W GYF          L +LA +  F I  +  +RI+ A++G +YRK L + N  R   T GEIVNLMSVDA+R M+   +     S PLQ++LA+  L+  +  ++ AG+ +++   PLN ++    + +    +K KD RIK++ EILNGIKVLK+YAWE +F DK+ ++R  E++ + + +    V    W   PFL+ L+TF  +V   E NI+  +KAFVSL LFN+LRFP+ +LP  ++  + A VSLKR+  +L  EEL    I  R            +I +++ +F+W + +  TLN I F I  G LVA+VG+VG GKSSL+SA+L EM ++ G V+++G++AYV Q+AWIQN SL+ENILF     E +Y+ ++EAC+L  DLE LP GD TEIGE+G+NLSGGQKQRVSLARAVY N DIYL DDPLSAVDAHVG+H+FE V+   G+LK+KTRILVTHG+++LP+VD ++V+ S G ISE GS+++LL     F +F++ Y        N        D+S  G  K         E    E    V  +    +QR+    +SN+                       +S+SG    +      +   G++         + T +L++   +Q        +G V+ + Y   +K+ GL++   ++ ++       + SN WL  +T+D  + N +Q                     + + +Y  +G+     +  Y  + ++G I AS+ +H  LL +VLRSPM FF+ TPSG ++NRFSK+++ +D +IP  I   +  LF V  ++I+I+  TP  A+ I PL ++Y+ +Q FY+ +SRQ +RL+S++ SPV++HF ETL GV++IRAF+EQ+ F + +   +D++ K  +    + RWL++R+E +G  +V  A LF++I R SL+A LVGLS+SYSLQIT +LNWL+R  +E+ETN VA+ER++EYS+   EA W +   AP  +WP++G + F+DY LRYRE L LVLK+IN+   GG+K+G+VGRTGAGKSSL L LFR+ E+A G IIID +NI+ IGLH+LR ++TI+PQDPV+FSG+LR NLDPFS + D+E++ +LE AHL+ +VS L + L++EC EGG NLSV                      GQ+QL+CLARALLRK+K+L+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ GE+ E  +P  LL    GIF S+
Sbjct:  107 LVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALLCALAILRSKIISALKKDAHVDVFRDSTFYLYFTLVLVQLVLSCFSDCSPLFSE---TVHDRNPCPESSASFLSRITFWWITGMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEALIVKSPHKDREPS--LFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAPDWQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEG----NSITVKNATFTWARGEPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVM-SGGKISEMGSYQELLDRDGAFAEFLRTY-------ANAEQDLASEDDSVSGSGK---------ESKPVENGMLVTDTVGKHLQRH----LSNS-----------------------SSHSGDTSQQHSSIAELQKAGAK---------EETWKLMEADKAQ--------TGQVQLSVYWNYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDPPVVNGTQ-----------------ANRNFRLSVYGALGILQGAAIFGYSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSV----------------------GQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVRECGAPSELL-QQRGIFYSM 1521          

HSP 2 Score: 90.8929 bits (224), Expect = 8.417e-17
Identity = 75/275 (27.27%), Postives = 128/275 (46.55%), Query Frame = 3
Query: 1863 VSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQE 2648
            V+++R+ +Y   E+    +I  ++    S + +   +E RD    ++++  L L +IN  I  G+ V IVG+ G GKSSL   +        G + + G              I  + Q+  + + SL+ N+     Y+++     +E   LK  +  LP     E  E G NLS GQ+Q V LARA+ +   I +LD+  +AVD     +L ++ I      +D T + + H LN +     V+VLD  G + E G+  +LL+    F    ++
Sbjct: 1256 VAVERLKEYSETEKEAPWQI--QETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLET-DNLIQSTIRTQ--FEDCTVLTIAHRLNTIMDYTRVIVLD-KGEVRECGAPSELLQQRGIFYSMAKD 1524          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|B2RX12|MRP3_MOUSE (Canalicular multispecific organic anion transporter 2 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=1)

HSP 1 Score: 1010.75 bits (2612), Expect = 0.000e+0
Identity = 581/1520 (38.22%), Postives = 899/1520 (59.14%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDAS----PYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKI---PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDK-LTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEW--DLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            ++ ++ +++ IT++LA L  +  R        +L IFWL   I  ++     I+  L       P+             F L     +  CF    K  L  P  +   PCPE  A   S+L++ W        +R+ + D   + L  +D S K   +++++       +  +++     + TA+    +  ED  L  P  +S       +L R +   LL++  F  + +   +  P LL IL+ +I + +   W G+ LA        + +L  +  +    ++++R+R A+IG+IYRK L + N ++ + T GE+VNLMSVDA+R M+   F     S PLQ++LAI  L+Q +  +  AG+ +IV   PLNG +   M+ +   ++K+KD RIK+++EILNGIKVLK+YAWE SFL+++  +R +E++ + + +    +   +W   PFL+ L T   YV   E N++  EKAFVSL+LFN+L+ P+ +LP  ++    A VSLKRI  +L   EL+   +  +  +   A      I I +G+F+W ++   TL+++N +I +G LVA+VG VG GKSSL+SA+LGEM ++ G VSV+G++AYV Q+AWIQN +L+EN+LF Q  N K Y+  +E C+L +DL+ LPGGD+TEIGE+GINLSGGQ+QRVSLARAVY + +I+LLDDPLSAVD+HV +H+F+ VI   G+L  KTR+LVTHG+++LP+ D ++VL + G +SE G +  LL+    F  F++ Y    ++  + +  Q+ ++E  L             ED +   TD     PA+   R    R  ++                        S+ G  E ++   P+  T   +   +  +T         K    L++EE A +G VK + Y    KS GL   ++   +Y   +   + +N+WL  ++ D++ ++  Q+                 +T   + +Y  +G+   L+V     +  VG+I A++++H+ LL + +RSP  FFDTTPSGRI+NRFSKDI  +D ++   I   L+  F   ++I+VI+  TP F + ++PLA+LY  +Q FY+ TSRQ +RL+SI+ SP+F+HF+ET+ G ++IRA+   Q F+ L+ T +D + K  +   +S RWL + +E +G  +V  A LF++IGR SL   LVGLS+SY+LQ+T  LNW++R  ++LE+N +A+ER++EYSK  +EA W  + N AP + WP  G + F++Y +RYR GL LVLKN+ +H  GG+K+G+VGRTGAGKSS+ L LFR++EAA G I+ID +N++ IGLHDLR +LTI+PQDP++FSGTLR NLDPF  + +++I+++LE +HL ++VS    GLD++C EGG NLSV                      GQ+QL+CLARALLRKS+VL+LDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D + ++V++ G + E DSP NL+A + GIF
Sbjct:  104 VFFVTPLVVGITMLLATLLIQYERLRGVQSSGVLIIFWLLCVICAIIPFRSKILSALAEGKILDPFRFTT-----FYIYFALVFCALILSCFKE--KPPLFSPENLDTNPCPEASAGFFSRLSFWWFTRLAILGYRRPLEDRDLWSLSEEDCSHK---VVQRLLE-----AWQKQQNQASGSQTATAEPKIPGEDAVLLKPRPKSKQPSFLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWWGFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELDPQCVERKTISPGYA------ITIHNGTFTWAQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVL-AGGQVSEMGHYSALLQHDGSFANFLRNYAPDEDQEDHEAALQNANEEVLL------------LEDTLSTHTDLTDNEPAIYEVRKQFMREMSSL-----------------------SSEG--EVQNRTMPKKHTNSLEKEALVTKT---------KETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAAAIGANVWLSAWSNDAE-EHGQQN-----------------KTSVRLGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGFVQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAP-EGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTFVSSQPAGLDFQCAEGGDNLSV----------------------GQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIA-AGGIF 1513          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|O88563|MRP3_RAT (Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus OX=10116 GN=Abcc3 PE=1 SV=1)

HSP 1 Score: 1004.59 bits (2596), Expect = 0.000e+0
Identity = 579/1527 (37.92%), Postives = 894/1527 (58.55%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNII------RLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKI---PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKL---TNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL--NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            ++ ++ +++ IT++LA L  +  R        +L IFWL   I  ++     I+      ++LD  P+             F L L  F+  CF    K  L  P  +   PCPE  A   S+L++ W        +R+ + D   + L  +D S K   +++++       +  +++       TA++   +  ED++     P  + P ++   +L R +   LL+   FK + D S  +            +     YW G+ LA        + +L  +  +    ++++RIR A+IG+IYRK L + N ++ ++T GE+VNLMSVDA+R M+   F     S PLQ++LAI  L+Q +  +  AG+ +IV   PLNG +   M+ +   ++K+KD RIK+++EILNGIKVLK+YAWE +FL+++  +R  E++ + + +    +   +W   PF++ L T   YV   + N++  EKAFVSL+LFN+L+ P+ +LP  ++      VSLKRI  +L  +EL+   +  +  +   A      I I +G+FSW K+   TL++IN +I +G LVA+VG VG GKSSL+SA+LGEM ++ G+VSV+G++AYV Q+AWIQN +L+EN+LF Q  N K Y+  +E C+L +DL+ LPGGD+TEIGE+GINLSGGQ+QRVSLARAVY + +I+LLDDPLSAVD+HV +H+F+ VI   G+L  KTR+LVTHG+++LP+ D ++VL ++G I+E G + +LL+    F  F++ Y    N+  N    QH ++E  L             ED +   TD   T PA+   R                            ++    +S   E E    P +       ++ +   ++       K    L++EE A +G VK + Y    KS GL   +    +YA    + + +N+WL  +T  +D++   Q                +  T   + +Y  +G+   L+V     +  VG+I A++++H  LL + +R+P  FFDTTPSGRI+NRFSKDI  +  ++   I    +  +   ++I+VI+  TP F + ++PLA+ Y  +Q FY+ TSRQ +RL+S++ SP+F+HF+ET+ G ++IRA+   Q F+ L+   +D + K  +   +S RWL + +E +G  +V  + LF++IGR SL   LVGLS+SY+LQ+T  LNW++R  ++LE+N +A+ER++EYSK  +EA W L  N AP + WP +G + F++Y +RYR GL LVLKN+ LH  GG+K+G+VGRTGAGKSS+ L LFR++EAA G I ID +N++ IGLHDLR +LTI+PQDP++FSGTLR NLDPF  + D++I+++LE +HL ++VS    GLD++C EGG NLSV                      GQ+QL+CLARALLRKS+VL+LDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D + ++V++ G + E DSP NL+A + GIF  +
Sbjct:  104 VFFITPLLVGITMLLATLLIQYERLRGVRSSGVLIIFWLLCVICAIIPFRSKILLALAEGKILD--PFRFTT-----FYIYFALVLCAFILSCFQE--KPPLFSPENLDTNPCPEASAGFFSRLSFWWFTKLAILGYRRPLEDSDLWSLSEEDCSHK---VVQRLLE-----AWQKQQTQASGPQTAALEPKIAGEDEVLLKARPKTKKPSFLR--ALVRTFTSSLLMGACFKLIQDLSPSSTHSCSASSSGLFRPHGP-YWWGFLLAGLMFVSSTMQTLILHQHYHCIFVMALRIRTAIIGVIYRKALTITNSVKREYTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVQQMKFKDSRIKLMSEILNGIKVLKLYAWEPTFLEQVEGIRQGELQLLRKGAYLQAISTFIWVCTPFMVTLITLGVYVCVDKNNVLDAEKAFVSLSLFNILKIPLNLLPQLISGMTQTSVSLKRIQDFLNQDELDPQCVERKTISPGRA------ITIHNGTFSWSKDLPPTLHSINIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGAVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVL-ADGQITEMGHYSELLQHDGSFANFLRNYAPDENQEANEGVLQHANEEVLL------------LEDTLSTHTDLTDTEPAIYEVRK---------------------------QFMREMSSLSSEGEGQNRPVL-------KRYTSSLEKEVPATQTKETGALIKEEIAETGNVKLSVYWDYAKSVGLCTTLFICLLYAGQNAVAIGANVWLSAWT--NDVEEHGQ----------------QNNTSVRLGVYATLGILQGLLVMLSAFTMVVGAIQAARLLHTALLHNQIRAPQSFFDTTPSGRILNRFSKDIYVIHEVLAPTILMLFNSFYTSISTIVVIVASTPLFCVVVLPLAVFYGFVQRFYVATSRQLKRLESVSRSPIFSHFSETVTGTSVIRAYGRVQDFKVLSDAKVDSNQKTTYPYIASNRWLGVHVEFVGNCVVLFSALFAVIGRNSLNPGLVGLSVSYALQVTLSLNWMIRTLSDLESNIIAVERVKEYSKTETEAPWVLESNRAP-EGWPRSGVVEFRNYSVRYRPGLELVLKNLTLHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIFIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSDEDIWRTLELSHLSAFVSSQPTGLDFQCSEGGDNLSV----------------------GQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIA-AGGIFYGM 1515          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A210QB02 (Multidrug resistance-associated protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07304 PE=4 SV=1)

HSP 1 Score: 1112.44 bits (2876), Expect = 0.000e+0
Identity = 647/1629 (39.72%), Postives = 968/1629 (59.42%), Query Frame = 3
Query:   75 EICQDGFWNSTSFSNVKYPIFTECFQYVILL-IPSGXXXXXXXXXXXXKKYKSHPIIKVPCTFYYGLKLSSQAXXXXXXXXXXXXXXXXTKSNSLIDGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFY-----DKIKISHNRKR---YDLLQNSTASVAHLMED--EDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNY----WIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVL-WEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGR--FSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL-NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            E C   FW+     N  +P FTECFQ  +L+ +P G   +    +  +    +   +K  C++ + +KL+   +++  L   I+      K         ++  +I  ITL +  L   + R        +LF++W+      ++ LY  II+      Y        +      L L+  L HC +    + L   +K+  PE+ AS LS+++++WLD  +   +RK +T+E  F+L   + S       E+ +       KIK   +R         +NST     L     + K  +P        L   L + +GLELL A  FK  +D   +A PFLL+ L+++     D      W GY L   F    ++ S   +  F +++ L +R+RA +I  +Y+K L +++  R + T+GEIVNLMSVD ERI++ + + W   S PLQ+ +A+  LY  M  ++FAG G ++  FPLNG LM  +QK    ++K KD+RIK++ E+LNGIK+LK+YAWE SF +KI  +R  E++YI + +  FG   +  W I P+L+ LATF  ++  S+ + + P+ AFV+++LFN+LRF + + P  +T+ + A VS+KR+ ++L  E+L+   ++H     D       A+ IRDG F W +E   TL++IN  +  G LVA+VG+VG GKSSLISAILGEM ++ G V+V+G+++Y+ Q+AWIQN +L++NILF +   ++ Y++I+++C+L SD++ LP GD+TEIGE+GINLSGGQKQRVSLARAV+ N DIYLLDDPLSAVD+HVG+H+F+ VI   G+LKDKTR+L+THG+ WLP VD ++V+D NG ++E GS+ +LL     F +F+Q Y   N    +      +    A  KA+ L R  S N    EE  + +  S +     + + R   +                      +  + G+  D+  K   +    S+   + K+TD            +L+EEEQ+ +G+VK A +    +S GL   IA V + A F  + V SN+WL N+T D+ + N +          P  S I  ++ KYY+ IY  +G   ++ +  +       ++ ASKV+H ++L  +LRSPM FFDTTP GRI+NRFS+D++ +D  +PM +   L CLF+V  S+ VI Y TP+F + I+P+  LY+L+Q FYIP+SRQ +R++S   SP++NHF+ETL G ++IRA+  Q  F   ++  +D + K+ F   SS RWL  R+E LG L++ AA L ++I R    +T S+VGLS++Y+LQITE LNW++R  +ELET  V++ER++EY++IP E +    ++ P   WP NG + FK+Y  RYR GL LVLKNI++    G+K+G+VGRTGAGKSSL LALFRL+E A GSIIID  N++ +GLHD R RLTILPQDPVIFSG+LR NLDP   + D++++ +LE AHL+++   L+ GL+Y+CGEGG NLSV                      GQ+QL+CLAR+LLRK+K+L+LDEATA+VD+ETD L+  TIR  F+ STV+ IAHR+NTI+D D I+V++ GEI E DSP +LL  +  +F  L
Sbjct:    3 EYCNGTFWDINETWNSSWPQFTECFQNTVLVWVPCGFVWLALPFYLWYLLSVAGTTLK--CSWKHRIKLAIVVILMAFLAYWIVEVVNDLKPEEQYWRAKLVGPIIYLITLCVVFLLMCLERWKALVTSGVLFVYWVLVAFTLIIPLYSMIIQ----KAYKDHLNGFVIFMVSTGLVLIQVLVHCVA----EELPHTDKLISPEIKASFLSRMSFTWLDGLMVTGYRKTLTEEDVFNLGPSELSQNVVPRFERNWQRESAKQKIKAQTSRITEIPASSFENSTERTPLLASSPPDSKKDSPKKLVGKPSLTKVLFKTFGLELLNAHIFKLFYDALNFANPFLLRFLIDFTVPGPDGVYQQSWRGYVLTAGFFLTTIMQSFLFHQVFHMSTTLGLRVRAVIISAVYKKALSMSSASRKESTTGEIVNLMSVDTERIVSTLQYLWGIWSSPLQMAVALYFLYGTMGPSMFAGFGSLILMFPLNGYLMYKLQKLQEQQMKQKDIRIKVINEVLNGIKILKLYAWEMSFKEKIAAVRKLELKYIWK-AGIFGCGFMFSWYIAPYLVSLATFATFIFASDNHFLDPQTAFVAISLFNILRFAVNIAPAVITEVVTANVSMKRLSKFLNSEDLDAKCVSHSSLERD-------AVVIRDGEFLWDEEVGTTLSDINVRVPEGGLVAVVGQVGAGKSSLISAILGEMTKVKGQVNVKGSLSYIPQQAWIQNATLQDNILFGEKLQQQRYDEILDSCALVSDMDMLPAGDQTEIGEKGINLSGGQKQRVSLARAVHFNSDIYLLDDPLSAVDSHVGKHIFDRVIGRKGLLKDKTRVLITHGVQWLPHVDTIVVMD-NGRVTEIGSYDELLSHAGAFAKFLQTYFVQNEEDSDEEEDPEI----AATKARILQRLTSINS---EEGGELLRASESESGTDDKTLRRRKS----------------------KGLDRGMSRDDGEKKKGLDRALSKEAAVEKKTDD-----------KLIEEEQSETGSVKLAVFFAYARSLGLPYAIALVLLSAGFQAMGVLSNMWLSNWTGDATLNNRTL--------GPPDSSIYMDKNKYYLGIYGALGAGQSIFITVFSLVLVFRTVKASKVLHGQMLHGILRSPMSFFDTTPIGRIVNRFSQDMDIIDRELPMTVQMFLDCLFMVIGSLFVISYSTPFFMVIILPVGFLYFLVQRFYIPSSRQLKRVESKTRSPIYNHFSETLAGASVIRAYSVQHKFITQSEERVDLNQKYSFASFSSNRWLGFRLEFLGNLIIVAAALLTVISRDGSGITGSIVGLSVTYALQITENLNWMVRMSSELETKVVSVERVKEYAEIPHEDKLVYKSHRPPSLWPENGEVKFKNYSTRYRTGLDLVLKNIDVTIQPGEKVGIVGRTGAGKSSLTLALFRLIEPASGSIIIDGENLNRMGLHDSRSRLTILPQDPVIFSGSLRMNLDPLDEYMDNDLWDALEHAHLKTFAQSLATGLEYDCGEGGQNLSV----------------------GQRQLVCLARSLLRKTKILVLDEATAAVDMETDDLIQQTIRTEFKDSTVLTIAHRLNTIMDYDRIMVLDKGEICEFDSPNSLLKNTSSVFYQL 1542          

HSP 2 Score: 111.309 bits (277), Expect = 1.660e-20
Identity = 125/523 (23.90%), Postives = 227/523 (43.40%), Query Frame = 3
Query: 1146 FFGVLSSLAENGCFFITSI------LSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWI-IFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYL-VGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNE-FMQFVQE 2648
            + G+  +L      FIT         +++    L G +    LR      +    G IVN  S D + I   + +    FL C   ++ ++ ++     + +   L +   +F +    +   ++   +E K +       +E L G  V++ Y+ +  F+ +     D   +Y     ++   +    E L  LI++A  L  V++ + + IT     +S+T    +   +  +    ++     VS++R+ +Y  +  E  L   +HR     S +  +  ++ ++ S  ++    L L NI+  I  G+ V IVG+ G GKSSL  A+   +   +GS+ + G              +  + Q+  I + SL+ N+    +Y +    D +E   LK+  + L  G E + GE G NLS GQ+Q V LAR++ +   I +LD+  +AVD      L +  I      KD T + + H LN +   D ++VLD  G I E  S   LLK+ +  F Q  ++
Sbjct: 1030 YLGIYGALGAGQSIFITVFSLVLVFRTVKASKVLHGQMLHGILRSPMSFFDTTPIGRIVNRFSQDMDIIDRELPMTVQMFLDCLFMVIGSLFVISYSTPFFMVIILPVGFLYFLVQRFYIPSSRQLKRVESKTRSPIYNHFSETLAGASVIRAYSVQHKFITQSEERVDLNQKYSFASFSSNRWLGFRLEFLGNLIIVAAALLTVISRDGSGITGSIVGLSVTYALQITENLNWMVRMSSELETKVVSVERVKEYAEIPHEDKLVYKSHRP---PSLWPENGEVKFKNYSTRYRTGLDLVLKNIDVTIQPGEKVGIVGRTGAGKSSLTLALFRLIEPASGSIIIDGENLNRMGLHDSRSRLTILPQDPVIFSGSLRMNLDPLDEYMDNDLWDALEHAHLKTFAQSLATGLEYDCGEGGQNLSVGQRQLVCLARSLLRKTKILVLDEATAAVDMET-DDLIQQTIRTE--FKDSTVLTIAHRLNTIMDYDRIMVLD-KGEICEFDSPNSLLKNTSSVFYQLAKD 1545          

HSP 3 Score: 87.4261 bits (215), Expect = 3.047e-13
Identity = 80/308 (25.97%), Postives = 136/308 (44.16%), Query Frame = 3
Query: 4020 TELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENL---DPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNN 4925
            TE+ T  V+++R+   SK  +  + D       S   +  +  +D +  + E +   L +IN+    G  + VVG+ GAGKSSL  A+   +    G +             +++  L+ +PQ   I + TL++N+   +     + DEI   L++  L S +  L  G   E GE G+NLS                       GQKQ + LARA+   S + +LD+  ++VD    + +   +   +   +  T ++I H +  +   D IVVM+NG + EI S   LL+ +    K L    + N
Sbjct:  597 TEVVTANVSMKRL---SKFLNSEDLDAKCVSHSSLERDA-VVIRDGEFLWDEEVGTTLSDINVRVPEGGLVAVVGQVGAGKSSLISAILGEMTKVKGQV-------------NVKGSLSYIPQQAWIQNATLQDNILFGEKLQQQRYDEI---LDSCALVSDMDMLPAGDQTEIGEKGINLS----------------------GGQKQRVSLARAVHFNSDIYLLDDPLSAVDSHVGKHIFDRVIGRKGLLKDKTRVLITHGVQWLPHVDTIVVMDNGRVTEIGSYDELLSHAGAFAKFLQTYFVQN 862          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A1I8HN92 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1085.86 bits (2807), Expect = 0.000e+0
Identity = 618/1467 (42.13%), Postives = 910/1467 (62.03%), Query Frame = 3
Query:  681 EVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNIL-EKIFY------------------DKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGW-----VLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKED-KLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLS----------------DESALGKAKNLLRQL----SDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDE----DPKSPRIMTPGSQSRQISKETDQNTDRLID------KPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            E  +SI+S+LT+SWLD  +   +RKE+ +    D+ R D S +   +  E + Y                  + +  +H+R   D  Q   + V+    + D+L + D+R          L  +L + +G +L+L+ +   +H    +A PFLL+ L+ +  N  +  W G      F    VLSS+  +  F ++    I+ R+ALI  IYRK+L L  E R + T GEIVNLM+VD+ +I + I F W  L  P+QIV+A+++L+ ++  A+ AG+G+ V   P+NG +M   QK    E+K KD R+K+L E+LN +KV+K+YAWE SF  KI+++R TE+ ++ ++S  F VV ++W + PFL+M+ TF+ Y+ + + +I+T  KAFVSLTLFN+LRFP+ VLPW +T+S+NA+VS+KRI  +L  ++++ + +     + D       ++EI   SF WK+ D +  L ++N ++ +GKL+AIVGKVG GKSSL+ ++LGE  +  GS++ +G++AYV QEAWIQN ++++NILF +D+++  Y++ + AC L+ DL+ L  GD TEIGERGINLSGGQKQRVSLARAVYQ+ DIYLLDDPL+AVD+HVG+ LF  VI  +G+L+DKTRILVTHG++WLP VDE++V+D NG ISE+GS++ LL     F  F++E+  H+   K  S  + +S                DE    +   +L++L    S   +V  E    V TSP+   Q    H                      HV+   +S +    D     D K P I+   S+  Q++ E   + D  +D      +   +L++EE   SG+V   +Y   I +RG  L + T+  + A+T + V S++WL  +T D    NAS  +  N++ S Y    +R+   YY+ IY I G+ + ++V  Y       ++ AS+ IHK LL  + R PM FFDTTP+GRI+NRFSKD+E +D  +PM I+D L C     + I+VI Y TP F  A++PL I+Y  IQ+FY+P SRQSRRLDS + SP+  +F+E++ G A+IRAF++QQ F  ++   +D +S+F F++ +S RWL  R+E+LG   V  A L +++GR SLT  LVGLS+SY+LQI++ LNW++RQ TELETN VA+ER+ EYS + +EA W  ++ P   WP+ G + F +Y  RYR GL LVL+ I++ F  G K+G+VGRTGAGKSSL L LFRL+E+A G I +D + I  +GLH LR  LTILPQ+P +FSG+LR NLDPF    D+E++ +L+ AHL SW  GLS GL +ECGEGG NLSV                      GQ+QL+CLARAL+R+S++L+LDEATA+VD+ETD L+M T+R+ F  STVIIIAHR+ TI+D+D ++V+++G + E   P++LLA  D  F  L  ++
Sbjct: 1980 ECRSSIISRLTFSWLDRSVLNAYRKEIGEA---DVNRLDPSLRVRTVHGEFVRYFPPLVALSRSERDAAEQQENLSFTHHRVNADTEQLVDSGVS----EGDQLHSNDSRDGAGGRHRRKLLPALWKAFGSQLILSWSIMMIHGLLAFANPFLLESLINFSTN-GEELWHGILYTFLFFVVAVLSSITFHASFQLSLTCGIKFRSALIASIYRKSLTLTQESRARSTVGEIVNLMTVDSNKIADSIPFFWAMLVSPVQIVIALVMLWAQLGTAVLAGIGIFVVIIPVNGYIMAKAQKLEEKEMKTKDERLKLLNEVLNAMKVIKLYAWEPSFQQKISHVRRTEVGFLGQMSYLFSVVIIMWTVAPFLVMVLTFITYIYSGDDHILTASKAFVSLTLFNILRFPITVLPWTITESVNAYVSIKRIQNFLFEDDIDESSVLKLPSSPDGN-----SVEIEGASFGWKRTDSEPLLKDVNIQVPKGKLIAIVGKVGCGKSSLLQSVLGETVKFCGSITTRGSVAYVPQEAWIQNLTVRDNILFGRDFDQARYDEALRACQLEKDLQLLTAGDATEIGERGINLSGGQKQRVSLARAVYQDSDIYLLDDPLAAVDSHVGKKLFHEVIGKSGLLRDKTRILVTHGIHWLPHVDEIVVID-NGRISEQGSYEHLLDHDGPFASFLKEFFLHDGERKRASRSRDVSVSIAEIAAAAPEEEEEDEELAAEKARILQRLASCTSSAHEVCAESPAVVATSPS---QSPPPH----------------------HVRQMSSSVNSHCSDTADRLDSKRPSIVRQTSKISQLTSEKLPSRDEDVDGTRKAAEQSGRLIDEETMESGSVSLKSYVFYIAARGYHLVLMTIMAHLAYTVVNVASSVWLSTWTSDPLFSNAS--VTGNLNNSAY----LRDINDYYLSIYGIFGVGIVVLVGIYAVMGVYSALRASRSIHKSLLTRLFRVPMSFFDTTPTGRIVNRFSKDMEVVDRELPMIINDFLECFMATVSCIVVISYTTPIFLAAVVPLGIIYAGIQVFYLPISRQSRRLDSRSRSPILTNFSESIAGAAVIRAFRQQQRFVGISDYRVDNNSRFYFLKLASNRWLGFRLELLGTAAVVIAALLAVLGRDSLTPGLVGLSVSYALQISDALNWMVRQLTELETNSVAVERLDEYSNLETEAPWTTDSLPPSGWPSRGRVEFCNYATRYRPGLDLVLQGISVSFEPGHKVGIVGRTGAGKSSLTLGLFRLIESAFGHIEVDGVRIDRLGLHSLRSALTILPQEPTVFSGSLRSNLDPFDERTDEELWAALDAAHLSSWARGLSAGLAHECGEGGTNLSV----------------------GQRQLVCLARALMRRSRLLVLDEATAAVDLETDSLIMATVRQQFADSTVIIIAHRLATIMDSDRVMVLDSGRVREFAPPRDLLAKQDSYFHFLAKEA 3379          

HSP 2 Score: 1061.21 bits (2743), Expect = 0.000e+0
Identity = 595/1435 (41.46%), Postives = 901/1435 (62.79%), Query Frame = 3
Query:  681 EVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNI-------------LEKIFYD------KIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGW-----VLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKED-KLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNR----AKNPSGGQHLSDESA---------------LGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQ---SRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEI 4844
            E  +SI+S+LT+SWLD  +   +RKE+ +    D+ R D S +   +             L +   D       +  +H+R   D  Q   + V+    + D+L + D+R          L  +L + +G +L+L+ A   +H    +A P LL+ L+++    S+  W G+F    F    +LSSLA +    I+ +  I+IR+ALI  IYRK+L L  E R++ T GEIVNL++VD+ +I + + F W  L  P+QI LA+++L+ ++  A+ AG+ + +   PLN ++M   Q     E+K KD R+++L E++N +KV+K+YAWE SF  KI  +R  E+  + + +    +V V W + PFL+M+ TF+ Y+ +   +++T  KAFVSLTLFN+L FP+ VLPW +T+S+NA+VSLKRI ++L  ++++ + +        S+ N+ AAIE+ +GSF+WK+ D +  L NIN  + RG LVA+VGKVG GKSSL+ ++LGE  R+ GSV++ G+ AYV QEAWIQN ++++NILF +D+++  Y++ + AC L+ DL+ L  GD TEIGERGINLSGGQKQRVSLARAVYQ+ DIYLLDDPL+AVD+HVG+ LF  VI  +G+L+DKTRILVTHG++WLP VDE++V+D NG ISE+GS++ LL     F  F++E+  H+      +++P+G   LS++ +                 + + +LR+L+ +     +  +F   +P+V  + +     S+       S             Y  +++    E  D K P  +   S+   + ++ K  +   +R + +   +L++EE   +G V   +Y     +RGL   I    ++A F+ ++V S+IWL  +T D    N++      I G+   S ++RE   YY+ IY  +G+ + L+V  +     V S+ AS++IH  LL S+ R+PM FFDTTP+GRI+NRFSKD+E +DH +PM I+D   CL    + I+VI Y TP F  A++PL I+Y ++Q+FY+P SRQSRRLDS + SP+  +F+E++ G A+IRAF++QQ F +++   +D +++F F++ +S RWL  R+E+LG + V  A L +++ R SLT  LVGLS+SY+L I+  LNW++RQ TELET+ VA+ER+ EYS + +EA W  ++ P   WP+ G + F +Y  RYR+GL LVL+ I++ F  G K+G+VGRTGAGKSSL L LFRL+E+  G I +D + I  +GLH LR  LTILPQ+P +FSG+LR NLDPF    D+E++ +L+ AHL SW  GLS GL +ECGEGG NLSV                      GQ+QL+CLARAL+R+S++L+LDEATA+VD+ETD L+M T+R+ F  STVIIIAHR+ TI+D+D ++V+++G +
Sbjct:  373 ECRSSIISRLTFSWLDRSVLNAYRKEIGEA---DVNRLDPSLRVRTVHGEFVRYFPPLVALSRSVRDAAEQQENLSFTHHRVNADTEQLVDSGVS----EGDQLHSNDSRDGAGGRHRRKLLPALWKAFGGQLMLSWAVVMIHGLLEFANPLLLEQLIKF-SGSSEELWHGFFYTFLFFSVALLSSLAFHNSCQISLMSGIKIRSALIAAIYRKSLSLTLEARSRSTVGEIVNLLTVDSNKIADAVPFLWVVLVSPVQIFLALVMLWMQLGIAVLAGIAVFLVIIPLNAVVMVKSQSLEEREMKTKDERMRLLNEVINAMKVIKLYAWEPSFWQKIDQVRKKEVGLLAKNAYLLVLVVVSWTVAPFLVMVVTFITYIYSGNDHVLTASKAFVSLTLFNILHFPIAVLPWTITESVNAYVSLKRIQRFLDEDDIDDSSV----LKLPSSENHGAAIEVVNGSFAWKRSDTEALLQNINLTVPRGSLVAVVGKVGCGKSSLLQSVLGETVRLCGSVAMTGSAAYVPQEAWIQNLTVRDNILFGRDFDQARYDEALRACQLEKDLQLLTAGDATEIGERGINLSGGQKQRVSLARAVYQDSDIYLLDDPLAAVDSHVGKKLFHEVIGKSGLLRDKTRILVTHGIHWLPHVDEIVVID-NGRISEQGSYEHLLDHDGPFASFLKEFFLHDGERKRASRSPAGSISLSNKPSSDFPAEDIDEEDEEVRAEKERILRRLASHSG--HQACEF---NPSVQAETHIPQLSSSPVAHGLPSSIG---------SYCSDAS----ERVDAKRPPALRQTSRVLDAHEVPKLHESRHERTVTEDDGKLIDEETMETGRVSLKSYVYYASARGLHYVIIMSLLHAGFSAVEVASSIWLSTWTSDPMFNNST------IYGNLNNSVLLRELNDYYIEIYGTLGVAVVLLVAIFAMIEAVSSLRASRLIHNSLLSSLFRAPMSFFDTTPTGRIVNRFSKDMEVVDHELPMVINDFYECLMASLSCIVVISYTTPIFLAAVLPLGIIYAIVQVFYLPISRQSRRLDSRSRSPILTNFSESVAGAAIIRAFRQQQRFIHISDDRVDCNARFYFLKVASNRWLGFRLELLGTVAVTIASLLAVLARGSLTPGLVGLSVSYALDISNSLNWMVRQLTELETDSVAVERLNEYSNLETEAPWTTDSLPPSGWPSRGRVEFCNYATRYRQGLDLVLQGISVSFEPGHKVGIVGRTGAGKSSLTLGLFRLIESTFGHIEVDGVRIDRLGLHSLRSALTILPQEPTVFSGSLRSNLDPFDERTDEELWAALDAAHLSSWARGLSAGLAHECGEGGTNLSV----------------------GQRQLVCLARALMRRSRLLVLDEATAAVDLETDSLIMATVRQQFADSTVIIIAHRLATIMDSDRVMVLDSGRV 1748          

HSP 3 Score: 78.5666 bits (192), Expect = 1.649e-10
Identity = 66/214 (30.84%), Postives = 101/214 (47.20%), Query Frame = 3
Query: 1998 WKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSL-------ISAILGEMH----RIN--GSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDI---IEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISER 2591
            +++   L L  I+     G  V IVG+ G GKSSL       I +  G +     RI+  G  S++  +  + QE  + + SL+ N+     ++E+  E++   ++A  L S    L  G   E GE G NLS GQ+Q V LARA+ +   + +LD+  +AVD      +   V        D T I++ H L  +   D V+VLDS    S R
Sbjct: 1545 YRQGLDLVLQGISVSFEPGHKVGIVGRTGAGKSSLTLGLFRLIESTFGHIEVDGVRIDRLGLHSLRSALTILPQEPTVFSGSLRSNL---DPFDERTDEELWAALDAAHLSSWARGLSAGLAHECGEGGTNLSVGQRQLVCLARALMRRSRLLVLDEATAAVDLETDSLIMATVRQQ---FADSTVIIIAHRLATIMDSDRVMVLDSGRVESSR 1752          

HSP 4 Score: 76.6406 bits (187), Expect = 7.236e-10
Identity = 78/272 (28.68%), Postives = 119/272 (43.75%), Query Frame = 3
Query: 4131 NGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENL---DPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKS------LHD 4910
            NG+  +K  D         +L+NINL    G  + VVG+ G GKSSL  ++        GS+              +      +PQ+  I + T+R+N+     F   + DE   +L    L+  +  L+ G   E GE G+NLS                       GQKQ + LARA+ + S + +LD+  A+VD    + + H +       +  T I++ H I+ +   D IVV++NG I E  S ++LL   DG F S      LHD
Sbjct:  819 NGSFAWKRSDTEA------LLQNINLTVPRGSLVAVVGKVGCGKSSLLQSVLGETVRLCGSVA-------------MTGSAAYVPQEAWIQNLTVRDNILFGRDFDQARYDE---ALRACQLEKDLQLLTAGDATEIGERGINLS----------------------GGQKQRVSLARAVYQDSDIYLLDDPLAAVDSHVGKKLFHEVIGKSGLLRDKTRILVTHGIHWLPHVDEIVVIDNGRISEQGSYEHLLD-HDGPFASFLKEFFLHD 1045          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A1I8GTT5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1083.17 bits (2800), Expect = 0.000e+0
Identity = 618/1467 (42.13%), Postives = 910/1467 (62.03%), Query Frame = 3
Query:  681 EVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNIL-EKIFY------------------DKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGW-----VLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKED-KLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLS----------------DESALGKAKNLLRQL----SDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDE----DPKSPRIMTPGSQSRQISKETDQNTDRLID------KPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            E  +SI+S+LT+SWLD  +   +RKE+ +    D+ R D S +   +  E + Y                  + +  +H+R   D  Q   + V+    + D+L + D+R          L  +L + +G +L+L+ +   +H    +A PFLL+ L+ +  N  +  W G      F    VLSS+  +  F ++    I+ R+ALI  IYRK+L L  E R + T GEIVNLM+VD+ +I + I F W  L  P+QIV+A+++L+ ++  A+ AG+G+ V   P+NG +M   QK    E+K KD R+K+L E+LN +KV+K+YAWE SF  KI+++R TE+ ++ ++S  F VV ++W + PFL+M+ TF+ Y+ + + +I+T  KAFVSLTLFN+LRFP+ VLPW +T+S+NA+VS+KRI  +L  ++++ + +     + D       ++EI   SF WK+ D +  L ++N ++ +GKL+AIVGKVG GKSSL+ ++LGE  +  GS++ +G++AYV QEAWIQN ++++NILF +D+++  Y++ + AC L+ DL+ L  GD TEIGERGINLSGGQKQRVSLARAVYQ+ DIYLLDDPL+AVD+HVG+ LF  VI  +G+L+DKTRILVTHG++WLP VDE++V+D NG ISE+GS++ LL     F  F++E+  H+   K  S  + +S                DE    +   +L++L    S   +V  E    V TSP+   Q    H                      HV+   +S +    D     D K P I+   S+  Q++ E   + D  +D      +   +L++EE   SG+V   +Y   I +RG  L + T+  + A+T + V S++WL  +T D    NAS  +  N++ S Y    +R+   YY+ IY I G+ + ++V  Y       ++ AS+ IHK LL  + R PM FFDTTP+GRI+NRFSKD+E +D  +PM I+D L C     + I+VI Y TP F  A++PL I+Y  IQ+FY+P SRQSRRLDS + SP+  +F+E++ G A+IRAF++QQ F  ++   +D +S+F F++ +S RWL  R+E+LG   V  A L +++GR SLT  LVGLS+SY+LQI++ LNW++RQ TELETN VA+ER+ EYS + +EA W  ++ P   WP+ G + F +Y  RYR GL LVL+ I++ F  G K+G+VGRTGAGKSSL L LFRL+E+A G I +D + I  +GLH LR  LTILPQ+P +FSG+LR NLDPF    D+E++ +L+ AHL SW  GLS GL +ECGEGG NLSV                      GQ+QL+CLARAL+R+S++L+LDEATA+VD+ETD L+M T+R+ F  STVIIIAHR+ TI+D+D ++V+++G + E   P++LLA  D  F  L  ++
Sbjct: 1130 ECRSSIISRLTFSWLDRSVLNAYRKEIGEA---DVNRLDPSLRVRTVHGEFVRYFPPLVALSRSERDAAEQQENLSFTHHRVNADTEQLVDSGVS----EGDQLHSNDSRDGAGGRHRRKLLPALWKAFGSQLILSWSIMMIHGLLAFANPFLLESLINFSTN-GEELWHGILYTFLFFVVAVLSSITFHASFQLSLTCGIKFRSALIASIYRKSLTLTQESRARSTVGEIVNLMTVDSNKIADSIPFFWAMLVSPVQIVIALVMLWAQLGTAVLAGIGIFVVIIPVNGYIMAKAQKLEEKEMKTKDERLKLLNEVLNAMKVIKLYAWEPSFQQKISHVRRTEVGFLGQMSYLFSVVIIMWTVAPFLVMVLTFITYIYSGDDHILTASKAFVSLTLFNILRFPITVLPWTITESVNAYVSIKRIQNFLFEDDIDESSVLKLPSSPDGN-----SVEIEGASFGWKRTDSEPLLKDVNIQVPKGKLIAIVGKVGCGKSSLLQSVLGETVKFCGSITTRGSVAYVPQEAWIQNLTVRDNILFGRDFDQARYDEALRACQLEKDLQLLTAGDATEIGERGINLSGGQKQRVSLARAVYQDSDIYLLDDPLAAVDSHVGKKLFHEVIGKSGLLRDKTRILVTHGIHWLPHVDEIVVID-NGRISEQGSYEHLLDHDGPFASFLKEFFLHDGERKRASRSRDVSVSIAEIAAAAPEEEEEDEELAAEKARILQRLASCTSSAHEVCAESPAVVATSPS---QSPPPH----------------------HVRQMSSSVNSHCSDTADRLDSKRPSIVRQTSKISQLTSEKLPSRDEDVDGTRKAAEQSGRLIDEETMESGSVSLKSYVFYIAARGYHLVLMTIMAHLAYTVVNVASSVWLSTWTSDPLFSNAS--VTGNLNNSAY----LRDINDYYLSIYGIFGVGIVVLVGIYAVMGVYSALRASRSIHKSLLTRLFRVPMSFFDTTPTGRIVNRFSKDMEVVDRELPMIINDFLECFMATVSCIVVISYTTPIFLAAVVPLGIIYAGIQVFYLPISRQSRRLDSRSRSPILTNFSESIAGAAVIRAFRQQQRFVGISDYRVDNNSRFYFLKLASNRWLGFRLELLGTAAVVIAALLAVLGRDSLTPGLVGLSVSYALQISDALNWMVRQLTELETNSVAVERLDEYSNLETEAPWTTDSLPPSGWPSRGRVEFCNYATRYRPGLDLVLQGISVSFEPGHKVGIVGRTGAGKSSLTLGLFRLIESAFGHIEVDGVRIDRLGLHSLRSALTILPQEPTVFSGSLRSNLDPFDERTDEELWAALDAAHLSSWARGLSAGLAHECGEGGTNLSV----------------------GQRQLVCLARALMRRSRLLVLDEATAAVDLETDSLIMATVRQQFADSTVIIIAHRLATIMDSDRVMVLDSGRVREFAPPRDLLAKQDSYFHFLAKEA 2529          

HSP 2 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 406/939 (43.24%), Postives = 596/939 (63.47%), Query Frame = 3
Query: 2157 GTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFM-QFVQEYIEHNNRAKNPSGGQHLSDESA---------------LGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQ---SRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            G+ AYV QEAWIQN ++++NILF +D+++  Y++ + AC L+ DL+ L  GD TEIGERGINLSGGQKQRVSLARAVYQ+ DIYLLDDPL+AVD+HVG+ LF  VI  +G+L+DKTRILVTHG++WLP VDE++V+D NG ISE+GS++ LL     F  +F     E    +++P+G   LS++ +                 + + +LR+L+ +     +  +F   +P+V  + +     S+       S             Y  +++  V    D K P  +   S+   + ++ K  +   +R + +   +L++EE   +G V   +Y     +RGL   I    ++A F+ ++V S+IWL  +T D    N++      I G+   S ++RE   YY+ IY  +G+ + L+V  +     V S+ AS++IH  LL S+ R+PM FFDTTP+GRI+NRFSKD+E +DH +PM I+D   CL    + I+VI Y TP F  A++PL I+Y ++Q+FY+P SRQSRRLDS + SP+  +F+E++ G A+IRAF++QQ F +++   +D +++F F++ +S RWL  R+E+LG + V  A L +++ R SLT  LVGLS+SY+L I+  LNW++RQ TELET+ VA+ER+ EYS + +EA W  ++ P   WP+ G + F +Y  RYR+GL LVL+ I++ F  G K+G+VGRTGAGKSSL L LFRL+E+  G I +D + I  +GLH LR  LTILPQ+P +FSG+LR NLDPF    D+E++ +L+ AHL SW           CGEGG NLSV                      GQ+QL+CLARAL+R+S++L+LDEATA+VD+ETD L+M T+R+ F  STVIIIAHR+ TI+D+D ++V+++G + E   P++LLA  D  F  L  ++
Sbjct:    1 GSAAYVPQEAWIQNLTVRDNILFGRDFDQARYDEALRACQLEKDLQLLTAGDATEIGERGINLSGGQKQRVSLARAVYQDSDIYLLDDPLAAVDSHVGKKLFHEVIGKSGLLRDKTRILVTHGIHWLPHVDEIVVID-NGRISEQGSYEHLLDHDGPFAREFFLHDGERKRASRSPAGSISLSNKPSSDFPAEDIDEEDEEVRAEKERILRRLASHSG--HQACEF---NPSVQAETHIPQLSSSPVAHGLPSSIG---------SYCSDASERV----DAKRPPALRQTSRVLDAHEVPKLHESRHERTVTEDDGKLIDEETMETGRVSLKSYVYYASARGLHYVIIMSLLHAGFSAVEVASSIWLSTWTSDPMFNNST------IYGNLNNSVLLRELNDYYIEIYGTLGVAVVLLVAIFAMIEAVSSLRASRLIHNSLLSSLFRAPMSFFDTTPTGRIVNRFSKDMEVVDHELPMVINDFYECLMASLSCIVVISYTTPIFLAAVLPLGIIYAIVQVFYLPISRQSRRLDSRSRSPILTNFSESVAGAAIIRAFRQQQRFIHISDDRVDCNARFYFLKVASNRWLGFRLELLGTVAVTIASLLAVLARGSLTPGLVGLSVSYALDISNSLNWMVRQLTELETDSVAVERLNEYSNLETEAPWTTDSLPPSGWPSRGRVEFCNYATRYRQGLDLVLQGISVSFEPGHKVGIVGRTGAGKSSLTLGLFRLIESTFGHIEVDGVRIDRLGLHSLRSALTILPQEPTVFSGSLRSNLDPFDERTDEELWAALDAAHLSSWARA-------SCGEGGTNLSV----------------------GQRQLVCLARALMRRSRLLVLDEATAAVDLETDSLIMATVRQQFADSTVIIIAHRLATIMDSDRVMVLDSGRVREFAPPRDLLAKQDSYFHFLAKEA 885          

HSP 3 Score: 79.7221 bits (195), Expect = 8.414e-11
Identity = 67/230 (29.13%), Postives = 106/230 (46.09%), Query Frame = 3
Query: 1998 WKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSL-------ISAILGEMH----RIN--GSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQE 2648
            +++   L L  I+     G  V IVG+ G GKSSL       I +  G +     RI+  G  S++  +  + QE  + + SL+ N+     ++E+  E++  A     D   L        GE G NLS GQ+Q V LARA+ +   + +LD+  +AVD      +   V        D T I++ H L  +   D V+VLDS G + E    +DLL   + +  F+ +
Sbjct:  665 YRQGLDLVLQGISVSFEPGHKVGIVGRTGAGKSSLTLGLFRLIESTFGHIEVDGVRIDRLGLHSLRSALTILPQEPTVFSGSLRSNL---DPFDERTDEELWAAL----DAAHLSSWARASCGEGGTNLSVGQRQLVCLARALMRRSRLLVLDEATAAVDLETDSLIMATVRQQ---FADSTVIIIAHRLATIMDSDRVMVLDS-GRVREFAPPRDLLAKQDSYFHFLAK 883          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A1I8JGC8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1082.01 bits (2797), Expect = 0.000e+0
Identity = 615/1467 (41.92%), Postives = 907/1467 (61.83%), Query Frame = 3
Query:  681 EVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNIL-EKIFY------------------DKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGW-----VLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKED-KLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLS----------------DESALGKAKNLLRQL----SDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDE----DPKSPRIMTPGSQSRQISKETDQNTDRLID------KPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            E  +SI+S+LT+SWLD  +   +RKE+ +    D+ R D S +   +  E + Y                  + +  +H+R   D  Q   + V+    + D+L + D+R          L  +L + +G +L+L+ +   +H    +A PFLL+ L+ +  N  +  W G      F    VLSS+  +  F ++    I+ R+ALI  IYRK+L L  E R + T GEIVNLM+VD+ +I + I F W  L  P+QIV+A+++L+ ++  A+ AG+G+ V   P+NG +M   QK    E+K KD R+K+L E+LN +KV+K+YAWE SF  KI+++R TE+ ++ ++S  F VV ++W + PFL+M+ TF+ Y+ + + +I+T  KAFVSLTLFN+LRFP+ VLPW +T+S+NA+VS+KRI  +L  ++++ + +     + D       ++EI   SF WK+ D +  L ++N ++ +GKL+AIVGKVG GKSSL+ ++LGE  +  GS++ +G++AYV QEAWIQN ++++NILF +D+++  Y++ + AC L+ DL+ L  GD TEIGERGINLSGGQKQRVSLARAVYQ+ DIYLLDDPL+AVD+HVG+ LF  VI  +G+L+DKTRILVTHG++WLP VDE++V+D NG ISE+GS++ LL     F  F++E+  H+   K  S  + +S                DE    +   +L++L    S   +V  E    V TSP+   Q    H                      HV+   +S +    D     D K P I+   S+  Q++ E   + D  +D      +   +L++EE   SG+V   +Y   I +RG  L + T+  + A+T + V S++WL  +T D    NAS  +  N++ S Y    +R+   YY+ IY I G+ + ++V  Y       ++ AS+ IHK LL  + R PM FFDTTP+GRI+NRFSKD+E +D  +PM I+D L C     + I+VI Y TP F  A++P A+     Q+FY+P SRQSRRLDS + SP+  +F+E++ G A+IRAF++QQ F  ++   +D +S+F F++ +S RWL  R+E+LG   V  A L +++GR SLT  LVGLS+SY+LQI++ LNW++RQ TELETN VA+ER+ EYS + +EA W  ++ P   WP+ G + F +Y  RYR GL LVL+ I++ F  G K+G+VGRTGAGKSSL L LFRL+E+A G I +D + I  +GLH LR  LTILPQ+P +FSG+LR NLDPF    D+E++ +L+ AHL SW  GLS GL +ECGEGG NLSV                      GQ+QL+CLARAL+R+S++L+LDEATA+VD+ETD L+M T+R+ F  STVIIIAHR+ TI+D+D ++V+++G + E   P++LLA  D  F  L  ++
Sbjct: 1729 ECRSSIISRLTFSWLDRSVLNAYRKEIGEA---DVNRLDPSLRVRTVHGEFVRYFPPLVALSRSERDAAEQQENLSFTHHRVNADTEQLVDSGVS----EGDQLHSNDSRDGAGGRHRRKLLPALWKAFGSQLILSWSIMMIHGLLAFANPFLLESLINFSTN-GEELWHGILYTFLFFVVAVLSSITFHASFQLSLTCGIKFRSALIASIYRKSLTLTQESRARSTVGEIVNLMTVDSNKIADSIPFFWAMLVSPVQIVIALVMLWAQLGTAVLAGIGIFVVIIPVNGYIMAKAQKLEEKEMKTKDERLKLLNEVLNAMKVIKLYAWEPSFQQKISHVRRTEVGFLGQMSYLFSVVIIMWTVAPFLVMVLTFITYIYSGDDHILTASKAFVSLTLFNILRFPITVLPWTITESVNAYVSIKRIQNFLFEDDIDESSVLKLPSSPDGN-----SVEIEGASFGWKRTDSEPLLKDVNIQVPKGKLIAIVGKVGCGKSSLLQSVLGETVKFCGSITTRGSVAYVPQEAWIQNLTVRDNILFGRDFDQARYDEALRACQLEKDLQLLTAGDATEIGERGINLSGGQKQRVSLARAVYQDSDIYLLDDPLAAVDSHVGKKLFHEVIGKSGLLRDKTRILVTHGIHWLPHVDEIVVID-NGRISEQGSYEHLLDHDGPFASFLKEFFLHDGERKRASRSRDVSVSIAEIAAAAPEEEEEDEELAAEKARILQRLASCTSSAHEVCAESPAVVATSPS---QSPPPH----------------------HVRQMSSSVNSHCSDTADRLDSKRPSIVRQTSKISQLTSEKLPSRDEDVDGTRKAAEQSGRLIDEETMESGSVSLKSYVFYIAARGYHLVLMTIMAHLAYTVVNVASSVWLSTWTSDPLFSNAS--VTGNLNNSAY----LRDINDYYLSIYGIFGVGIVVLVGIYAVMGVYSALRASRSIHKSLLTRLFRVPMSFFDTTPTGRIVNRFSKDMEVVDRELPMIINDFLECFMATVSCIVVISYTTPIFLAAVVPSALST---QVFYLPISRQSRRLDSRSRSPILTNFSESIAGAAVIRAFRQQQRFVGISDYRVDNNSRFYFLKLASNRWLGFRLELLGTAAVVIAALLAVLGRDSLTPGLVGLSVSYALQISDALNWMVRQLTELETNSVAVERLDEYSNLETEAPWTTDSLPPSGWPSRGRVEFCNYATRYRPGLDLVLQGISVSFEPGHKVGIVGRTGAGKSSLTLGLFRLIESAFGHIEVDGVRIDRLGLHSLRSALTILPQEPTVFSGSLRSNLDPFDERTDEELWAALDAAHLSSWARGLSAGLAHECGEGGTNLSV----------------------GQRQLVCLARALMRRSRLLVLDEATAAVDLETDSLIMATVRQQFADSTVIIIAHRLATIMDSDRVMVLDSGRVREFAPPRDLLAKQDSYFHFLAKEA 3125          

HSP 2 Score: 1074.31 bits (2777), Expect = 0.000e+0
Identity = 604/1459 (41.40%), Postives = 912/1459 (62.51%), Query Frame = 3
Query:  681 EVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNI-------------LEKIFYD------KIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGW-----VLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKED-KLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAK----NPSGGQHLSDESA---------------LGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQ---SRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            E  +SI+S+LT+SWLD  +   +RKE+ +    D+ R D S +   +             L +   D       +  +H+R   D  Q   + V+    + D+L + D+R          L  +L + +G +L+L+ A   +H    +A P LL+ L+++    S+  W G+F    F    +LSSLA +    I+ +  I+IR+ALI  IYRK+L L  E R++ T GEIVNL++VD+ +I + + F W  L  P+QI LA+++L+ ++  A+ AG+ + +   PLN ++M   Q     E+K KD R+++L E++N +KV+K+YAWE SF  KI  +R  E+  + + +    +V V W + PFL+M+ TF+ Y+ +   +++T  KAFVSLTLFN+L FP+ VLPW +T+S+NA+VSLKRI ++L  ++++ + +        S+ N+ AAIE+ +GSF+WK+ D +  L NIN  + RG LVA+VGKVG GKSSL+ ++LGE  R+ GSV++ G+ AYV QEAWIQN ++++NILF +D+++  Y++ + AC L+ DL+ L  GD TEIGERGINLSGGQKQRVSLARAVYQ+ DIYLLDDPL+AVD+HVG+ LF  VI  +G+L+DKTRILVTHG++WLP VDE++V+D NG ISE+GS++ LL     F  F++E+  H+   K    +P+G   LS++ +                 + + +LR+L+ +     +  +F   +P+V  + +     S+       S             Y  +++  V    D K P  +   S+   + ++ K  +   +R + +   +L++EE   +G V   +Y     +RGL   I    ++A F+ ++V S+IWL  +T D    N++      I G+   S ++RE   YY+ IY  +G+ + L+V  +     V S+ AS++IH  LL S+ R+PM FFDTTP+GRI+NRFSKD+E +DH +PM I+D   CL    + I+VI Y TP F  A++PL I+Y ++Q+FY+P SRQSRRLDS + SP+  +F+E++ G A+IRAF++QQ F +++   +D +++F F++ +S RWL  R+E+LG + V  A L +++ R SLT  LVGLS+SY+L I+  LNW++RQ TELET+ VA+ER+ EYS + +EA W  ++ P   WP+ G + F +Y  RYR+GL LVL+ I++ F  G K+G+VGRTGAGKSSL L LFRL+E+  G I +D + I  +GLH LR  LTILPQ+P +FSG+LR NLDPF    D+E++ +L+ AHL SW  GLS GL +ECGEGG NLSV                      GQ+QL+CLARAL+R+S++L+LDEATA+VD+ETD L+M T+R+ F  STVIIIAHR+ TI+D+D ++V+++G + E   P++LLA  D  F  L  ++
Sbjct:  112 ECRSSIISRLTFSWLDRSVLNAYRKEIGEA---DVNRLDPSLRVRTVHGEFVRYFPPLVALSRSVRDAAEQQENLSFTHHRVNADTEQLVDSGVS----EGDQLHSNDSRDGAGGRHRRKLLPALWKAFGGQLMLSWAVVMIHGLLEFANPLLLEQLIKF-SGSSEELWHGFFYTFLFFSVALLSSLAFHNSCQISLMSGIKIRSALIAAIYRKSLSLTLEARSRSTVGEIVNLLTVDSNKIADAVPFLWVVLVSPVQIFLALVMLWMQLGIAVLAGIAVFLVIIPLNAVVMVKSQSLEEREMKTKDERMRLLNEVINAMKVIKLYAWEPSFWQKIDQVRKKEVGLLAKNAYLLVLVVVSWTVAPFLVMVVTFITYIYSGNDHVLTASKAFVSLTLFNILHFPIAVLPWTITESVNAYVSLKRIQRFLDEDDIDDSSV----LKLPSSENHGAAIEVVNGSFAWKRSDTEALLQNINLTVPRGSLVAVVGKVGCGKSSLLQSVLGETVRLCGSVAMTGSAAYVPQEAWIQNLTVRDNILFGRDFDQARYDEALRACQLEKDLQLLTAGDATEIGERGINLSGGQKQRVSLARAVYQDSDIYLLDDPLAAVDSHVGKKLFHEVIGKSGLLRDKTRILVTHGIHWLPHVDEIVVID-NGRISEQGSYEHLLDHDGPFASFLKEFFLHDGERKRASRSPAGSISLSNKPSSDFPAEDIDEEDEEVRAEKERILRRLASHSG--HQACEF---NPSVQAETHIPQLSSSPVAHGLPSSIG---------SYCSDASERV----DAKRPPALRQTSRVLDAHEVPKLHESRHERTVTEDDGKLIDEETMETGRVSLKSYVYYASARGLHYVIIMSLLHAGFSAVEVASSIWLSTWTSDPMFNNST------IYGNLNNSVLLRELNDYYIEIYGTLGVAVVLLVAIFAMIEAVSSLRASRLIHNSLLSSLFRAPMSFFDTTPTGRIVNRFSKDMEVVDHELPMVINDFYECLMASLSCIVVISYTTPIFLAAVLPLGIIYAIVQVFYLPISRQSRRLDSRSRSPILTNFSESVAGAAIIRAFRQQQRFIHISDDRVDCNARFYFLKVASNRWLGFRLELLGTVAVTIASLLAVLARGSLTPGLVGLSVSYALDISNSLNWMVRQLTELETDSVAVERLNEYSNLETEAPWTTDSLPPSGWPSRGRVEFCNYATRYRQGLDLVLQGISVSFEPGHKVGIVGRTGAGKSSLTLGLFRLIESTFGHIEVDGVRIDRLGLHSLRSALTILPQEPTVFSGSLRSNLDPFDERTDEELWAALDAAHLSSWARGLSAGLAHECGEGGTNLSV----------------------GQRQLVCLARALMRRSRLLVLDEATAAVDLETDSLIMATVRQQFADSTVIIIAHRLATIMDSDRVMVLDSGRVREFAPPRDLLAKQDSYFHFLAKEA 1511          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A267EF93 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017813g1 PE=4 SV=1)

HSP 1 Score: 1078.54 bits (2788), Expect = 0.000e+0
Identity = 613/1463 (41.90%), Postives = 907/1463 (62.00%), Query Frame = 3
Query:  681 EVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNI---LEKIFYDKIKISHNRKRYDLLQNSTASVAHLM------------EDEDKLTNPDNRSPGW-----VLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKED-KLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLS----------------DESALGKAKNLLRQL----SDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDE----DPKSPRIMTPGSQSRQISKETDQNTDRLID------KPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            E  +SI+S+LT+SWLD  +   +RKE+ +    D+ R D S +   +     + F   + +S + +     Q + +   H +             + D+L + D+R          L  +L + +G +L+L+ +   +H    +A PFLL+ L+ +  N  +  W G      F    VLSS+  +  F ++    I+ R+ALI  IYRK+L L  E R + T GEIVNLM+VD+ +I + I F W  L  P+QIV+A+++L+ ++  A+ AG+G+ V   P+NG +M   QK    E+K KD R+K+L E+LN +KV+K+YAWE SF  KI+++R TE+ ++ ++S  F VV ++W + PFL+M+ TF+ Y+ + + +I+T  KAFVSLTLFN+LRFP+ VLPW +T+S+NA+VS+KRI  +L  ++++ + +     + D       ++EI   SF WK+ D +  L ++N ++ +GKL+AIVGKVG GKSSL+ ++LGE  +  GS++ +G++AYV QEAWIQN ++++NILF +D+++  Y++ + AC L+ DL+ L  GD TEIGERGINLSGGQKQRVSLARAVYQ+ DIYLLDDPL+AVD+HVG+ LF  VI  +G+L+DKTRILVTHG++WLP VDE++V+D NG ISE+GS++ LL     F  F++E+  H+   K  S  + +S                DE    +   +L++L    S   +V  E    V TSP+   Q    H                      HV+   +S +    D     D K P I+   S+  Q++ E   + D  +D      +   +L++EE   SG+V   +Y   I +RG  L + T+  + A+T + V S++WL  +T D    NAS  +  N++ S Y    +R+   YY+ IY I G+ + ++V  Y       ++ AS+ IHK LL  + R PM FFDTTP+GRI+NRFSKD+E +D  +PM I+D L C     + I+VI Y TP F  A++PL I+Y  IQ+FY+P SRQSRRLDS + SP+  +F+E++ G A+IRAF++QQ F  ++   +D +S+F F++ +S RWL  R+E++G   V  A L +++GR SLT  LVGLS+SY+LQI++ LNW++RQ TELETN VA+ER+ EYS + +EA W  ++ P   WP+ G + F +Y  RYR GL LVL+ I++ F  G K+G+VGRTGAGKSSL L LFRL+E+  G I +D + I  +GLH LR  LTILPQ+P +FSG+LR NLDPF    D+E++ +L+ AHL SW  GLS GL +ECGEGG NLSV                      GQ+QL+CLARAL+R+S++L+LDEATA+VD+ETD L+M T+R+ F  STVIIIAHR+ TI+D+D ++V+++G + E   P++LLA  D  F  L  ++
Sbjct:  226 ECRSSIISRLTFSWLDRSVLNAYRKEIGEA---DVNRLDPSLRVRTVHGEFVRYFPPLVALSRSERDAAEQQENLSFTHHRVNADTEQLVDSGDSEGDQLHSNDSRDGAGGRHRRKLLPALWKAFGSQLILSWSIMMIHGLLAFANPFLLESLINFSTN-GEELWHGILYTFLFFVVAVLSSITFHASFQLSLTCGIKFRSALIASIYRKSLTLTQESRARSTVGEIVNLMTVDSNKIADSIPFFWAMLVSPVQIVIALVMLWAQLGTAVLAGIGIFVVIIPVNGYIMAKAQKLEEKEMKTKDERLKLLNEVLNAMKVIKLYAWEPSFQQKISHVRRTEVGFLGQMSYLFSVVIIMWTVAPFLVMVLTFITYIYSGDDHILTASKAFVSLTLFNILRFPITVLPWTITESVNAYVSIKRIQNFLFEDDIDESSVLKLPSSPDGN-----SVEIEGASFGWKRTDSEPLLKDVNIQVLKGKLIAIVGKVGCGKSSLLQSVLGETVKFCGSITTRGSVAYVPQEAWIQNLTVRDNILFGRDFDQARYDEALRACQLEKDLQLLTAGDATEIGERGINLSGGQKQRVSLARAVYQDSDIYLLDDPLAAVDSHVGKKLFHEVIGKSGLLRDKTRILVTHGIHWLPHVDEIVVID-NGRISEQGSYEHLLDHDGPFASFLKEFFLHDGERKRASRSRDVSVSIAEIAAAAPEEEEEDEELAAEKARILQRLASCTSSAHEVCAESPAVVATSPS---QSPPPH----------------------HVRQMSSSVNSHCSDTADRLDSKRPSIVRQTSKISQLTSEKLPSRDEDVDGTRKAAEQSGRLIDEETMESGSVSLKSYVFYIAARGYHLVLMTIMAHLAYTVVNVASSVWLSTWTSDPLFSNAS--VTGNLNNSAY----LRDINDYYLSIYGIFGVGIVVLVGIYAVMGVYSALRASRSIHKSLLTRLFRVPMSFFDTTPTGRIVNRFSKDMEVVDRELPMIINDFLECFMATVSCIVVISYTTPIFLAAVVPLGIIYAGIQVFYLPISRQSRRLDSRSRSPILTNFSESIAGAAVIRAFRQQQRFVGISDYRVDNNSRFYFLKLASNRWLGFRLELIGTAAVVIAALLAVLGRDSLTPGLVGLSVSYALQISDALNWMVRQLTELETNSVAVERLDEYSNLETEAPWTTDSLPPSGWPSRGRVEFCNYATRYRPGLDLVLQGISVSFEPGHKVGIVGRTGAGKSSLTLGLFRLIESTFGHIEVDGVRIDRLGLHSLRSALTILPQEPTVFSGSLRSNLDPFDERTDEELWAALDAAHLSSWARGLSAGLAHECGEGGTNLSV----------------------GQRQLVCLARALMRRSRLLVLDEATAAVDLETDSLIMATVRQQFADSTVIIIAHRLATIMDSDRVMVLDSGRVREFAPPRDLLAKQDSYFHFLAKEA 1625          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 1018.07 bits (2631), Expect = 0.000e+0
Identity = 592/1535 (38.57%), Postives = 901/1535 (58.70%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDA---------SPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDES-TKNTNILEKIFYD--KIKISHNRKRYDLLQNSTASVAH---LMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVL-WEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDS-WPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSL 4919
            +Y++S  IL IT++LA L  +  R        I+  FWL AT+   +     I++ ++          S + I   L+ +S  +  L     L   FS   KD        PCPE  AS LS++++ W+   + + +++ + ++  + L  +D S T    ++ +  ++  K K + ++  Y   + S A       + E E  L     +S    LF++L R +G   L++  +K +HD  ++  P +L++L++++ +     W GYF            +L     F +  +  +R+R A++G +YRK L + N  R   T GEIVNLMSVDA+R M+ I +     S PLQ++LA+  L+Q +  ++ AG+ ++V   P+N ++    + +   ++K KD RIK++ E+LNGIKVLK+YAWE +F DK++ +R++E+R +L+ +A  G +    W   PFL+ L+TF  YVL  E+N++  +KAFVSL LFN+LRFP+ +LP  ++  + A VS+KR+  +L  EEL+   ++ R  T  +      +I I DG+FSW KED+  L  IN  I  G LVA+VG VG+GKSSL+SA+LGEMH+  G VS++G++AYV Q+AWIQN +L+ENI+F Q+  E +Y+ ++EAC+L  DLE LPGGD TEIGE+G+NLSGGQKQRVSLARAVY +  +YLLDDPLSAVDAHVG+H+FE VI   G+L+ +TR+LVTHGL++LP+ D +LV+  +G I+E GS+ +LL     F  F++ Y       + P G                                  +T     +QRN +                        V +F   +           P       Q +  S +T     +  D   ++L E ++A +G VK A +   +K+ G++L   ++ ++ A     + SN WL  +T+D  I N +Q            S+ +R      + +Y  +GL   + V  Y  S ++G I AS+ +H+ +L +VLRSPM FF+ TPSG ++NRF+K+ + +D +IP  I   +  +F V  S  VI+  TP  AI I PL +LY+ +Q FY+ +SRQ +RL+S++ SPV+ HF ETL G ++IRAF EQQ F   +   +D + K  F    + RWL++R+E +G  +V  A LF+++ R +L+  ++GLSISY+LQ+T  LNWL+R  +E+ETN VA+ER++EY     EAEW L  +   + WP  G+I  +++ LRYRE L L + +I +   GG+K+G+VGRTGAGKSSL L LFR++EAA G I ID +NI+ +GLHDLR R+TI+PQDPV+FSG+LR NLDPF  + D++++++LE AHL+++VSGL + L++EC EGG NLS+                      GQ+QL+CLARALLRK+K+L+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ G++ E DSP +L+A     +K   D  L
Sbjct:  105 VYLVSPTILGITMLLATLLIQYERIKGVQSSGIMLNFWLVATVCATVTFRSKILQAVNEPETVNVFRYSTFYIYYALLLISLILSCLSDQPPL---FSQAVKD------SNPCPEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTDDKTMYSPKRPSMAEKKDGRPVEESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAPSWHGYFYTALLFVCTCFQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLMVPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELR-VLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFLSHEELDENSVDRRAITGSAD-----SIRIGDGAFSWSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVM-VDGEITETGSYTELLNRQGAFADFLRTYANAEQDGE-PDG----------------------------------MTGKKEKLQRNTT-----------------------FVHFFPRQSQSSLNTPGAAKP-------QQKAESNDTQAKKTKSPDA--AKLTEADKANTGRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTDDPVI-NGTQP-----------SREMR------LGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARANLSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSL----------------------GQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIAKKGIFYKMAKDSGL 1516          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:103023748])

HSP 1 Score: 1014.99 bits (2623), Expect = 0.000e+0
Identity = 592/1530 (38.69%), Postives = 891/1530 (58.24%), Query Frame = 3
Query:  357 IDGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSS----FSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNIL------EKIFYDKIKISHNRKR-YDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFG--VLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL-NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            +  +Y ++ +I+ +T++LA    +  R        +LFIFW+ + +  ++     I+        N+           F L L+  +  CF+     FS    V+ +  PCPE  A  LS++T+ W  +   K ++  +  +  + L +QD S      L      EK     I+   N +  Y      T  V    E+ + L +    +P      SL + +G   L+  AFK + D   +  P LL++L+E+ +      W G+  A+AF+ FG  +L +L  +  F    +  +R+R A+IG IYRK+L + NE +   T GE+VNLMSVDA+R M+   F     S PLQI+LA+  L+Q +  ++ AG+ ++V   P N ++    + +   ++++KD RIK++ EILNGIKVLK+YAWE SF +K+  +R  E+  + + +    +  + W   PFL+ L TF  YV   + N++  +KAFVSL+LFN+LRFP+ +LP  ++  + A VSLKRI  +L  +EL+       D  D      D A+ + +G FSW K+D   L +IN  + +G L+A+VG VG GKSSL++A+LGEM ++ G +S++G++AYV Q+AWIQN +L++NILF + Y E+ Y  ++EAC+L  DLE LPGGD TEIGE+GINLSGGQ+QRVSLARA+Y   D+YL+DDPLSAVDAHV +H+F++VI   G L+ KTRILVTHG+++LP+VD +LVL   G +SE GS++DLLK    F +F++ Y   +   ++      + +E +              +D +   TD V   PAV   R    R                      +    N      + E+PK+  I       R+  +   +  +  ++K    L++ E A +G VK+  Y    K+ G  L +    +YA+ +   + +NIWL  +T DS     +Q                 E+    + +Y  +G+   ++V F   +  +G I A++ +H+ LL +   +P  FFDTTP GRIINRFSKDI  +D  +P  I   L   F   A++IVI+  TP FA+ I+PLA++Y+ +Q FY+ TSRQ +RL+S++ SP+++HF+ET+ G ++IRA+     F  ++   +D++ K  +    S RWL +RIE +G  +V  A +F+++ + +L+  LVGLS+SY+LQ+T  LNW++R  ++LE+N VA+ER++EYS+ P EA W++ +  P   WP+ GN+ F DY +RYREGL LVL+NI+L   GG+KIG+VGRTGAGKSS+ L LFRL+EAAGG I ID + I  IGLHDLR +LTI+PQ+PV+FSGTLR NLDPF  + DD+++ +L  +HL  +VS     L  EC EGG NLSV                      GQ+QL+CLARALLRK+++LILDEATA++D+ETD L+  TIR  F+  TV  IAHR+NTI+D   I+V++ G+I E D+P NL+A   GIF S+
Sbjct:   96 VPPIYFITPLIVGMTMLLATFIIQFERLRGVQSSGVLFIFWMLSVLCAIVPFRSKILHANKGE--NVDKLRFTTFYMYFGLILVELILCCFNEKPPLFSS---VVTDPNPCPESTAGFLSRMTFWWFTSMAIKGYKSPLETKDLWSLNKQDSSELVVPKLLREWEGEKSKAQSIEQDVNGQAVYSKAGAETNHVEVNPEEVEVLLSSKKDTPQPSFLRSLLKAFGPYFLIGSAFKLLQDLITFINPQLLRMLIEFTKETGVPSWWGF--ALAFMMFGCALLQTLILHQHFQYCFVTGMRLRTAIIGAIYRKSLVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIILALFFLWQTLGPSVLAGVAVMVLLIPFNAVIAMKTRAYQVEQMQYKDARIKLMNEILNGIKVLKLYAWEVSFKEKVLQIRQKELNVLRKTAYLSALSTMAWTSAPFLVALTTFAVYVSVDKNNVLDADKAFVSLSLFNILRFPLNMLPQVISSLVQASVSLKRIQAFLSHDELD------PDNVDKKPAPSDHAVTVVNGKFSWAKKDPPALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVL-VEGMVSEMGSYQDLLKQNGAFAEFLRNYSLEDIIEEDEVTEVLIDEEESF------------PDDALSNHTDMVDNEPAVNEARRQFMR---------------------QISIMSN------DLENPKTKSIRKRRCSERRPGEPPQEKKEPKVEK----LIQAETAETGRVKFKVYWEYAKAVGPILSLFICFLYASQSAAAIGANIWLSQWTNDSRDSVTAQ-----------------EKVHMRVGVYASLGITQGILVMFSSFTLAMGKIQAARKLHQGLLDNKFHTPQAFFDTTPLGRIINRFSKDIYVIDEALPSTILMFLGTFFASVATMIVIVSSTPIFAVVIVPLALVYFFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGTSVIRAYGRNSAFVLMSDMKVDENQKSYYPGIVSNRWLGIRIEFIGNCIVLFAAVFAVLEKENLSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTDWPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQPAKLALECSEGGENLSV----------------------GQRQLICLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFEDCTVFTIAHRLNTIMDYTRILVLDKGQIAEFDTPVNLIA-QKGIFYSM 1528          

HSP 2 Score: 86.2705 bits (212), Expect = 2.522e-16
Identity = 82/313 (26.20%), Postives = 137/313 (43.77%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVM-HTI--REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNN 4925
            LN L +  + L    V+L+RI+ +    S  E D +N      P++  +T  +    + +  P  L++IN+    G  + VVG  G GKSSL  AL   +E   G I              +R  +  +PQ   I + TLR+N+     + + +    LE   L   +  L  G   E GE G+NLS                       GQ+Q + LARAL  ++ V ++D+  ++VD    + +  H I      +  T I++ H I+ +   D I+V+  G + E+ S ++LL  +    + L + SL +
Sbjct:  589 LNMLPQVISSLVQASVSLKRIQAFL---SHDELDPDNVDKKPAPSDHAVTVVNGKFSWAKKDPPALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHI-------------SIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLS----------------------GGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVLVEGMVSEMGSYQDLLKQNGAFAEFLRNYSLED 863          

HSP 3 Score: 77.7962 bits (190), Expect = 1.124e-13
Identity = 67/284 (23.59%), Postives = 123/284 (43.31%), Query Frame = 3
Query: 1842 TDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISE----------RGSFKDLLKDCN 2624
            +D  +  V+++R+ +Y         E+  +    D  +  +  +E  D S  +++   L L NI+  +  G+ + IVG+ G GKSS+   +   +    G +++ G              +  + QE  + + +L+ N+   + Y++    + +    L   +   P     E  E G NLS GQ+Q + LARA+ +   I +LD+  +A+D      L ++ I      +D T   + H LN +     +LVLD  G I+E          +G F  + KD  
Sbjct: 1256 SDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTD--WPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQPAKLALECSEGGENLSVGQRQLICLARALLRKTRILILDEATAAIDLET-DDLIQSTIRTQ--FEDCTVFTIAHRLNTIMDYTRILVLD-KGQIAEFDTPVNLIAQKGIFYSMAKDAG 1533          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:103023748])

HSP 1 Score: 1012.68 bits (2617), Expect = 0.000e+0
Identity = 588/1526 (38.53%), Postives = 883/1526 (57.86%), Query Frame = 3
Query:  357 IDGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNIL------EKIFYDKIKISHNRKR-YDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFG--VLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL-NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            +  +Y ++ +I+ +T++LA    +  R        +LFIFW+       L + C I+      P+                              + +++  NK PCPE  A  LS++T+ W  +   K ++  +  +  + L +QD S      L      EK     I+   N +  Y      T  V    E+ + L +    +P      SL + +G   L+  AFK + D   +  P LL++L+E+ +      W G+  A+AF+ FG  +L +L  +  F    +  +R+R A+IG IYRK+L + NE +   T GE+VNLMSVDA+R M+   F     S PLQI+LA+  L+Q +  ++ AG+ ++V   P N ++    + +   ++++KD RIK++ EILNGIKVLK+YAWE SF +K+  +R  E+  + + +    +  + W   PFL+ L TF  YV   + N++  +KAFVSL+LFN+LRFP+ +LP  ++  + A VSLKRI  +L  +EL+       D  D      D A+ + +G FSW K+D   L +IN  + +G L+A+VG VG GKSSL++A+LGEM ++ G +S++G++AYV Q+AWIQN +L++NILF + Y E+ Y  ++EAC+L  DLE LPGGD TEIGE+GINLSGGQ+QRVSLARA+Y   D+YL+DDPLSAVDAHV +H+F++VI   G L+ KTRILVTHG+++LP+VD +LVL   G +SE GS++DLLK    F +F++ Y   +   ++      + +E +              +D +   TD V   PAV   R    R                      +    N      + E+PK+  I       R+  +   +  +  ++K    L++ E A +G VK+  Y    K+ G  L +    +YA+ +   + +NIWL  +T DS     +Q                 E+    + +Y  +G+   ++V F   +  +G I A++ +H+ LL +   +P  FFDTTP GRIINRFSKDI  +D  +P  I   L   F   A++IVI+  TP FA+ I+PLA++Y+ +Q FY+ TSRQ +RL+S++ SP+++HF+ET+ G ++IRA+     F  ++   +D++ K  +    S RWL +RIE +G  +V  A +F+++ + +L+  LVGLS+SY+LQ+T  LNW++R  ++LE+N VA+ER++EYS+ P EA W++ +  P   WP+ GN+ F DY +RYREGL LVL+NI+L   GG+KIG+VGRTGAGKSS+ L LFRL+EAAGG I ID + I  IGLHDLR +LTI+PQ+PV+FSGTLR NLDPF  + DD+++ +L  +HL  +VS     L  EC EGG NLSV                      GQ+QL+CLARALLRK+++LILDEATA++D+ETD L+  TIR  F+  TV  IAHR+NTI+D   I+V++ G+I E D+P NL+A   GIF S+
Sbjct:   96 VPPIYFITPLIVGMTMLLATFIIQFERLRGVQSSGVLFIFWM-------LSVLCAIV------PF------------------------------RSKILHANKNPCPESTAGFLSRMTFWWFTSMAIKGYKSPLETKDLWSLNKQDSSELVVPKLLREWEGEKSKAQSIEQDVNGQAVYSKAGAETNHVEVNPEEVEVLLSSKKDTPQPSFLRSLLKAFGPYFLIGSAFKLLQDLITFINPQLLRMLIEFTKETGVPSWWGF--ALAFMMFGCALLQTLILHQHFQYCFVTGMRLRTAIIGAIYRKSLVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIILALFFLWQTLGPSVLAGVAVMVLLIPFNAVIAMKTRAYQVEQMQYKDARIKLMNEILNGIKVLKLYAWEVSFKEKVLQIRQKELNVLRKTAYLSALSTMAWTSAPFLVALTTFAVYVSVDKNNVLDADKAFVSLSLFNILRFPLNMLPQVISSLVQASVSLKRIQAFLSHDELD------PDNVDKKPAPSDHAVTVVNGKFSWAKKDPPALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVL-VEGMVSEMGSYQDLLKQNGAFAEFLRNYSLEDIIEEDEVTEVLIDEEESF------------PDDALSNHTDMVDNEPAVNEARRQFMR---------------------QISIMSN------DLENPKTKSIRKRRCSERRPGEPPQEKKEPKVEK----LIQAETAETGRVKFKVYWEYAKAVGPILSLFICFLYASQSAAAIGANIWLSQWTNDSRDSVTAQ-----------------EKVHMRVGVYASLGITQGILVMFSSFTLAMGKIQAARKLHQGLLDNKFHTPQAFFDTTPLGRIINRFSKDIYVIDEALPSTILMFLGTFFASVATMIVIVSSTPIFAVVIVPLALVYFFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGTSVIRAYGRNSAFVLMSDMKVDENQKSYYPGIVSNRWLGIRIEFIGNCIVLFAAVFAVLEKENLSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTDWPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQPAKLALECSEGGENLSV----------------------GQRQLICLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFEDCTVFTIAHRLNTIMDYTRILVLDKGQIAEFDTPVNLIA-QKGIFYSM 1486          

HSP 2 Score: 85.8853 bits (211), Expect = 3.331e-16
Identity = 82/313 (26.20%), Postives = 137/313 (43.77%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVM-HTI--REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNN 4925
            LN L +  + L    V+L+RI+ +    S  E D +N      P++  +T  +    + +  P  L++IN+    G  + VVG  G GKSSL  AL   +E   G I              +R  +  +PQ   I + TLR+N+     + + +    LE   L   +  L  G   E GE G+NLS                       GQ+Q + LARAL  ++ V ++D+  ++VD    + +  H I      +  T I++ H I+ +   D I+V+  G + E+ S ++LL  +    + L + SL +
Sbjct:  547 LNMLPQVISSLVQASVSLKRIQAFL---SHDELDPDNVDKKPAPSDHAVTVVNGKFSWAKKDPPALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHI-------------SIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLS----------------------GGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVLVEGMVSEMGSYQDLLKQNGAFAEFLRNYSLED 821          

HSP 3 Score: 77.0258 bits (188), Expect = 1.590e-13
Identity = 67/284 (23.59%), Postives = 123/284 (43.31%), Query Frame = 3
Query: 1842 TDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISE----------RGSFKDLLKDCN 2624
            +D  +  V+++R+ +Y         E+  +    D  +  +  +E  D S  +++   L L NI+  +  G+ + IVG+ G GKSS+   +   +    G +++ G              +  + QE  + + +L+ N+   + Y++    + +    L   +   P     E  E G NLS GQ+Q + LARA+ +   I +LD+  +A+D      L ++ I      +D T   + H LN +     +LVLD  G I+E          +G F  + KD  
Sbjct: 1214 SDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTD--WPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQPAKLALECSEGGENLSVGQRQLICLARALLRKTRILILDEATAAIDLET-DDLIQSTIRTQ--FEDCTVFTIAHRLNTIMDYTRILVLD-KGQIAEFDTPVNLIAQKGIFYSMAKDAG 1491          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 1010.75 bits (2612), Expect = 0.000e+0
Identity = 593/1539 (38.53%), Postives = 905/1539 (58.80%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDA---------SPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDES-TKNTNILEKIFYD--KIKISHNRKRYDLLQNSTASVAH---LMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVL-WEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESAL--GKAKNLLRQLSDNEDVVEEITDFVLTSP--AVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDS-WPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSL 4919
            +Y++S  IL IT++LA L  +  R        I+  FWL AT+   +     I++ ++          S + I   L+ +S  +  L     L   FS   KD        PCPE  AS LS++++ W+   + + +++ + ++  + L  +D S T    ++ +  ++  K K + ++  Y   + S A       + E E  L     +S    LF++L R +G   L++  +K +HD  ++  P +L++L++++ +     W GYF            +L     F +  +  +R+R A++G +YRK L + N  R   T GEIVNLMSVDA+R M+ I +     S PLQ++LA+  L+Q +  ++ AG+ ++V   P+N ++    + +   ++K KD RIK++ E+LNGIKVLK+YAWE +F DK++ +R++E+R +L+ +A  G +    W   PFL+ L+TF  YVL  E+N++  +KAFVSL LFN+LRFP+ +LP  ++  + A VS+KR+  +L  EEL+   ++ R  T  +      +I I DG+FSW KED+  L  IN  I  G LVA+VG VG+GKSSL+SA+LGEMH+  G VS++G++AYV Q+AWIQN +L+ENI+F Q+  E +Y+ ++EAC+L  DLE LPGGD TEIGE+G+NLSGGQKQRVSLARAVY +  +YLLDDPLSAVDAHVG+H+FE VI   G+L+ +TR+LVTHGL++LP+ D +LV+  +G I+E GS+ +LL     F  F++ Y       + P G    +    L  G    +LRQ   +           L +P  A P Q+ +S+                                      D ++ +  +P   + ++++    NT R                   VK A +   +K+ G++L   ++ ++ A     + SN WL  +T+D  I N +Q            S+ +R      + +Y  +GL   + V  Y  S ++G I AS+ +H+ +L +VLRSPM FF+ TPSG ++NRF+K+ + +D +IP  I   +  +F V  S  VI+  TP  AI I PL +LY+ +Q FY+ +SRQ +RL+S++ SPV+ HF ETL G ++IRAF EQQ F   +   +D + K  F    + RWL++R+E +G  +V  A LF+++ R +L+  ++GLSISY+LQ+T  LNWL+R  +E+ETN VA+ER++EY     EAEW L  +   + WP  G+I  +++ LRYRE L L + +I +   GG+K+G+VGRTGAGKSSL L LFR++EAA G I ID +NI+ +GLHDLR R+TI+PQDPV+FSG+LR NLDPF  + D++++++LE AHL+++VSGL + L++EC EGG NLS+                      GQ+QL+CLARALLRK+K+L+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ G++ E DSP +L+A     +K   D  L
Sbjct:  105 VYLVSPTILGITMLLATLLIQYERIKGVQSSGIMLNFWLVATVCATVTFRSKILQAVNEPETVNVFRYSTFYIYYALLLISLILSCLSDQPPL---FSQAVKD------SNPCPEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTDDKTMYSPKRPSMAEKKDGRPVEESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAPSWHGYFYTALLFVCTCFQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLMVPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELR-VLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFLSHEELDENSVDRRAITGSAD-----SIRIGDGAFSWSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVM-VDGEITETGSYTELLNRQGAFADFLRTYANAEQDGE-PDGMTDGAPRKTLENGGPAAVLRQSQSS-----------LNTPGAAKPQQKAESN--------------------------------------DTQAKKTKSP--DAAKLTEADKANTGR-------------------VKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTDDPVI-NGTQP-----------SREMR------LGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARANLSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSL----------------------GQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIAKKGIFYKMAKDSGL 1516          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:103023748])

HSP 1 Score: 1000.35 bits (2585), Expect = 0.000e+0
Identity = 584/1533 (38.10%), Postives = 889/1533 (57.99%), Query Frame = 3
Query:  357 IDGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSS----FSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNIL------EKIFYDKIKISHNRKR-YDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFG--VLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVV---CFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL-NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            +  +Y ++ +I+ +T++LA    +  R        +LFIFW+ + +  ++     I+        N+           F L L+  +  CF+     FS    V+ +  PCPE  A  LS++T+ W  +   K ++  +  +  + L +QD S      L      EK     I+   N +  Y      T  V    E+ + L +    +P      SL + +G   L+  AFK + D   +  P LL++L+E+ +      W G+  A+AF+ FG  +L +L  +  F    +  +R+R A+IG IYRK+L + NE +   T GE+VNLMSVDA+R M+   F     S PLQI+LA+  L+Q +  ++ AG+ ++V   P N ++    + +   ++++KD RIK++ EILNGIKVLK+YAWE SF +K+  +R  E+  + + +    +  + W   PFL+ L TF  YV   + N++  +KAFVSL+LFN+LRFP+ +LP  ++  + A VSLKRI  +L  +EL+       D  D      D A+ + +G FSW K+D   L +IN  + +G L+A+VG VG GKSSL++A+LGEM ++ G +S++G++AYV Q+AWIQN +L++NILF + Y E+ Y  ++EAC+L  DLE LPGGD TEIGE+GINLSGGQ+QRVSLARA+Y   D+YL+DDPLSAVDAHV +H+F++VI   G L+ KTRILVTHG+++LP+VD +LVL   G +SE GS++DLLK    F +F++ Y   +   ++      + +E +              +D +   TD V   PAV   R    R                      +    N      + E+PK+  I       R+  +   +  +  ++K    L++ E A +G VK+  Y    K+ G  L +    +YA+ +   + +NIWL  +T DS     +Q                 E+    + +Y  +G+   +++   C    ++++  + A+   H  +L +VLR+P  FF+ TPSGR++NRFSKD++ +D LIP NI   +   +     ++V   +TP F I I+PL + Y+ +Q FY+ TSRQ +RL+S++ SP+++HF+ET+ G ++IRA+     F  ++   +D++ K  +    S RWL +RIE +G  +V  A +F+++ + +L+  LVGLS+SY+LQ+T  LNW++R  ++LE+N VA+ER++EYS+ P EA W++ +  P   WP+ GN+ F DY +RYREGL LVL+NI+L   GG+KIG+VGRTGAGKSS+ L LFRL+EAAGG I ID + I  IGLHDLR +LTI+PQ+PV+FSGTLR NLDPF  + DD+++ +L  +HL  +VS     L  EC EGG NLSV                      GQ+QL+CLARALLRK+++LILDEATA++D+ETD L+  TIR  F+  TV  IAHR+NTI+D   I+V++ G+I E D+P NL+A   GIF S+
Sbjct:   96 VPPIYFITPLIVGMTMLLATFIIQFERLRGVQSSGVLFIFWMLSVLCAIVPFRSKILHANKGE--NVDKLRFTTFYMYFGLILVELILCCFNEKPPLFSS---VVTDPNPCPESTAGFLSRMTFWWFTSMAIKGYKSPLETKDLWSLNKQDSSELVVPKLLREWEGEKSKAQSIEQDVNGQAVYSKAGAETNHVEVNPEEVEVLLSSKKDTPQPSFLRSLLKAFGPYFLIGSAFKLLQDLITFINPQLLRMLIEFTKETGVPSWWGF--ALAFMMFGCALLQTLILHQHFQYCFVTGMRLRTAIIGAIYRKSLVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIILALFFLWQTLGPSVLAGVAVMVLLIPFNAVIAMKTRAYQVEQMQYKDARIKLMNEILNGIKVLKLYAWEVSFKEKVLQIRQKELNVLRKTAYLSALSTMAWTSAPFLVALTTFAVYVSVDKNNVLDADKAFVSLSLFNILRFPLNMLPQVISSLVQASVSLKRIQAFLSHDELD------PDNVDKKPAPSDHAVTVVNGKFSWAKKDPPALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVL-VEGMVSEMGSYQDLLKQNGAFAEFLRNYSLEDIIEEDEVTEVLIDEEESF------------PDDALSNHTDMVDNEPAVNEARRQFMR---------------------QISIMSN------DLENPKTKSIRKRRCSERRPGEPPQEKKEPKVEK----LIQAETAETGRVKFKVYWEYAKAVGPILSLFICFLYASQSAAAIGANIWLSQWTNDSRDSVTAQ-----------------EKVHMRVGVYASLGITQGVLILANCLLCRAYSM--LKAAHATHLTMLHAVLRAPQAFFEATPSGRLLNRFSKDVDTIDSLIPDNIDIWMRTFWYTVNVLLVCSALTPMFLIVIVPLMMFYWWVQRFYVATSRQLKRLESVSRSPIYSHFSETITGTSVIRAYGRNSAFVLMSDMKVDENQKSYYPGIVSNRWLGIRIEFIGNCIVLFAAVFAVLEKENLSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTDWPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQPAKLALECSEGGENLSV----------------------GQRQLICLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFEDCTVFTIAHRLNTIMDYTRILVLDKGQIAEFDTPVNLIA-QKGIFYSM 1529          

HSP 2 Score: 85.8853 bits (211), Expect = 3.142e-16
Identity = 82/313 (26.20%), Postives = 137/313 (43.77%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVM-HTI--REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNN 4925
            LN L +  + L    V+L+RI+ +    S  E D +N      P++  +T  +    + +  P  L++IN+    G  + VVG  G GKSSL  AL   +E   G I              +R  +  +PQ   I + TLR+N+     + + +    LE   L   +  L  G   E GE G+NLS                       GQ+Q + LARAL  ++ V ++D+  ++VD    + +  H I      +  T I++ H I+ +   D I+V+  G + E+ S ++LL  +    + L + SL +
Sbjct:  589 LNMLPQVISSLVQASVSLKRIQAFL---SHDELDPDNVDKKPAPSDHAVTVVNGKFSWAKKDPPALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHI-------------SIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLS----------------------GGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVLVEGMVSEMGSYQDLLKQNGAFAEFLRNYSLED 863          

HSP 3 Score: 77.7962 bits (190), Expect = 1.051e-13
Identity = 67/284 (23.59%), Postives = 123/284 (43.31%), Query Frame = 3
Query: 1842 TDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISE----------RGSFKDLLKDCN 2624
            +D  +  V+++R+ +Y         E+  +    D  +  +  +E  D S  +++   L L NI+  +  G+ + IVG+ G GKSS+   +   +    G +++ G              +  + QE  + + +L+ N+   + Y++    + +    L   +   P     E  E G NLS GQ+Q + LARA+ +   I +LD+  +A+D      L ++ I      +D T   + H LN +     +LVLD  G I+E          +G F  + KD  
Sbjct: 1257 SDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTD--WPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQPAKLALECSEGGENLSVGQRQLICLARALLRKTRILILDEATAAIDLET-DDLIQSTIRTQ--FEDCTVFTIAHRLNTIMDYTRILVLD-KGQIAEFDTPVNLIAQKGIFYSMAKDAG 1534          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:ZFIN;Acc:ZDB-GENE-050517-16])

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 523/1443 (36.24%), Postives = 828/1443 (57.38%), Query Frame = 3
Query:  627 FSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFY-DKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDN-------RSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAER---IMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSG----GQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWL-SLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA-PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            FS+ S D    PN   CPEV AS +S+LT+ W        +R+ +     + LR +D  +     L+ ++  ++ +I+   +R  + Q++ A    L   E   +           + P  +  ++LA  +G   L+   +K + D   +A P LL  L+ ++ + S   W GY LA       + +S+  +  F    +  IR+R+AL G++YRK L +    R     GE+  LMSVD +    I N + F W   S PL I LA+  L+Q +  ++ AG+ +++   P N  +   ++      +K +D R++ L+E L+G++++KMYAWE  F D I  +R+ E+  + R +    +    W   PFL+ LA+F  YVL  E++++  E+AFVSL LFNLLR+P+  LP  +++   A VSL+R+  +L  EEL+   ++        +   ++ + I  G+F+W  ++   L++I+  + RG L+A+VG VG+GKSSL++A+LGE++++ GSV+V+G +AYV+Q+AWIQN SL++N+LF +  +E +Y ++++AC+L+ DL  LP GD TEIGE+GINLSGGQ+QRVSLARA+Y    ++LLDDPLSAVDAHVG+H+FE VI  +G+L  +TR+LVTHGL++LP VD ++VL + G +SE GS+ +L+     F + ++ + + +   ++       G H+  +        +L   S+  D+     + V+T P   + R    +                          E S SG                  ++ +S ET  + +    +P S L++ E   +G +K +     +++ G  L    + ++ A     + +N+WL  +  +  + N +Q                   T Y + +Y+ +G   +++          G + A+  +H  LL + L SP+ F+D TP GRIINRFSKD+  +D ++P      L  L     +I++I+  TP F +A IPL ++Y+ +Q FY+ TSRQ +RL+S   SPVF+HF E++ G A +RAF++++ F       +D   +  +    S R + ++ +E LG  +V  A +F+++ R SL A  VGLS+SY++Q+T  ++W++R  +E+E+N VA+ER++EYS+ P EA+W++ +  P   WP+ G++ F+DY  RYREGL LVL+NI+    GG+K+G+VGRTGAGKSSL L L R+VEAA G+I ID ++IS IGLHDLR R+TI+PQDPV+F G+LR+NLDPF  H D E++++LE AHL      L  G+ +EC EGG N SV                      GQ+QL CLARALLR+++VL+LDEATA+VDVETD L+  TIR +F A TV+ IAHR++T+LD   ++V+ +G+IVE DSP  LL+  D  F  +
Sbjct:  179 FSTDSDD----PNL--CPEVGASFISRLTFCWFTRMAVNGYRRGLKMSDLWSLRHKDSCSFVVPHLQAVWRKEQARIA---QRSAVSQSTPAETRKLHTTEKSQSGGAGTEGGATGQEPSLIRAMALA--FGPRYLVGSVYKLLQDILSFASPLLLSHLIRFVGDNSRPTWHGYALAGLMFLCAIATSMLAHQHFHAGFVTGIRLRSALTGLLYRKALMITQAARLSCAGGELTTLMSVDVQHMADITNNLNFVW---SAPLHICLAMYFLWQHLGPSVLAGVAVMLLLIPFNAFIALNIRTLQAQIIKKRDERVRTLSEALSGVRIIKMYAWEGRFRDVILRVREHELAVLGRAAYFSMLSAFTWLCSPFLVALASFGVYVLVDEHHVLDAERAFVSLALFNLLRYPLNQLPQLMSELAMASVSLRRLRNFLSLEELDPHAVDR-----SPSHLRESCVSIEGGTFTWSWDEPPILHDISLAVPRGCLLAVVGTVGSGKSSLMAALLGELNKLGGSVAVKGQVAYVAQQAWIQN-SLRDNVLFGRPLDETWYREVLQACALEQDLLALPAGDNTEIGEKGINLSGGQRQRVSLARAIYSKASVFLLDDPLSAVDAHVGKHIFERVIGPSGLLAGQTRVLVTHGLSFLPHVDRIVVLTA-GRVSESGSYSELMLSGEAFSELLRIHGQGDGAGEDSPASQDDGPHVIIDLRSPGPDEVLSTCSNIADM-----EPVMTEPRRMLMRQLGSQ--------------------------EASGSGT-----------------TQGVSTETRGHKE---TQPGSTLMQPESMETGHMKLSVVLHYLRAVGAPLSTLALLLFCANYTTMLGTNVWLSEWAGEP-VVNGTQ-----------------RNTGYRLGVYSALGAVQSVLSLVMVLMVFKGCLRAAGSLHLALLDNKLHSPISFYDVTPLGRIINRFSKDVFMIDEVLPPTFLMFLGALCNSIFTILIIVISTPVFVVAAIPLVVIYFFVQRFYVATSRQLKRLESTVRSPVFSHFGESVAGAATLRAFRQEERFVIAGDRAVDALQRTSYPSIVSQRRVGAVWLEFLGACVVLFAAMFAVLSRDSLKAGTVGLSVSYAMQVTVVMSWMVRMSSEVESNIVAVERVKEYSETPPEADWEVESCRPPADWPSQGHVEFRDYSTRYREGLDLVLRNISCDIKGGEKVGIVGRTGAGKSSLTLCLLRMVEAASGAIAIDGVDISRIGLHDLRSRITIIPQDPVLFGGSLRDNLDPFGHHSDAEVWEALEFAHLGETARALPGGIQHECAEGGENFSV----------------------GQRQLACLARALLRRTRVLVLDEATAAVDVETDALIQGTIRTHFHACTVLTIAHRLHTVLDCTRVMVLSSGQIVEFDSPDVLLSRKDSAFHKM 1509          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006454.1 (pep scaffold:Pmarinus_7.0:GL483531:32:7621:1 gene:ENSPMAG00000005809.1 transcript:ENSPMAT00000006454.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 354.369 bits (908), Expect = 1.582e-108
Identity = 202/500 (40.40%), Postives = 308/500 (61.60%), Query Frame = 3
Query: 3384 GSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREY-SKIPSEAEWDLNNAP-SDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAG-KSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLL 4874
            G++ AS  +H  L   VLRS M  FDTTP+GR++NRFS+D++ +D  +P      +  + +V   + VI  V PWF +A+IPL +L+ +I        R+ +RLD+I+ SP  +H   +LQG+  I A+ +   F +  Q L+D +    F+   +VRWL++R++I+   ++    L  ++    + A+  GL+ISY++Q+T    + +R  +E E    ++ERI+ Y   +  EA   +   P +  WP +G+++F+D ++RYREGLPLVLK +  +    + +G+VGRTG+G KSSL + LFRLVE  GGSI ID + I  IGL DLR RL+I+PQ+PV+F GT+R NLDP   + D++I+++LE  H++  +  L + L+ E  E G N SV                      G++QLLC+ARA+LR SK+L+LDEATA++D ETD L+  TIR  F   T++ IAHR+NT+L  D I+VM+ G++VE DSP  LL
Sbjct:    3 GTLRASSRLHDSLFLKVLRSSMTVFDTTPTGRLLNRFSRDMDEVDVRMPFQAELFIQNVILVLFCLGVIAAVFPWFLLAVIPLCVLFLIINKISRVFIRELKRLDNISHSPFMSHVAASLQGLPTIHAYSKSDEFLHRYQELLDTNQACLFLFSCAVRWLAVRLDIISVALITTTALMMVLMHGQIPAAYAGLAISYAIQLTGTFQFTIRLASETEARFTSVERIQHYIEALEEEAPDHVPEKPLAAEWPQHGSVSFQDVEMRYREGLPLVLKRVTANIKPRENVGIVGRTGSGCKSSLGVCLFRLVELCGGSISIDGVPIGDIGLGDLRSRLSIIPQEPVLFIGTIRTNLDPLGLYTDEQIWEALERTHMKDNIGQLPQKLETEVVENGENFSV----------------------GERQLLCVARAILRHSKILLLDEATAAIDTETDTLIQETIRRAFGDCTMLTIAHRLNTVLSCDRIMVMDQGQVVEFDSPSTLL 480          

HSP 2 Score: 90.5077 bits (223), Expect = 7.872e-19
Identity = 106/491 (21.59%), Postives = 217/491 (44.20%), Query Frame = 3
Query: 1206 SIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIF-AWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLT----LFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSA-FNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTG-KSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKD 2618
            ++R  + L   ++ K LR +  + +   +G ++N  S D + +   + F A  F+   + ++  + ++     + + A + L V F  +N +    +++   ++       +  +   L G+  +  Y+    FL +   L DT    +   S A   + V  +I+   ++  T L  VL   +  I    A ++++    L    +F + +     +++   F S++RI  Y+  E L     +H      +A +    ++  +D    +++   L L  +   I   + V IVG+ G+G KSSL   +   +    GS+S+ G              ++ + QE  +   +++ N+     Y ++   + +E   +K ++ QLP   ETE+ E G N S G++Q + +ARA+ ++  I LLD+  +A+D      + E +    G   D T + + H LN +   D ++V+D  G + E  S   LL++
Sbjct:    4 TLRASSRLHDSLFLKVLRSSMTVFDTTPTGRLLNRFSRDMDEVDVRMPFQAELFIQNVILVLFCLGVIAAVFPWFLLAVIPLCVLFLIINKISRVFIRELKRLDNISHSPFMSHVAASLQGLPTIHAYSKSDEFLHRYQELLDTNQACLFLFSCAVRWLAVRLDIISVALITTTALMMVLM--HGQIPAAYAGLAISYAIQLTGTFQFTIRLA----SETEARFTSVERIQHYI--EALEEEAPDHVPEKPLAAEWPQHGSVSFQDVEMRYREGLPLVLKRVTANIKPRENVGIVGRTGSGCKSSLGVCLFRLVELCGGSISIDGVPIGDIGLGDLRSRLSIIPQEPVLFIGTIRTNLDPLGLYTDEQIWEALERTHMKDNIGQLPQKLETEVVENGENFSVGERQLLCVARAILRHSKILLLDEATAAIDTETDTLIQETIRRAFG---DCTMLTIAHRLNTVLSCDRIMVMD-QGQVVEFDSPSTLLEN 482          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007076.1 (pep scaffold:Pmarinus_7.0:GL480539:10051:22495:1 gene:ENSPMAG00000006379.1 transcript:ENSPMAT00000007076.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 354.369 bits (908), Expect = 5.933e-108
Identity = 206/529 (38.94%), Postives = 319/529 (60.30%), Query Frame = 3
Query: 3294 EQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRF--SLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLL 4874
            +  ++Y+ +Y  +    T+        F  G + A+K IH  LL  VL++P+ FFD TP+GRI+NRFS D+  +D  +P  ++  ++ LF +  +I+V+ Y  PW A+ ++PLA +YY +Q +Y  TSR+ +RL S+  SP+++HF E+L G+A+I+AF+    F   N+  ++ + + +F   + + WL +R++++G ++V +    +++      +   LVGL+I+Y+L I   L+ L+  +T+ ET  V++ER++EY  I SE         S  WP  G +TF    L YR GLP  L  I+   +  +K+G+VGRTG+GKS+L   LFR+V+   G+I ID  +IS + L  LR  L I+PQDP +FS T+R NLDP  S++D E+++ LE  HL+S+V     GL  E  E G + S                       GQ+QLLCLARA+L K+K+L +DEATASVD +TD L+  TIR  F  STV+ IAHR NTILD+D ++V++ G ++E  SP +LL
Sbjct:   16 DPVQFYLSVYGALAAGNTVFTLLRAFLFAYGGVCAAKNIHVTLLHKVLQAPVSFFDATPTGRIMNRFSSDLFTVDDSLPFIMNIFMAQLFGLVGAIVVMCYGLPWMALVLLPLAGVYYCVQKYYRFTSRELKRLGSVTLSPIYSHFAESLSGLAIIKAFRATDRFTRENEARLELNQRCQFAAVAVMHWLDVRLQMMGVVIVVSLAALAVLEHHLRGVDPGLVGLAIAYALGINGRLSGLVSSFTQTETQMVSVERVQEYRGIASEEAHRHPTHVSPDWPQGGALTFDKVFLTYRPGLPFALNGISFCINSWEKVGIVGRTGSGKSTLFSVLFRIVDVQHGAIYIDNQDISKLALKQLRSNLAIIPQDPFLFSDTVRNNLDPKGSYQDHELWEVLEKCHLKSFVLD-QGGLQAEVAERGRDFS----------------------CGQRQLLCLARAMLFKAKILCIDEATASVDQDTDVLLQKTIRSEFVNSTVLTIAHRPNTILDSDRVLVLQGGRVLEFASPHDLL 521          

HSP 2 Score: 88.5817 bits (218), Expect = 4.816e-18
Identity = 113/478 (23.64%), Postives = 210/478 (43.93%), Query Frame = 3
Query: 1290 SGEIVNLMSVDAERIMNWIIFAW-FFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQ--KFSTIELKWKDLRIKILT---------EILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTS----EYNIITPEKAFVSLTLFNLLRF--PMVVLPWGLTDSMNAFVSLKRIGQY--LVGEELNLTEIN-HRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAIL-------GEMHRINGSVS------VQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKS-DLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKD 2618
            +G I+N  S D   + + + F    F++    +V AI+++   + +       + +   PL G+   + +  +F++ ELK    R+  +T         E L+G+ ++K +     F       R+ E R  L     F  V V+  +   L M+   +   L +    E+++   +   V L +   L     +  L    T +    VS++R+ +Y  +  EE +    +   D+    A  +D          +++      LN I+F I   + V IVG+ G+GKS+L S +        G ++  N  +S      ++  +A + Q+ ++ + +++ N+     Y +    +++E C LKS  L+Q  GG + E+ ERG + S GQ+Q + LARA+     I  +D+  ++VD      L + + S      + T + + H  N +   D VLVL   G + E  S  DLL+D
Sbjct:   75 TGRIMNRFSSDLFTVDDSLPFIMNIFMAQLFGLVGAIVVMCYGLPW-------MALVLLPLAGVYYCVQKYYRFTSRELK----RLGSVTLSPIYSHFAESLSGLAIIKAFRATDRFT------RENEARLELNQRCQFAAVAVMHWLDVRLQMMGVVIVVSLAALAVLEHHLRGVDPGLVGLAIAYALGINGRLSGLVSSFTQTETQMVSVERVQEYRGIASEEAHRHPTHVSPDWPQGGALTFDKVF------LTYRPGLPFALNGISFCINSWEKVGIVGRTGSGKSTLFSVLFRIVDVQHGAIYIDNQDISKLALKQLRSNLAIIPQDPFLFSDTVRNNLDPKGSYQDHELWEVLEKCHLKSFVLDQ--GGLQAEVAERGRDFSCGQRQLLCLARAMLFKAKILCIDEATASVDQDTDVLLQKTIRSE---FVNSTVLTIAHRPNTILDSDRVLVLQ-GGRVLEFASPHDLLQD 523          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001536.1 (pep scaffold:Pmarinus_7.0:GL479104:2125:31869:1 gene:ENSPMAG00000001392.1 transcript:ENSPMAT00000001536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 333.569 bits (854), Expect = 6.150e-101
Identity = 198/528 (37.50%), Postives = 319/528 (60.42%), Query Frame = 3
Query: 3339 CMTLVVCFYWASFTV--GSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRF--SLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWD--LNNAP-SDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKS 4901
            C  + +CF   S TV    +  ++ +H  +L+ ++ +PM +FDTTP G I+NRFS D   +D  IP  +   +    +  +++ +I YVTP F IA++PLAI YY IQ ++   SR  + LD     P+F+HF+ET++G+  IRAF+ +  F+     L D ++       ++ RWL +R++ +G  +V  A + SI   +  +L+++ VGL ++Y+L ++ +LNW++R   ++E    A++R+    +I +E+ +D  L+ A   D+WP +G I  ++  +RY   L  VLK++N H    +K+G+ GRTG+GKSSL+LA FR+V+   G IIID I+I+ I LH LR RL+I+ QDP++FSG++R NLDP ++  D  ++++L+ A L+  V  L  GLD    E G N SV                      GQ+QL CLARA +RK+ + I+DEATAS+D+ T+ ++   +   F   TV+IIAHR++TIL  D+++V++ G ++E D+P  LLA  D +F S
Sbjct:   11 CSGIALCFI-TSLTVEWTGLKTARNVHNNMLKRIVLAPMRYFDTTPLGHILNRFSADTNIMDQQIPTTLESLMRSALLCLSALGIIAYVTPIFLIALVPLAIAYYFIQKYFRVASRDLQELDDSTQLPLFSHFSETVEGITTIRAFRHEVRFRQRLLELTDANNISYLFLSAANRWLEVRLDYIGACIVLIASVASITDSWNNTLSSARVGLCLTYALMVSNYLNWVVRNLADIEVQMGAIKRVNNLLQIETES-YDGLLSQAQVPDNWPQSGEIKIEELSVRYDSTLKPVLKHVNAHIQPSQKVGICGRTGSGKSSLSLAFFRMVDTFEGRIIIDNIDIAKIPLHTLRSRLSIILQDPILFSGSIRFNLDPEAACGDGVLWEALDIAQLKHVVKALPGGLDAMVTENGENFSV----------------------GQRQLFCLARAFVRKTSIFIMDEATASIDMATESILQKVVMTAFANRTVVIIAHRVHTILTADLVMVLKRGSVLEYDTPSTLLA-HDSMFAS 513          

HSP 2 Score: 73.9442 bits (180), Expect = 1.505e-13
Identity = 82/379 (21.64%), Postives = 167/379 (44.06%), Query Frame = 3
Query: 1548 TEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSV-------------SVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQ 2645
            +E + GI  ++ +  E  F  ++  L D      L +SAA   + V  + +   I+L   +  +  S  N ++  +  + LT   ++   +  +   L D      ++KR+   L  E  +   +  +    D+ +     I+I + S  +    K  L ++N  I   + V I G+ G+GKSSL  A    +    G +             +++  ++ + Q+  + + S++ N+       +    + ++   LK  ++ LPGG +  + E G N S GQ+Q   LARA  +   I+++D+  +++D      L + V++      ++T +++ H ++ +   D V+VL   GS+ E  +   LL   + F  FV+
Sbjct:  143 SETVEGITTIRAFRHEVRFRQRLLELTDANNISYLFLSAANRWLEVRLDYIGACIVLIASVASITDSWNNTLSSARVGLCLTYALMVSNYLNWVVRNLADIEVQMGAIKRVNNLLQIETESYDGLLSQAQVPDN-WPQSGEIKIEELSVRYDSTLKPVLKHVNAHIQPSQKVGICGRTGSGKSSLSLAFFRMVDTFEGRIIIDNIDIAKIPLHTLRSRLSIILQDPILFSGSIRFNLDPEAACGDGVLWEALDIAQLKHVVKALPGGLDAMVTENGENFSVGQRQLFCLARAFVRKTSIFIMDEATASIDMATESILQKVVMTA---FANRTVVIIAHRVHTILTADLVMVL-KRGSVLEYDTPSTLLAHDSMFASFVR 516          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ABCC8 (ATP binding cassette subfamily C member 8 [Source:HGNC Symbol;Acc:HGNC:59])

HSP 1 Score: 332.798 bits (852), Expect = 5.075e-93
Identity = 202/529 (38.19%), Postives = 311/529 (58.79%), Query Frame = 3
Query: 3339 CMTLVVCFYWASFTVG--SINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRF--SLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIP---SEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            C+ +V+C   +S  V    + A++ +HK+LL  ++R+P+ FFDTTP G I+NRFS D+  +D LIP +    +       +++ VI YVTP F +A++PLA+++Y IQ  +   S+  + LD     P+  H  ET+ G+A IRAF+ +  F+     LID ++       ++ RWL +R++ +G  +V A  + SI   F   L + LVGL ++Y+L ++ +LNW++R   ++E    A++R+    K+     E   +L+  P D WP+ G I       RY   L   LKN++     G+K+G+ GRTG+GKSSL+LALFR+++   GSI ID ++IS I L  LR RL+I+ QDPV+FSG++R NLDP +   D  ++ +LE A L+  V  L  GLD    EGG N S+                      GQ+QL CLARA +R++ +LI+DEATA++D+ T++++   +   F   TV++IAHR+  ILD D+++V+  G + E DSP NLLA  D IF SL
Sbjct: 1069 CLAVVMCLI-SSLAVEWVGLKAARGLHKRLLGRIVRAPLRFFDTTPLGSILNRFSADLHMIDQLIPSSTESLVRSSLFSLSAVSVIAYVTPIFLVALVPLALVHYFIQKHFRIASKDLQELDENTKLPLLLHIMETVDGIATIRAFRHESQFRQRIFELIDANNVPFLFLSAANRWLEVRMDYIGASIVLATAMASITRSFYSGLDSGLVGLGLTYALLVSIYLNWVVRNLADIEVQLQAIKRVNNLMKVEIEDDERSPELHAVPED-WPHRGEIKINRLSARYDASLKPALKNLSSVIQPGQKVGICGRTGSGKSSLSLALFRMLDIFDGSITIDDVDISKIPLSLLRSRLSIILQDPVLFSGSIRFNLDPEARSTDSMLWDALEIAQLKCVVKALPGGLDATVREGGENFSL----------------------GQRQLFCLARAFVRQTAILIMDEATAALDMATEKILQKVVMTAFADRTVVMIAHRVANILDADVVLVLNQGLLEENDSPANLLANPDTIFSSL 1573          

HSP 2 Score: 300.827 bits (769), Expect = 6.414e-83
Identity = 203/697 (29.12%), Postives = 346/697 (49.64%), Query Frame = 3
Query:  969 LFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDN----------YWI--------GYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEI--RNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCP------LQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNI-ITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYL----VGEELNLTEINHR-------------------------------------DFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSV---------SV-----------------QGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTR--ILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVE 2771
            L+ S+ R +G  ++++   + + D   +  P  +  ++ ++ N              Y+I         Y L++   F  VL        ++      I+ RAA+  MIY K L L+     R K TS  I N+++VD+ ++M      WF   CP      +QI++ + LLY  +  +   G  +I    PL   +   + +   + L+    RIK  +E+++GIK+LK+YAWE+ F   +   R  E+R +   +    +   +   +P   ++ATF+ YV  S  +I ++P  AF SL LF++L  P+ +L   +  ++ A +S++++ ++L    +G+E N  ++  R                                     +FTD S    D AI++  G F+W   +   L +IN  I  G+L  +VG++G GKSSL+SA LGEMH ++GSV         SV                 +G++AY +Q+ WI N +++ENI F   +NE+ Y+ +I  CSL+ D++ LP GD T+IGE+GINLS GQ+QR+S+ARA+YQ+ ++  LDDP +A+D H+  HL  + I   G+L + TR  +LVTH L +L   D ++ +  +G++   G+ KD+     E  +  +E +  N + +       +   +AL + KNL R +   E +V+
Sbjct:  286 LWRSVFRTFGRPIIVSSVLRYMADLLAFTGPLCIYGIVHHLNNDEQQLKPQVRALGVYFISSREFLANAYVLSVLLFFSLVLQRTLLQASYYKAIETGIKFRAAVQTMIYDKILHLSTSSVSRGKMTSRYISNVVTVDSNQLM------WFLFLCPNLWALPVQIIVGVSLLYSLLGVSALIGAAVIALLAPLQYCIATKLARAQKLTLEHSSSRIKQTSELVHGIKLLKLYAWEQVFCSTVEETRSKELRSLSTFAIYTALSTFMNAAIPITAVMATFVTYVHLSSPDITLSPAVAFASLALFHILVTPLFLLSTVVRFAVKALISMQKLTEFLATSEIGDEPNTLDVEPRPKKSSNADVVQMMAVNRKQPQKPVWDDFEPPQDWRQFEFTDGSE---DFAIKVTGGVFTWASSEPSLLTDINICIPHGQLTMVVGQIGCGKSSLLSATLGEMHLVSGSVYWNSSPRQQSVNTKNNRQERRASTFCRRRGSVAYAAQKPWILNSNVQENITFGSPFNEERYKAVINTCSLQPDIDILPQGDRTQIGEKGINLSAGQRQRISVARALYQHTNVVFLDDPFTALDIHLSDHLMHSGIL--GLLHNDTRTVVLVTHKLQYLTHADWIIAM-KDGTVQREGTLKDIQTSDPELYEMWKELM--NKQDEELQKETIIESRTALER-KNLRRAMYSKEVLVK 967          

HSP 3 Score: 87.8113 bits (216), Expect = 1.923e-17
Identity = 124/518 (23.94%), Postives = 224/518 (43.24%), Query Frame = 3
Query: 1149 FGVLSSLAENGCFFIT-SILSIRIRAA------LIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQK---FSTIELKWKDLRIKI-----LTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSV-------------QGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKD 2618
            F VL  LA   C   + ++  + ++AA      L+G I R  LR  +        G I+N  S D   I   I       S    +V + +     +S   +     +VA  PL  L+   +QK    ++ +L+  D   K+     + E ++GI  ++ +  E  F  +I  L D      L +SAA   + V  + +   I+LAT +  +  S Y+ +      + LT   L+   +  +   L D      ++KR+   L+  E+   E +         + +   I+I   S  +    K  L N++  I  G+ V I G+ G+GKSSL  A+   +   +GS+++             +  ++ + Q+  + + S++ N+       +    D +E   LK  ++ LPGG +  + E G N S GQ+Q   LARA  +   I ++D+  +A+D    + L + V++      D+T +++ H +  +   D VLVL+  G + E  S  +LL +
Sbjct: 1064 FAVLCCLAVVMCLISSLAVEWVGLKAARGLHKRLLGRIVRAPLRFFDTT----PLGSILNRFSADLHMIDQLIP------SSTESLVRSSLFSLSAVSVIAYVTPIFLVALVPL-ALVHYFIQKHFRIASKDLQELDENTKLPLLLHIMETVDGIATIRAFRHESQFRQRIFELIDANNVPFLFLSAANRWLEVRMDYIGASIVLATAMASITRSFYSGLDSGLVGLGLTYALLVSIYLNWVVRNLADIEVQLQAIKRVNN-LMKVEIEDDERSPELHAVPEDWPHRGEIKINRLSARYDASLKPALKNLSSVIQPGQKVGICGRTGSGKSSLSLALFRMLDIFDGSITIDDVDISKIPLSLLRSRLSIILQDPVLFSGSIRFNLDPEARSTDSMLWDALEIAQLKCVVKALPGGLDATVREGGENFSLGQRQLFCLARAFVRQTAILIMDEATAALDMATEKILQKVVMTA---FADRTVVMIAHRVANILDADVVLVLN-QGLLEENDSPANLLAN 1565          

HSP 4 Score: 68.1662 bits (165), Expect = 1.766e-11
Identity = 66/282 (23.40%), Postives = 118/282 (41.84%), Query Frame = 3
Query: 4071 KIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGL-------PLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGS-------------XXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQS-LETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHT---IREYFQASTVIIIAHRINTILDTDIIVVMENGEI 4844
            K P +  WD    P D          +D+ ++   G+       P +L +IN+    G+   VVG+ G GKSSL  A    +    GS                ++           R  +    Q P I +  ++EN+  F S  ++E +++ + T  LQ  +  L +G   + GE G+NLS                      AGQ+Q + +ARAL + + V+ LD+   ++D+     +MH+      +    TV+++ H++  +   D I+ M++G +
Sbjct:  649 KQPQKPVWDDFEPPQDWRQFEFTDGSEDFAIKVTGGVFTWASSEPSLLTDINICIPHGQLTMVVGQIGCGKSSLLSATLGEMHLVSGSVYWNSSPRQQSVNTKNNRQERRASTFCRRRGSVAYAAQKPWILNSNVQENIT-FGSPFNEERYKAVINTCSLQPDIDILPQGDRTQIGEKGINLS----------------------AGQRQRISVARALYQHTNVVFLDDPFTALDIHLSDHLMHSGILGLLHNDTRTVVLVTHKLQYLTHADWIIAMKDGTV 907          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: BPT1 (ABC type transmembrane transporter of MRP/CFTR family; found in vacuolar membrane, involved in the transport of unconjugated bilirubin and in heavy metal detoxification via glutathione conjugates, along with Ycf1p [Source:SGD;Acc:S000003938])

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 465/1382 (33.65%), Postives = 748/1382 (54.12%), Query Frame = 3
Query:  948 NRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWI---GYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLR-DTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFT-DDSAFNYDAAIEIRDGSFSWKKEDKLT----------------------LNNIN-FEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGS--------VSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENV-ISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVF---SNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLC----------MTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIG---RFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAE-WDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGL----SEGLDYECGEGGVN--LSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQ 4913
            NR+  W    ++ + +G  + +A  ++T  D      P  L+I ++ +   + + +    G F+A+      V+S    N  +       + IR +L  ++Y+K+LRL    RN+ ++G+I+NLMSVD  RI  +   A   +  P+QI++ +  LY  +  A+  GL  +    P+N  L   ++K S  ++K+KD+RIK +TE+LN IK +K+YAWE+  + ++ ++R D E++   ++     ++   W  +P ++  +TF  + L S+ + ++P   F SL+LFN+L   +  +P  +   +   VS++R+  +L+ +E++ + I   D + D+ A     AIE+ + +F WK ++ LT                      L NI+ FE  RG LV +VG+VG GKS+ + AILG++  ++GS        +    ++AY SQE+WI N S++ENILF   +++ +Y+  I+AC L  DL+ LP GDET +GE+GI+LSGGQK R+SLARAVY   DIYLLDD LSAVDA V +++ E V I    +LK+KT IL T+ ++ L     +  L+ NG I E+G+++D++   N   +  +   E ++   N +     ++  +  +    L QL   E    E  D V+T   + + + +S R S A+                                    PR    G+Q   + K   +                E+   G VK   Y   IK+ G+   +  V  +      +VF    N WLK ++E ++   +++ + +                  ++ +Y++IG+           M L+ C         SI  SK +H+ + +SV+RSPM FF+TTP GRIINRFS D++ +D  +    S     +     ++I++ Y  PWF +  + L ++Y   Q FYI  SR+ +RL SI+ SP+ +  +E+L G ++I A+   + F  LN   I  +  F F  +S+ RWLS+R++ +G  +V A  + ++     +  L++ +VGL +SYSL++T  L W++R    +ETN V++ERI EY ++P EA+  +    P ++WP+ G I FK+Y  +YRE L  VL NIN+     +K+G+VGRTGAGKS+L+LALFR++E   G IIID I+IS IGL DLR  L I+PQD   F GT++ NLDPF+ + +DE+ +++E AHL+  +  +      G D    +G VN  L V I            N  N +  GQ+QLLCLARALL +SK+L+LDEATASVD+ETD+++  TIR  F+  T++ IAHRI+T+LD+D I+V++ G + E DSP  LL+    IF SL ++
Sbjct:  276 NRNSLWR---AIWKSFGRTISVAMLYETTSDLLSVVQPQFLRIFIDGLNPETSSKYPPLNGVFIALTLFVISVVSVFLTNQFYIGIFEAGLGIRGSLASLVYQKSLRLTLAERNEKSTGDILNLMSVDVLRIQRFFENAQTIIGAPIQIIVVLTSLYWLLGKAVIGGLVTMAIMMPINAFLSRKVKKLSKTQMKYKDMRIKTITELLNAIKSIKLYAWEEPMMARLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCSTFGLFSLFSD-SPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSADERAL---PAIEMNNITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQESWIMNASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKHSQMIYALE-NGEIVEQGNYEDVMNRKNNTSKLKKLLEEFDSPIDNGNESDVQTEHRSESEVDEPL-QLKVTES---ETEDEVVTESELELIKANSRRASLATL----------------------------------RPRPFV-GAQLDSVKKTAQK---------------AEKTEVGRVKTKIYLAYIKACGV---LGVVLFFLFMILTRVFDLAENFWLKYWSESNEKNGSNERVWM------------------FVGVYSLIGVASAAFNNLRSIMMLLYC---------SIRGSKKLHESMAKSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFRSTNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSGMVGLLMSYSLEVTGSLTWIVRTTVTIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKYRENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSEDELKRAVEQAHLKPHLEKMLHSKPRGDDSNEEDGNVNDILDVKINE----------NGSN-LSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFKDRTILTIAHRIDTVLDSDKIIVLDQGSVREFDSPSKLLSDKTSIFYSLCEK 1554          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YOR1 (Plasma membrane ATP-binding cassette (ABC) transporter; multidrug transporter mediates export of many different organic anions including oligomycin; homolog of human cystic fibrosis transmembrane receptor (CFTR) [Source:SGD;Acc:S000003513])

HSP 1 Score: 495.738 bits (1275), Expect = 3.474e-149
Identity = 337/998 (33.77%), Postives = 547/998 (54.81%), Query Frame = 3
Query: 1944 DSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASII-----VIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREY-SKIPSEAEW-DLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            + A   D  ++ RDG    +K       ++NF+I +G+ + I G +GTGKSSL++A+ G M + +G V V G +       WIQN S+++NI+F   +N++ Y++++  CSLK+DL+ LP GD TEIGERGI LSGGQK R++LAR+VY+ +DIYL DD LSAVD+ VG+H+ +  ++  G+L +KTRIL TH L+ + +   V+VL ++G + + G+  D LK  N+ +  + ++   N+  ++      ++ E  LG+ K         E  V+E+T+           +  +  +S                        + +NSG          +I+  G  S   SKE     +R ++  IS  +  E   +   KW   ++ +         A + +   F  L  FS++WL  +TE+                     K       +YM +Y+       + +   +       I ASK ++ + ++ +L +PM + DTTP GRI+NRF+KD ++LD+     +++SL  +   FA+I+      I+Y+ PWFAIAI  L +++ LI   Y  + R+ +RL+++  S V+N+  E L G+  I+A++ Q+ F   +  LI+K ++  ++     RW+ + ++++         L  +   F ++A+ VG+ ++Y LQ+   LN +LR  T+ E +  + ER+  Y +++P EA +      P +SWP+ G I F++ D  YR GLP+VLKN+NL+   G+KIG+ GRTGAGKS++  AL+RL E   G I+ID ++IS +GL DLR++L I+PQDPV+F GT+R+NLDPF+   DDE++ +L      +    L E    +  E G +  +   H    +     NF      G++QLL L RAL+R+SK+LILDEAT+SVD ETD  +   I E F   T++ IAHR+ TI++ D I+V+E GE+ E D+P  L +  D IF+S+  +S
Sbjct:  578 NKAKRLDNMLKDRDGPEDLEKTSFRGFKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNGDLLMCGY-PWIQNASVRDNIIFGSPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLT--GMLANKTRILATHQLSLIERASRVIVLGTDGQV-DIGTV-DELKARNQTLINLLQFSSQNSEKEDEEQEAVVAGE--LGQLK--------YESEVKELTEL----------KKKATEMS------------------------QTANSG----------KIVADGHTS---SKE-----ERAVNS-ISLKIYREYIKAAVGKWGFIALPL--------YAILVVGTTFCSL--FSSVWLSYWTEN---------------------KFKNRPPSFYMGLYSFFVFAAFIFMNGQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDN----ELTESLRLMTSQFANIVGVCVMCIVYL-PWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIAFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPPESWPSMGEIIFENVDFAYRPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAIA-KDDLPEVKLQKPDENGTHGKMHKFHLDQAVEEEGSNF----SLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEEFGDCTILCIAHRLKTIVNYDRILVLEKGEVAEFDTPWTLFSQEDSIFRSMCSRS 1466          

HSP 2 Score: 89.3521 bits (220), Expect = 3.559e-18
Identity = 90/450 (20.00%), Postives = 193/450 (42.89%), Query Frame = 3
Query:  678 PEVYASILSKLTYSWLDAYIYKWFRKEMTDETSF--DLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRS------DNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWK 2003
            P  + +I+S + + W+   +   +++ +     F  D R   E+  +      I+Y        RK+Y   ++  A+   +ME+         + P   +  +L   +  +  ++  F  + + +    P + K L+E+++ ++       N  IGY +    + F  ++ L  N  F  + +  ++ ++ L     +K    +N  R+ F +G++ + ++ D  RI   + F  F    P  + + I+LL   +      G+G+    F ++     L+  F      + D R+ ++ E+LN IK++K Y WE ++   I ++R  E+  + ++  +   +  +   LP +  L TFL     ++     P   F SL+LF +L   M  LP  +   ++  + L R+   L   E +  ++   +      F+   A+++   SF W+
Sbjct:  109 PLFHTNIISNMFFWWVLPILRVGYKRTIQPNDLFKMDPRMSIETLYDDFEKNMIYY----FEKTRKKYRK-RHPEATEEEVMENA--------KLPKHTVLRALLFTFKKQYFMSIVFAILANCTSGFNPMITKRLIEFVEEKAIFHSMHVNKGIGYAIGACLMMF--VNGLTFNHFFHTSQLTGVQAKSILTKAAMKKMFNASNYARHCFPNGKVTSFVTTDLARIEFALSFQPFLAGFPAILAICIVLLIVNLGPIALVGIGIFFGGFFISLFAFKLILGFRIAANIFTDARVTMMREVLNNIKMIKYYTWEDAYEKNIQDIRTKEISKVRKMQLSRNFLIAMAMSLPSIASLVTFLAMYKVNKGG-RQPGNIFASLSLFQVLSLQMFFLPIAIGTGIDMIIGLGRLQSLLEAPEDDPNQM--IEMKPSPGFDPKLALKMTHCSFEWE 540          

HSP 3 Score: 74.3294 bits (181), Expect = 1.369e-13
Identity = 120/549 (21.86%), Postives = 236/549 (42.99%), Query Frame = 3
Query: 1092 QNRSDNYWIG---YFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPL-QIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWE-ILPFLIMLA-------TFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVV--LPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHR--DFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRIN-----------------GSVSVQGTIAYVSQEAWIQNKSLKENI-LFTQDYNEKFYEDIIEACSL-KSDLE----QLPGGDETE-----------IGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISE 2588
            +NR  ++++G   +F+  AF+F         NG F I   + I     L     ++ L       +    G I+N  + D + + N +  +   ++     IV   ++    + +   A   L+V F  +     +  ++   +E   +      L E+L G+  +K Y  ++ FL K   L       I +++ A  +V VL   +  FL M+A       T LC  +T  + I     A V + L  +L+ P ++  +   +T + N   S +R+  Y    EL L E ++R  + T   ++     I   +  F+++    + L N+N  I  G+ + I G+ G GKS+++SA    ++R+N                 G   ++  +A + Q+  +   ++++N+  F +  +++ ++ ++   ++ K DL     Q P  + T            + E G N S G++Q ++L RA+ +   I +LD+  S+VD      +   ++   G   D T + + H L  +   D +LVL+  G ++E
Sbjct:  927 KNRPPSFYMGLYSFFVFAAFIFM--------NGQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFL-------INKMNEAGYLVVVLQRWVGIFLDMVAIAFALIITLLC--VTRAFPI---SAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTY--ATELPL-EASYRKPEMTPPESWPSMGEIIFENVDFAYRPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSA----LYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEEFG---DCTILCIAHRLKTIVNYDRILVLE-KGEVAE 1444          

HSP 4 Score: 50.8322 bits (120), Expect = 2.207e-6
Identity = 58/250 (23.20%), Postives = 104/250 (41.60%), Query Frame = 3
Query: 4191 LKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENL---DPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVM-HTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNND 4928
             K++N     G+ I + G  G GKSSL       + A  GS+      +   G  DL     ++   P I + ++R+N+    PF+  K DE+   +    L++ +  L  G   E GE G+ LS                       GQK  + LAR++ +K  + + D+  ++VD    + +M   +       T I+  H+++ I     ++V+     V+I +   L A +  +   L   S N++
Sbjct:  604 FKDLNFDIKKGEFIMITGPIGTGKSSL-------LNAMAGSMRKTDGKVEVNG--DL-----LMCGYPWIQNASVRDNIIFGSPFNKEKYDEV---VRVCSLKADLDILPAGDMTEIGERGITLS----------------------GGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILATHQLSLIERASRVIVLGTDGQVDIGTVDELKARNQTLINLLQFSSQNSE 814          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YCF1 (Vacuolar glutathione S-conjugate transporter; ABC-C transporter of the ATP-binding cassette family; required for vacuole fusion; forms stable complexes with vacuole fusion machinery; regulates Vam7p recruitment to vacuoles; role in detoxifying metals (Cd, Hg, As); transports GSSG that is not immediately reduced in cytosol to vacuole; transports unconjugated bilirubin, selenodigluthatione, oxidized glutathione; similar to human cystic fibrosis protein CFTR [Source:SGD;Acc:S000002542])

HSP 1 Score: 448.743 bits (1153), Expect = 2.555e-132
Identity = 272/647 (42.04%), Postives = 397/647 (61.36%), Query Frame = 3
Query: 2988 RQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWA---TYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTV-GSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSI--IGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL-NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLS-EGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            R+ S  T  + D   D+ I++    EQ   G VKW     Y+     + + +FI  + I + F  L V  N+WLK+++E                 S Y S         Y+ IY  +G+   L          V  +I+ASK +H  +  SVLR+PM FF+TTP GRI+NRFS DI  +D L+    S        V  +I VI   T  F   IIPL++ Y   Q +Y+ TSR+ RRLDSI  SP+++HF ETL G+A +R + +Q+ F ++NQ  ID +    +   ++ RWL+ R+E++G +++  A   S+  + + +LTA +VGLS+SY+LQIT+ LNW++R   E+ETN V++ERI+EY+ + SEA   +  + P   WP+ G+I F +Y  RYR  L LVLK+IN+H    +K+G+VGRTGAGKSSL LALFR++EA+ G+I+ID I I+ IGL+DLR +L+I+PQD  +F GT+REN+DP + + D+ I+++LE +HL+  V  +S +GLD +  EGG NLSV                      GQ+QLLCLARA+L  SK+L+LDEATA+VDVETD++V  TIR  F+  T++ IAHR+NTI+D+D I+V++NG++ E DSP  LL+ +  +F SL
Sbjct:  905 RRASDATLGSIDFGDDENIAKREHREQ---GKVKWNIYLEYAKACNPKSVCVFILFIVI-SMF--LSVMGNVWLKHWSE---------------VNSRYGSN---PNAARYLAIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQFIFIIIPLSVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKEWPSQGDIKFNNYSTRYRPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSV----------------------GQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDRTILTIAHRLNTIMDSDRIIVLDNGKVAEFDSPGQLLSDNKSLFYSL 1505          

HSP 2 Score: 416.772 bits (1070), Expect = 2.870e-121
Identity = 245/705 (34.75%), Postives = 393/705 (55.74%), Query Frame = 3
Query:  657 LPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQN----RSDNYWI----------------GYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMN---WIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDT-EMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEI-RDGSFSW--KKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFM-QFVQEYIEHNNRAKNPSG 2687
            L  + P P   A+I S++T+SW+   +   + K + +   + L R   S + +  LEK +                             E++L    N S  W    ++ R +G ++LLA  FK +HD   +  P LL+IL++++ +    R D++                  G+ +A A    G   +   +  F       + I++AL  +IY+K+L L+NE     ++G+IVNLMSVD +++ +   W+   W   S P QI++ +  LY+ +  +++ G+ ++V   PLN  LM + +K    ++K+KD R ++++EILN IK LK+YAWEK + +K+  +R+  E++ + ++     V    + I+PFL+   TF  +V T E   +T +  F +LTLFNLL FP++++P  L   + A VS+ R+  +   EEL    +       +     D AI I  D +F W  K E K+ L NINF+  +G L  IVGKVG+GK++L+S +LG++ R+ G  +V G++AYVSQ  WI N ++KENILF   Y+ +FYE  I+AC+L  DL  L  GD+T +GE+GI+LSGGQK R+SLARAVY   D YLLDDPL+AVD HV +HL E+V+  NG+L  KT++L T+ ++ L   D + +LD NG I+++G++ ++ KD +  + + +  Y + NN   N  G
Sbjct:  204 LTRRKPNPYDSANIFSRITFSWMSGLMKTGYEKYLVEADLYKLPRNFSSEELSQKLEKNW-----------------------------ENELKQKSNPSLSW----AICRTFGSKMLLAAFFKAIHDVLAFTQPQLLRILIKFVTDYNSERQDDHSSLQGFENNHPQKLPIVRGFLIAFAMFLVGFTQTSVLHQYFLNVFNTGMYIKSALTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKLQDLTQWLNLIW---SGPFQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTFAVFVYT-EDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSFIEASVSIGRLFTFFTNEELQPDSVQRLPKVKNIG---DVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLD-NGEITQQGTYDEITKDADSPLWKLLNNYGKKNNGKSNEFG 867          

HSP 3 Score: 85.8853 bits (211), Expect = 4.081e-17
Identity = 74/267 (27.72%), Postives = 127/267 (47.57%), Query Frame = 3
Query: 1863 VSLKRIGQYL-VGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSV-------------QGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPG-GDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKD 2618
            VS++RI +Y  +  E  L    HR       +     I+  + S  ++ E  L L +IN  I   + V IVG+ G GKSSL  A+   +    G++ +             +  ++ + Q++ +   +++ENI     Y ++     +E   LK  +  +   G + ++ E G NLS GQ+Q + LARA+     I +LD+  +AVD    + + E + +     KD+T + + H LN +   D ++VLD NG ++E  S   LL D
Sbjct: 1238 VSVERIKEYADLKSEAPLIVEGHRP---PKEWPSQGDIKFNNYSTRYRPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRT---AFKDRTILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPGQLLSD 1497          

HSP 4 Score: 62.003 bits (149), Expect = 8.655e-10
Identity = 57/230 (24.78%), Postives = 100/230 (43.48%), Query Frame = 3
Query: 4185 LVLKNINLHFHGGKKIGVVGRTGAGKSSLNLA----LFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQ-SLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDR-LVMHTI--REYFQASTVIIIAHRINTILDTDIIVVMENGEIVE 4850
            + LKNIN     G    +VG+ G+GK++L       LFR+                  G   +   +  + Q P I +GT++EN+  F    D E ++ +++   L   ++ L +G     GE G++LS                       GQK  L LARA+  ++   +LD+  A+VD    R L+ H +         T ++  ++++ +   D I +++NGEI +
Sbjct:  644 VALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRV-----------------KGFATVHGSVAYVSQVPWIMNGTVKENI-LFGHRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLS----------------------GGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLDNGEITQ 833          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YBT1 (Transporter of the ATP-binding cassette (ABC) family; involved in bile acid transport; negative regulator of vacuole fusion; regulates release of lumenal Ca2+ stores; similar to mammalian bile transporters; YBT1 has a paralog, VMR1, that arose from the whole genome duplication [Source:SGD;Acc:S000003971])

HSP 1 Score: 378.252 bits (970), Expect = 8.406e-108
Identity = 240/666 (36.04%), Postives = 371/666 (55.71%), Query Frame = 3
Query: 2982 QSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWL---FIATVAIYAA--FTGLQVFSNIWLKNFTEDSDIQNASQHI---------LLNISGSPYWSKIIREQ-------TKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            +++++ K      +R  D    +L++EE    G V    Y   +K  G W    F+A++ + A   + G   +   W  +      I  A + I         L++  GS   S    E        T YY+V+Y IIG    L+         V  INAS+ I   +L  VL S + FFD TP+GRI+NRFSKDIE +D  +   I  +   L    +++I+I ++TP F    I ++ILYY +  FY+  SR+ +R +SI+ SP++ HF+ETL GV  IRAF ++  F   N   ID+++K  F    + RWL+ RI+++G L++F A LF +    +L + + G+S++Y++  TE   WL+R Y+E+E N  ++ER++EY +I  E   +    P   WP +G I   D  LRY   LP V+KN++       KIG+VGRTGAGKS++  ALFR +E   G I ID I+IS + L  LR+ +TI+PQDP +FSGT++ NLDP+    D +IF++L+  +L S    L +G   E      + +    +  + + +      + +  GQ+QL+CLAR+LLR  K+++LDEATAS+D  +D  +  TIR+ FQ ST++ IAHR+ +++D D I+VM+ GE+ E D P +LL      F S+ + S
Sbjct:  977 EAKKLQKSLRTEAERTED---GKLIKEETKEEGVVGLDVYKWYLKIFGGWKIVSFLASLFLIAQLLYIGQSWWVRAWASHNVIAKIIPRAQRAIAFISKKASHLIDWRGSSQISMASAENQPSSGHSTMYYLVLYLIIGFAQALLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFNINNLDSGMAGISLTYAISFTEGALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNEHKEIPPPQWPQDGKIEVNDLSLRYAPNLPRVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLIS-EEQLQQGATRETSNEASSTNSENVNKFLDLSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGSTILTIAHRLRSVIDYDKILVMDAGEVKEYDHPYSLLLNKQSAFYSMCEHS 1638          

HSP 2 Score: 287.73 bits (735), Expect = 6.170e-79
Identity = 207/691 (29.96%), Postives = 333/691 (48.19%), Query Frame = 3
Query:  672 PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFG-VLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRL-------------------------NNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDK-LTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQG----------------TIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLK 2615
            P PE   SI   + ++WLD++++K  +  +  +  + L  QD S             K+K    RKR   L        +L+                               L C +  +     +    LLK +LEY++++S       +  +  +F G +L ++ +    F    + IR+++ +I  IY K LR                          + E  +    G I+NLM++DA ++     +   FL   +  V+A+ LLY+ + +A   G+ +IVA  PLN  L   +       L   D RI+ L E    I+++K ++WE++F   I  +R+ E+  +L  S  + +   LW + P ++  A+F  Y+      + TP  AF +L+LF LLR P+  L   L+  + + VSL R+  +L   +       +   T D   N  A     + + SW K+++   L ++N E   GKL  ++G  G+GK+SL+ A+LGEM+ +NG V V                  +IAY SQ AW+ N ++K NILF   +NE  Y+ ++EAC LK D E L  GD TEIGE+GI LSGGQKQRVSLARA+Y N    LLDD LSAVD+H    +++N I+   +++D+T ILV+H +    +  E++VL  +G + ++G   D+L+
Sbjct:  278 PSPEPVTSIAGFICWAWLDSFVWKAHKVSIKVKDIWGLMMQDYSFFVVKKFRYFVDHKVK----RKRIFSLNLFFFFSNYLV-------------------------------LQCFWAFLGSVLSFIPTVLLKRILEYVEDQSSAPSNLAWFYVTVMFVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPSNEDPQEINDQKSINGDEESTSSANLGAIINLMAIDAFKVSEICGYLHSFLEAFVMTVVALALLYRLLGFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENFEKDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYVQGEVLTTP-VAFTALSLFTLLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDTK----KYDQLTIDPNGNRFA---FENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCIT-GPLMEDRTCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDMLQ 924          

HSP 3 Score: 75.485 bits (184), Expect = 7.620e-14
Identity = 110/535 (20.56%), Postives = 224/535 (41.87%), Query Frame = 3
Query: 1122 YFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERI----MNWIIFAWF-FLSCPLQIVLAIILLYQEMSYAIFAG-LGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFP-----MVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQG-------------TIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGD----------------------ETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISE 2588
            Y+L + +L  G   +L   G   +  +  I     +  MI  K L       +   +G I+N  S D E I      +I  A++  + C   ++L   +  Q +S AI    L   V +F + G     +++F +I    +    +  +E L G+  ++ +  E  F+ +  +  D   +    +  A   +    +++  L++    L ++L   +NI   +     ++L   + F      +V L   +  +MN   S++R+ +Y+   E+     N         +  D  IE+ D S  +       + N++F +     + IVG+ G GKS++I+A+   +    G + +               +I  + Q+  + + ++K N+    +++++   + ++  +L S+ EQL  G                        +EI E G NLS GQ+Q + LAR++ ++  I LLD+  +++D      + E +       +  T + + H L  +   D++LV+D+ G + E
Sbjct: 1103 YYLVL-YLIIGFAQALLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAG--SRELKRFESIS---RSPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGL-FIL---FNINNLDSGMAGISLTYAISFTEGALWLVRLYSEVEMNMN---SVERVKEYM---EIEQEPYNEHKEIPPPQWPQDGKIEVNDLSLRYAPNLPRVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISE-EQLQQGATRETSNEASSTNSENVNKFLDLSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKE---FQGSTILTIAHRLRSVIDYDKILVMDA-GEVKE 1616          

HSP 4 Score: 62.7734 bits (151), Expect = 4.721e-10
Identity = 64/270 (23.70%), Postives = 121/270 (44.81%), Query Frame = 3
Query: 4125 PNNGNITFKDYDLRY-REGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLR---KRLTILPQDPVIFSGTLRENL---DPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVET-----DRLVMHTIREYFQASTVIIIAHRIN-TILDTDIIVVMENGEIVEIDSPKNLLAMSDGIF 4895
            PN     F++  + + ++     LK++N+ F  GK   V+G TG+GK+SL +AL   +    G +++  +      + D       +    Q   + + T++ N+    PF+  +   +   +E   L+     L  G   E GE G+ LS                       GQKQ + LARAL   ++ ++LD+  ++VD  T     D  +   + E     T I+++H I  T+ + +++V++E+G + +   P ++L    G+F
Sbjct:  689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEARYKAV---VEACGLKRDFEILKAGDLTEIGEKGITLS----------------------GGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLME---DRTCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDML--QKGLF 928          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: VMR1 (Vacuolar membrane protein; involved in multiple drug resistance and metal sensitivity; ATP-binding cassette (ABC) family member involved in drug transport; potential Cdc28p substrate; induced under respiratory conditions; VMR1 has a paralog, YBT1, that arose from the whole genome duplication [Source:SGD;Acc:S000001027])

HSP 1 Score: 355.91 bits (912), Expect = 1.203e-100
Identity = 231/648 (35.65%), Postives = 366/648 (56.48%), Query Frame = 3
Query: 3048 QLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVF---SNIWLKNFTEDSDIQ-NASQHIL--LNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDH-LIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSE-------AEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSW-----VSGLSE----------GLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            QL+EEE+  +G +    Y   +K  G   F A  A++A +   Q+     + W++++  D++++ NA    +  L + G    SK  +    YY+ +Y +IG+   ++  F      +  + AS+ I   LL  VL + + FFD TP GRI+NRFSKDIE +D  LIP  +  ++ CL    + I +I  +TP F    + + +LY+ +  +Y+  SR+ +RLDSI  SP+F HF+ETL GV  IRAF +++ F   N   ID++++  F    +V+W S R++++G  +V A+  F ++   ++ + L G+S++Y++  T+   WL+R Y+  E N  ++ER++EYS I  E           L N PS  WP +G I  ++  LRY   LP V++N++       KIG+VGRTGAGKS++  ALFRL+E   G I ID  +IS I L  LR+ +TI+PQDP++F+GT++ N+DP+  + + +IF++L   +L S      V    E           L  E  EGG+NLS                       G++QLL +AR+LLR+ K+++LDEAT+S+D ++D L+   IR  F  ST++ IAHR+ +++D D I+VM+ GE+ E D P  LL    GIF S+
Sbjct:  951 QLIEEEEKSNGAISPDVYKWYLKFFGG--FKALTALFALYITAQILFISQSWWIRHWVNDTNVRINAPGFAMDTLPLKGMTDSSKN-KHNAFYYLTVYFLIGIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPY-LEVTIFCLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLSVTVKWFSFRVDMIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTDGALWLVRLYSTFEMNMNSVERLKEYSSIEQENYLGHDEGRILLLNEPS--WPKDGEIEIENLSLRYAPNLPPVIRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLS----------------------QGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKSTILTIAHRLRSVIDYDRIIVMDAGEVKEYDRPSELLKDERGIFYSM 1570          

HSP 2 Score: 286.189 bits (731), Expect = 1.438e-78
Identity = 228/711 (32.07%), Postives = 355/711 (49.93%), Query Frame = 3
Query:  672 PCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQN--RSDN-------YWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTS--------------GEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKED------KLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSV----------------QGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNR 2669
            P  E  +SILS +T+SW+  +I+                   E+ KNT  L+ I+     +S       +L+  T    H+                  L ++L   +   LL+   +  V+         L+K  LE + N  RS +       Y IG F  I  L   + +S  +    F++  + +RIRA LIG IY K LR     R  FTS              G I+NL+S+D+ ++     + +  +   + I++ + LL+  +  + FAG+ +I+  FPLN LL NL+ KF    LK  D RI  L E L  I+++K +AWE++ +++I ++R  E+R +L+ S  + V   LW + P L+   TF         ++  P  AF +L+LF LL+ P+  L   L+    + VSLKRI  +L  ++    + N    + D        IE ++ + +W + D      KL   NI F+IG  KL  I+G  G+GKS+L+  +LGE++ I+GS+ V                  + AY SQ AW+ N ++K NI+F   YNE  Y  +I+AC LK DLE LP GD TEIGE+GI LSGGQKQR+SLARAVY +    LLDD LSAVD+H    ++EN I+   ++K++T ILVTH ++   +     ++  NG +  +G+  +L         F ++Y++ ++R
Sbjct:  266 PSREHISSILSCITWSWITNFIW-------------------EAQKNTIKLKDIW----GLSMEDYSIFILKGFTRRNKHINN----------------LTLALFESFKTYLLIGMLWVLVNSIVNLLPTILMKRFLEIVDNPNRSSSCMNLAWLYIIGMF--ICRLTLAICNSQGQ----FVSDKICLRIRAILIGEIYAKGLR-----RRLFTSPKTSSDSDSISANLGTIINLISIDSFKVSELANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMFPLNFLLANLLGKFQKQTLKCTDQRISKLNECLQNIRIVKYFAWERNIINEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFAICTFVQHEDLNAP-LAFTTLSLFTLLKTPLDQLSNMLSFINQSKVSLKRISDFLRMDDTE--KYNQLTISPDKN-----KIEFKNATLTWNENDSDMNAFKLCGLNIKFQIG--KLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIPDCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYNEDRYNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENCIT-GPLMKNRTCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKG----LFKEKYVQLSSR 911          

HSP 3 Score: 86.6557 bits (213), Expect = 2.541e-17
Identity = 121/562 (21.53%), Postives = 246/562 (43.77%), Query Frame = 3
Query: 1041 FSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWII-FAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLT---LFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRD----FTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQG-------------TIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKS--DLEQLPGGDE-------------TEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKD 2618
            F++  +P  LK + +  +N+ + +   Y+L + FL  G++ ++       +T +  +R    +   +    L       +    G I+N  S D E +   +I +    + C +Q    I L+       +   + + V +F +    +   ++   ++   K    +  +E L G+  ++ +  E+ F+ +  N  D   R    +S          +++   I+LA+   ++L +  NI     A +SLT   LF      +V L      +MN   S++R+ +Y   E+ N   + H +      ++ ++  D  IEI + S  +       + N++F++     + IVG+ G GKS++I+A+   +  I G + + G             +I  + Q+  +   ++K N+    +Y+EK     +   +L S  + E++   +E             TEI E G+NLS G++Q + +AR++ +   I LLD+  S++D +   HL + +I +       T + + H L  +   D ++V+D+ G + E     +LLKD
Sbjct: 1018 FAMDTLP--LKGMTDSSKNKHNAF---YYLTVYFLI-GIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLSVTVKWFSFRVDMIGAFIVLASG-SFILLNIANI-DSGLAGISLTYAILFTDGALWLVRLYSTFEMNMN---SVERLKEYSSIEQENY--LGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPPVIRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSID-YDSDHLIQGIIRSE--FNKSTILTIAHRLRSVIDYDRIIVMDA-GEVKEYDRPSELLKD 1562          

HSP 4 Score: 57.3806 bits (137), Expect = 2.280e-8
Identity = 74/306 (24.18%), Postives = 134/306 (43.79%), Query Frame = 3
Query: 4041 VALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREG----LPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHD---LRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHT--IREYFQASTVIIIAHRIN-TILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNND 4928
            V+L+RI ++ ++    ++   N  + S P+   I FK+  L + E         L  +N+ F  GK   ++G TG+GKS+L L L   +    GSII+  +      + D   L        Q   + + T++ N+   + + +D   + ++   L+  +  L  G   E GE G+ LS                       GQKQ + LARA+   +K ++LD+  ++VD  T   +          +  T I++ H ++ T+ +    +V+ENG++    +   L   S G+FK  + Q  + D
Sbjct:  635 VSLKRISDFLRMDDTEKY---NQLTIS-PDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIPDCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYNEDRYNKVIDACGLKRDLEILPAGDLTEIGEKGITLS----------------------GGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENCITGPLMKNRTCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITEL--QSKGLFKEKYVQLSSRD 912          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO36474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII0])

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 544/1315 (41.37%), Postives = 817/1315 (62.13%), Query Frame = 3
Query: 1002 ELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYI---LRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQL-SDNEDVV---EEITD----FVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAF--TGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA-PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            +  LA  FK + D   +  P +L++++ +++  S + W GY  A+         S+  +  F I     I+I+ AL G+IY K LRLN+  RNK T+G++VNLMSVDA+R+++   +     S PLQIV+A+  LY  M ++I AG+ ++V   P N ++    +K    ++  KD RI+I+ EILNG+KVLK+YAWE+SF+ K+T +R+ E+ ++   + ++A FG     +   PFL+ LATF  YVLT   NI+T   AFV+++LFN+LRFP+ VLP  +   + A VSLKR+ ++L  +EL+ T ++ +  +  S    + AI + DGSFSW    + TL+NIN  I  G LVA+VG+VG GKS+L+SA+LGE  ++ G V V+G++AYV Q+AWIQN +L++N++F ++++ + Y   I+ C+L++D + LP GD TEIGERGINLSGGQKQRV+LARAVY N D+YLLDDPLSAVD+HVG+H+F+ VI   G L+ KTR+LVTHG+++LP+VD+++VL  +G +SE G++K+LL +   F +F++ +                 +E +   A  +LR++  D ED++   + I D    F+   P  PI+R                                            ++  ++T G+     + +TD  T    D+ +  ++ EE+A +G+VKW  +    KS G+  FIA++ I       G  V S IWL  ++ D+D  +A++ + L                 Y    +      +   +C  +     GS+ AS+ IH  LL ++  +PM FF+TTP GR++NRFSKD+  +D  +P + S  L        ++  I Y TP F   IIPL I+Y LIQ  Y+ +SRQ +R++S++ SP++N+F ET+ G + IRA+ +QQ F   N   +D++    +    S RWL LR+E +G L++F A LF+++GR S+ ++LVG+SI+Y+LQIT+ LN ++RQ +ELETN V++ER +EY+ + +EAEW + ++ P   WP+ G I  +D+DLRYR  LPLVLKNI++    G+KIG+VGRTGAGKS+L LALFR++E+AGG I++D ++IS +GL DLR  LTI+PQDPV+FSGTLR NLDPF ++ D+++++ LE +HL+++ SGL EGL +   EGG NLSV                      GQ+QL+CLARALLRKSKVL+LDEATA+VD+ETD L+ +TIR  F   TV  IAHR+NTI+D   I+V++ G ++E DSP+NL+A   GIF  +
Sbjct:   15 QFFLAAFFKLIQDSMSFVQPTILRLMISFVEGNSPS-WEGYMYALIMFAAAAFQSILLHAYFHIVISAGIKIKTALTGLIYSKALRLNSVSRNKSTAGDMVNLMSVDAQRVLDMCTYINLLWSGPLQIVVALYFLYDTMGWSIVAGVVVMVLLIPFNLVVTRFSRKLQLKQMANKDSRIRIMNEILNGMKVLKLYAWEESFMAKVTGIRNQELHHLKNAMYLNAFFGFT---FTCAPFLVSLATFAIYVLTG--NILTANNAFVAISLFNILRFPLTVLPNVIISYVQAQVSLKRLTKFLTLDELDETNVHKKMPSHIS----NQAIHVDDGSFSWDVTGQPTLHNINLNIPDGSLVAVVGQVGCGKSTLLSALLGETEKVTGEVYVKGSVAYVPQQAWIQNATLRDNVIFGRNFDSRRYHKTIKVCALETDFDILPAGDMTEIGERGINLSGGQKQRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLRKKTRVLVTHGISFLPQVDQIVVL-QDGRVSEVGTYKELLANRGAFAEFLKTFA---------------PEEKSGDAALKVLREVPEDEEDILVRLQAIGDEDEMFMEPEPQ-PIRRRG------------------------------------------RANSVVTIGTTITSDTADTDCMTIMEEDREVDHMIGEEKAATGSVKWVVFWAYAKSIGV--FIASIVILFMILSEGALVGSRIWLAAWSADNDTSDATRDMYLG---------------GYAAFGFFQAFFVLVSSICLAF-----GSVRASRSIHDSLLIAIFHAPMSFFETTPLGRVVNRFSKDLYVVDDTVPRSTSGFLRTALSAIGTLFAITYATPLFLSVIIPLGIVYVLIQRLYVASSRQLKRIESVSKSPIYNNFFETISGTSTIRAYHQQQRFIRGNYYKVDENQLAYYPLVVSNRWLGLRLEFVGNLIIFFAALFAVVGRDSIESALVGMSITYALQITQTLNMMVRQTSELETNIVSVERTKEYADMETEAEWVVEDSRPPKGWPDKGRIQIEDFDLRYRANLPLVLKNISVDIQPGEKIGIVGRTGAGKSTLTLALFRILESAGGRIVVDDLDISKMGLQDLRSSLTIIPQDPVLFSGTLRFNLDPFDAYSDEDLWEVLEVSHLKAFASGLPEGLLHPIAEGGENLSV----------------------GQRQLVCLARALLRKSKVLVLDEATAAVDLETDELIQNTIRTEFAERTVFTIAHRLNTIMDYSRILVLDKGFMMEFDSPQNLIAQR-GIFYGM 1215          

HSP 2 Score: 85.5001 bits (210), Expect = 1.478e-16
Identity = 65/240 (27.08%), Postives = 112/240 (46.67%), Query Frame = 3
Query: 1971 IEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSV-------------QGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSN---------GSISERGSFKDLLKDCN 2624
            I+I D    ++    L L NI+ +I  G+ + IVG+ G GKS+L  A+   +    G + V             + ++  + Q+  + + +L+ N+     Y+++   +++E   LK+    LP G    I E G NLS GQ+Q V LARA+ +   + +LD+  +AVD    + L +N I       ++T   + H LN +     +LVLD             I++RG F  + +D  
Sbjct:  984 IQIEDFDLRYRANLPLVLKNISVDIQPGEKIGIVGRTGAGKSTLTLALFRILESAGGRIVVDDLDISKMGLQDLRSSLTIIPQDPVLFSGTLRFNLDPFDAYSDEDLWEVLEVSHLKAFASGLPEGLLHPIAEGGENLSVGQRQLVCLARALLRKSKVLVLDEATAAVDLETDE-LIQNTIRTE--FAERTVFTIAHRLNTIMDYSRILVLDKGFMMEFDSPQNLIAQRGIFYGMAQDAG 1220          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO35071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMJ8])

HSP 1 Score: 451.44 bits (1160), Expect = 1.194e-136
Identity = 239/573 (41.71%), Postives = 370/573 (64.57%), Query Frame = 3
Query: 1065 LLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRI---KILTEILNG-IKVLKMYAWEKSFLDKITNLRDTEMRYI---LRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNED 2762
            L+++++ +++  S + W GY  A+         S+  +  F I     I+I+ AL G+IY K LRLN+  RNK T+G++VNLMSVDA+R+++   +     S PLQIV+A+  LY  M ++I AG+ ++V   P N ++    +K    +     + +    +    L G  KVLK+YAWE+SF+ K+T +R+ E+ ++   + ++A FG     +   PFL+ LATF  YVLT   NI+T   AFV+++LFN+LRFP+ VLP  +   + A VSLKR+ ++L  +EL+ T ++ +  +  S    + AI + DGSFSW    + TL+NIN  I  G LVA+VG+VG GKS+L+SA+LGE  ++ G V V+G++AYV Q+AWIQN +L++N++F ++++ + Y   I+ C+L++D + LP GD TEIGERGINLSGGQKQRV+LARAVY N D+YLLDDPLSAVD+HVG+H+F+ VI   G L+ KTR+LVTHG+++LP+VD+++VL  +G +SE G++K+LL +   F +F++ +             +   D S    A+ + RQ++  ++
Sbjct:    1 LIRLMISFVEGNSPS-WEGYMYALIMFAAAAFQSILLHAYFHIVISAGIKIKTALTGLIYSKALRLNSVSRNKSTAGDMVNLMSVDAQRVLDMCTYINLLWSGPLQIVVALYFLYDTMGWSIVAGVVVMVLLIPFNLVVTRFSRKLQVCQFILIGVSLCQPPLCRCCLWGSCKVLKLYAWEESFMAKVTGIRNQELHHLKNAMYLNAFFGFT---FTCAPFLVSLATFAIYVLTG--NILTANNAFVAISLFNILRFPLTVLPNVIISYVQAQVSLKRLTKFLTLDELDETNVHKKMPSHIS----NQAIHVDDGSFSWDVTGQPTLHNINLNIPEGSLVAVVGQVGCGKSTLLSALLGETEKVTGEVYVKGSVAYVPQQAWIQNATLRDNVIFGRNFDSRRYHKTIKVCALETDFDILPAGDMTEIGERGINLSGGQKQRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLRKKTRVLVTHGISFLPQVDQIVVLQ-DGRVSEVGTYKELLANRGAFAEFLKTFAPEEKSGDAAREQESCPDNSQ--GARVMSRQIAREQE 560          

HSP 2 Score: 321.627 bits (823), Expect = 1.666e-91
Identity = 197/505 (39.01%), Postives = 298/505 (59.01%), Query Frame = 3
Query: 2943 EDPKSPRIMTPGSQSRQISKETDQNTD------------RLIDKPISQLVEEEQAMSGT--------VKWATYSMCIKSRGLWLFIATVAIYAAF--TGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNA-PSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQ 4388
            ++ +  R+M     SRQI++E +   D            R     ++QL   +   S T        VKW  +    KS G+  FIA++ I       G  V S IWL  ++ D+D  +A++ + L                 Y    +      +   +C  +     GS+ AS+ IH  LL ++  +PM FF+TTP GR++NRFSKD+  +D  +P + S  L        ++  I Y TP F   IIPL I+Y LIQ  Y+ +SRQ +R++S++ SP++N+F ET+ G + IRA+ +QQ F   N   +D++    +    S RWL LR+E +G L++F A LF+++GR S+ ++LVG+SI+Y+LQIT+ LN ++RQ +ELETN V++ER +EY+ + +EAEW + ++ P   WP+ G I  +D+DLRYR  LPLVLKNI++    G+KIG+VGRTGAGKS+L LALFR++E+AGG I++D ++IS +GL DLR  LTI+PQ
Sbjct:  564 DNSQGTRVM-----SRQIAREQESCPDNSQGTRRKTLRSRYFTSKVAQLRHAKPMDSITWSPYISFQVKWVVFWTYAKSIGV--FIASIVILFMILSEGALVGSRIWLAAWSADNDTSDATRDMYLG---------------GYAAFGFFQAFFVLVSSICLAF-----GSVRASRSIHDSLLIAIFHAPMSFFETTPLGRVVNRFSKDLYVVDDTVPRSTSGFLRTALSAIGTLFAITYATPLFLSVIIPLGIVYVLIQRLYVASSRQLKRIESVSKSPIYNNFFETISGTSTIRAYHQQQRFIRGNYYKVDENQLAYYPLVVSNRWLGLRLEFVGNLIIFFAALFAVVGRDSIESALVGMSITYALQITQTLNMMVRQTSELETNIVSVERTKEYADMETEAEWVVEDSRPPKGWPDKGRIQIEDFDLRYRANLPLVLKNISVDIQPGEKIGIVGRTGAGKSTLTLALFRILESAGGRIVVDDLDISRMGLQDLRSSLTIIPQ 1041          

HSP 3 Score: 76.6406 bits (187), Expect = 8.481e-14
Identity = 64/237 (27.00%), Postives = 106/237 (44.73%), Query Frame = 3
Query: 4176 GLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLA 4877
            G P  L NINL+   G  + VVG+ G GKS+L  AL    E   G +              ++  +  +PQ   I + TLR+N+    +       ++++   L++    L  G   E GE G+NLS                       GQKQ + LARA+   + V +LD+  ++VD    + +   +   R   +  T +++ H I+ +   D IVV+++G + E+ + K LLA
Sbjct:  313 GQP-TLHNINLNIPEGSLVAVVGQVGCGKSTLLSALLGETEKVTGEVY-------------VKGSVAYVPQQAWIQNATLRDNVIFGRNFDSRRYHKTIKVCALETDFDILPAGDMTEIGERGINLS----------------------GGQKQRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLRKKTRVLVTHGISFLPQVDQIVVLQDGRVSEVGTYKELLA 513          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO43433 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYB6])

HSP 1 Score: 386.726 bits (992), Expect = 4.060e-121
Identity = 200/416 (48.08%), Postives = 285/416 (68.51%), Query Frame = 3
Query: 3660 FYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL-NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
             ++ TSRQ +RL+S++ SP+++HF E++ G  +IRAF++Q+ F   + + +D +    +      RWLSLR+E+LG  ++  A LF+++ R  +   LVGLS++Y+LQIT  L WL+RQ +ELETN VA+ERI+EYS+ P+EA W +    P   WP  G++  +  D+RYR+  P V+K +    + G+KIG+VGRTGAGKS+L+LALFR++E A G I+ID I+I+ IGL DLR RLTI+PQD V+FSG+++ NLDPF S  D+E+++ LE  HL+S+VS L +GL ++  EGG NLS                      AGQ QL+CLARALLRKSKVL+LDEATA+VD+ETD L+ +TIR  F   TV+ IAHR+NTI+D   I+V++ G I+E D+P  LLA   G+F  +
Sbjct:    2 LFVSTSRQLKRLESVSRSPIYSHFYESITGCTIIRAFRQQRRFVQESNSKVDHAQMANYPSLCINRWLSLRLELLGAAVLLFAALFAVVSRGRIAPGLVGLSVAYALQITGVLTWLVRQSSELETNIVAVERIKEYSETPTEAAWVIPGRRPPADWPQEGHVAVESLDMRYRDDQPPVIKKLTFEINSGEKIGIVGRTGAGKSTLSLALFRILERASGKIVIDNIDINKIGLQDLRSRLTIIPQDAVLFSGSVKLNLDPFESTCDEELWRVLEAVHLKSFVSSLQDGLMHQIQEGGENLS----------------------AGQCQLVCLARALLRKSKVLVLDEATAAVDLETDELIQNTIRTEFADRTVLTIAHRLNTIMDYTRIMVLDEGSILEFDTPSALLAQK-GVFHEM 394          

HSP 2 Score: 85.8853 bits (211), Expect = 2.114e-17
Identity = 66/233 (28.33%), Postives = 114/233 (48.93%), Query Frame = 3
Query: 1998 WKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSV-------------QGTIAYVSQEAWIQNKSLKENI-LFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSI----------SERGSFKDLLKDCN 2624
            ++ +    +  + FEI  G+ + IVG+ G GKS+L  A+   + R +G + +             +  +  + Q+A + + S+K N+  F    +E+ +  ++EA  LKS +  L  G   +I E G NLS GQ Q V LARA+ +   + +LD+  +AVD    + L +N I       D+T + + H LN +     ++VLD  GSI          +++G F ++ KD  
Sbjct:  172 YRDDQPPVIKKLTFEINSGEKIGIVGRTGAGKSTLSLALFRILERASGKIVIDNIDINKIGLQDLRSRLTIIPQDAVLFSGSVKLNLDPFESTCDEELWR-VLEAVHLKSFVSSLQDGLMHQIQEGGENLSAGQCQLVCLARALLRKSKVLVLDEATAAVDLETDE-LIQNTIRTE--FADRTVLTIAHRLNTIMDYTRIMVLD-EGSILEFDTPSALLAQKGVFHEMAKDAG 399          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO35250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM18])

HSP 1 Score: 377.096 bits (967), Expect = 3.465e-113
Identity = 229/624 (36.70%), Postives = 356/624 (57.05%), Query Frame = 3
Query: 3048 QLVEEEQAMSGTVKWATY-SMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSII--GRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEW--DLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            +++E E+   G++    Y  +          +    ++ A  G    ++ WL ++++    QN        ++ SPY         +YY+ +Y  + L   L+       F    + ASK +H K+  +VLR+PM FFDT P+GRIINRFSKDI  +D L+P    + +S   + FA ++V +   PW  I I+PLA+ +  ++ +Y+ TSR+ +R+++I  +P+FNHF+ TL+G+A IR+   Q           D  S+  F+  ++ RWL++R+E+L  L V  A    +       + A +VGL++SY++ +T    W +R   E+E    A+ER+ +YSK+  E EW  + ++ P   WP +G IT +   L+Y   LP VLKN+       +K+G+VGRTG GKSSL  AL RLVE  G  + ID ++I+ IGLHDLR +++++PQDPV+FSG+LR NLDP S +KD+E++ +L+   L   V    +GLD +  E G N SV                      GQ+QL+CLARALLR++ +LI+DEATA VD  TD L+  TIR  F+  TV+ IAHR+NTI+D D ++V++NG++VE + P  +L   + +F  L
Sbjct:  144 EMLEPEERPRGSIPVKLYLDLFYAGANCCTLVFMSVLFFAAQGSYTITDWWLAHWSDIDYKQNLLNETSGIVTQSPY-------DRRYYIAVYGGLVLLTFLLSFIRSFLFFYVKVAASKALHNKMFCAVLRAPMYFFDTNPAGRIINRFSKDIGFMDDLLPETFYEFISLAILCFAVVVVNVATMPWVIIGILPLAVAFLFVRSYYLKTSREVKRIEAIGRTPIFNHFSSTLEGLATIRSLSSQTQVTAELAACQDHHSEAWFLFIATSRWLAIRLEMLCLLFVTMAAFTPLFLSRNHDIDAGVVGLTLSYAVMLTGMFQWCVRMSAEVENQMTAVERVVDYSKVEPEGEWHKECSDVPP-IWPVHGLITAESLSLQYHATLPRVLKNMCFCVRPKEKVGIVGRTGTGKSSLLAALIRLVEPKG-IMRIDGVDITDIGLHDLRSKISVIPQDPVLFSGSLRHNLDPVSQYKDEELWTALKEVQLGDAVLEFPDGLDTKVTESGNNFSV----------------------GQRQLICLARALLRRNVILIIDEATAHVDQRTDALIQKTIRSKFKDCTVLTIAHRLNTIMDMDRVMVLDNGKLVEFEEPFVMLLNPESVFSKL 736          

HSP 2 Score: 82.4185 bits (202), Expect = 1.153e-15
Identity = 61/221 (27.60%), Postives = 109/221 (49.32%), Query Frame = 3
Query: 2022 LNNINFEIGRGKLVAIVGKVGTGKSSLISAIL-----GEMHRINGS-------VSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQE 2648
            L N+ F +   + V IVG+ GTGKSSL++A++       + RI+G          ++  I+ + Q+  + + SL+ N+     Y ++     ++   L   + + P G +T++ E G N S GQ+Q + LARA+ +   I ++D+  + VD      + + + S     KD T + + H LN +  +D V+VLD+   +     F  LL   + F + V E
Sbjct:  522 LKNMCFCVRPKEKVGIVGRTGTGKSSLLAALIRLVEPKGIMRIDGVDITDIGLHDLRSKISVIPQDPVLFSGSLRHNLDPVSQYKDEELWTALKEVQLGDAVLEFPDGLDTKVTESGNNFSVGQRQLICLARALLRRNVILIIDEATAHVDQRTDALIQKTIRSK---FKDCTVLTIAHRLNTIMDMDRVMVLDNGKLVEFEEPFVMLLNPESVFSKLVAE 739          

HSP 3 Score: 81.6481 bits (200), Expect = 1.812e-15
Identity = 44/109 (40.37%), Postives = 63/109 (57.80%), Query Frame = 3
Query: 2379 RAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSD 2705
            RAVY N D+YLLDDPLS+VD HVG+HLF+  I   G++KD  RILVTH L +L    E+L L   G +   G++ +L     +F   ++   E      + + G+  +D
Sbjct:    1 RAVYYNADVYLLDDPLSSVDTHVGRHLFDACIC--GLIKDCPRILVTHQLQYLHSATEILCL-KEGRVLGIGTYTELTTSGIDFTTLIKTKPEAEETDADSAIGEDTND 106          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO46846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP39])

HSP 1 Score: 391.349 bits (1004), Expect = 4.142e-113
Identity = 237/658 (36.02%), Postives = 373/658 (56.69%), Query Frame = 3
Query: 3033 DKPIS--QLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISG-------SPYWSKIIR------EQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRF--SLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREY-SKIPSEAEWDLNNAPSD----------------SWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            D+P    +LVEEE    G V+   Y    ++ G  L  + +       G +   + WL  +   S I +      +           +PY +  +R         K+Y+V+Y  I +  T+   F    F  G I A+K IH++LL S+L +P+ FFD TP GRIINRFS D+ ++D  +P  ++  L+  + V AS+++  Y  PW A+ + PL I+YY +Q +Y  TSR+ +R+ ++  SP++ HF+ETL G++ IRA +  Q F+  N+  ++ + +  + +  +  WL LR++ +G  +       +++     ++   LVGL++SY+L +T+ +  ++  + E E   V++ER  +Y ++IP E         +                 SWP +G I F +  L YR GLP  L+N++L  H G+K+G+VGRTG+GKSSL L LFR+VE A G++I+D +NI+++ L  LR RL I+PQDP +FSG++R+N+DP+    D +++ +LE  HLQ  VS L  GLD E GE G N S                      AGQ+QL+CLARA+L ++K+L +DEATASVD+ETDR +  TIRE F+ STV+ IAHRI+T++D+D ++VM  G + E + P  L+A  + +F SL
Sbjct:  708 DEPTGDGRLVEEEAKDVGAVRLHVYGSYWRAIGHCLATSILLSLLLMQGSRTIGDWWLAYWISHSKIDHTDNATTITHHSHDSTHPEAPYAAPFLRGVNIKKNTLKFYLVVYAGIAVANTVFTLFRAFLFAYGGIKAAKTIHQRLLSSILAAPISFFDITPIGRIINRFSSDVYSIDDSLPFMLNIFLAQAYFVVASLVITCYGLPWMALLVAPLMIIYYYLQGYYRKTSRELKRIITVTESPIYAHFSETLTGLSTIRALRHTQRFRTENEERLEVNQRANYCEMVAYVWLVLRLQGIGVAINAGVAFLAVLEHHFHTVDPGLVGLAMSYALSVTQSIADMVNSFAETEKQMVSVERAEQYITRIPVEKPGGSKVCHAHILLLSSLSDISRLLSSSWPTHGRIRFHNIVLVYRPGLPPALRNVSLEIHAGEKVGIVGRTGSGKSSLFLVLFRMVEVAEGAVILDGVNIASLPLDKLRSRLAIIPQDPFLFSGSVRDNIDPWGKCSDRDLWITLERCHLQQPVSDLG-GLDAEVGERGRNFS----------------------AGQRQLVCLARAMLTRAKILCIDEATASVDMETDRFIQRTIREAFRTSTVLTIAHRIDTVMDSDRVLVMNKGTVTEFEKPDTLMANQNSLFYSL 1342          

HSP 2 Score: 343.969 bits (881), Expect = 3.541e-97
Identity = 233/622 (37.46%), Postives = 345/622 (55.47%), Query Frame = 3
Query:  969 LFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCV-LWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWK-----KEDKLT-------------------LNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSV---QGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNN------------RAKNPSGGQHLSDESA 2714
            L   L   +GL+       K   D   ++ P LL  L+ +++N+++    GY+ A+  L   +L++L      +    +S +IRAA+I  +Y KTL ++     KF+SGE++N MS D +R++N+      F S P QI +++ LLYQ++  A  AGLG  +   PLN  L   +QK+ST  +  KD R+KI+ EIL GI+V+K YAWE +F +K+   R+ E++  L+        CV  W   P +I + TF  YVL    N +T  K F S+ LF +L  P+   PW +   M A+VS+KR+  +L  EEL+        +    A +   A++I DG FSW+     +E K T                   L+ +N  I +G+L+ ++G VG+GKSSL+SA+  EM ++ G V V    G    V+QE WIQ+ ++KENILF + Y+   Y D+I AC+L+ DL+ LP GD+TEIGE G+NLSGGQK RV LARAVYQN+ IYLLDDPL+AVDAHV  HL+++ I+  G+L+ KT IL TH   +L   D V+V+ SNG++   G   ++L       Q  ++     +             A  P+G   L +E A
Sbjct:  110 LLGGLHYAFGLQYFSLGILKLFCDCLGFSGPLLLHALVSFMENKTEPVIHGYYYAMGVLVSALLTALTNCHFTYWVHKISYKIRAAIITTVYHKTLAVSTTSLGKFSSGEVLNFMSTDTDRVVNFANSFHQFWSLPFQIAVSLYLLYQQVGLAFLAGLGFALLLIPLNRWLAIKIQKYSTEMMTQKDSRVKIMNEILYGIRVIKFYAWENNFKNKVNTFRNAELKS-LKGRKYLDAWCVYFWATTPIIISILTFTTYVLMG--NQLTAAKVFTSVALFQMLITPLNAFPWVINGMMEAWVSVKRLQAFLTLEELDPDNY----YIYIPAQSAGDAVQIVDGHFSWRYKPPQQEAKETKDVENLAEIETEVKSTVGLLSGLNLSIRKGQLIGVIGGVGSGKSSLLSALTAEMDKLTGQVFVAGLDGGFGLVAQEPWIQHATVKENILFGKPYDVDKYSDVINACALREDLQSLPAGDDTEIGENGVNLSGGQKARVGLARAVYQNKSIYLLDDPLAAVDAHVAAHLYKHCIT--GLLRHKTVILCTHHTKFLSGADHVIVM-SNGTVMHSGPPSEILSSERILRQISRDVSRERSLDGKEGGEDGEENADEPTGDGRLVEEEA 721          

HSP 3 Score: 81.6481 bits (200), Expect = 2.495e-15
Identity = 56/203 (27.59%), Postives = 102/203 (50.25%), Query Frame = 3
Query: 2019 TLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISE 2588
             L N++ EI  G+ V IVG+ G+GKSSL   +   +    G+V + G              +A + Q+ ++ + S+++NI      +++     +E C L+  +  L GG + E+GERG N S GQ+Q V LARA+     I  +D+  ++VD    + +   +       +  T + + H ++ +   D VLV++  G+++E
Sbjct: 1127 ALRNVSLEIHAGEKVGIVGRTGSGKSSLFLVLFRMVEVAEGAVILDGVNIASLPLDKLRSRLAIIPQDPFLFSGSVRDNIDPWGKCSDRDLWITLERCHLQQPVSDL-GGLDAEVGERGRNFSAGQRQLVCLARAMLTRAKILCIDEATASVDMETDRFIQRTI---REAFRTSTVLTIAHRIDTVMDSDRVLVMN-KGTVTE 1324          

HSP 4 Score: 53.1434 bits (126), Expect = 1.089e-6
Identity = 61/231 (26.41%), Postives = 96/231 (41.56%), Query Frame = 3
Query: 4188 VLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEA-TASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLA 4877
            +L  +NL    G+ IGV+G  G+GKSSL  AL   ++   G +           +  L     ++ Q+P I   T++EN+     +  D+    +    L+  +  L  G D E GE GVNLS                       GQK  + LARA+ +   + +LD+   A        L  H I    +  TVI+  H    +   D ++VM NG ++    P  +L+
Sbjct:  478 LLSGLNLSIRKGQLIGVIGGVGSGKSSLLSALTAEMDKLTGQVF----------VAGLDGGFGLVAQEPWIQHATVKENILFGKPYDVDKYSDVINACALREDLQSLPAGDDTEIGENGVNLS----------------------GGQKARVGLARAVYQNKSIYLLDDPLAAVDAHVAAHLYKHCITGLLRHKTVILCTHHTKFLSGADHVIVMSNGTVMHSGPPSEILS 676          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 982.245 bits (2538), Expect = 0.000e+0
Identity = 582/1546 (37.65%), Postives = 887/1546 (57.37%), Query Frame = 3
Query:  357 IDGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHC-------FSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQD---------------ESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVL-WEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEW--DLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSL 4919
            +  ++++S  +L +T++LA L  +  R        I+ IFWL A +   +     I++  D  P  +           + L L+  +  C       FS   KD    PN  PCPE  AS LS++T+ W+   +   +++ + ++  + L  +D               E  K     EK+ Y   +  H   +          V  + E E  +     +S    L  +L   +    L++C +K + D  ++  P +L++L+ ++ +     W GYF A        + SL     F +  +  +R+R A+IG IYRK L +++  R   T GEIVNLMSVDA+R M+ + +     S PLQ+VLA+  L++ +  ++ AG+ +++   P+N ++    + +   ++K KD RIK++ E+LNGIKVLK+YAWE +F +K++ +R+ E++ +L+ +A  G V    W   PFL+ L+TF  YVL  + N++  EKAFVSL LFN+LRFP+ +LP  ++  + A VSLKR+  +L  EEL    +        +A     +I I DG FSW + +  TL  +N  I  G LVA+VG VG+GKSSL+SA+LGEM ++ GSVSV+G++AYV Q+AWI N +LK NI+F Q   E +Y  ++EAC+L  DLE LP GDETEIGE+G+NLSGGQKQRVSLARAVY +R +YLLDDPLSAVDAHVG+H+F++VI   G+LKDKTRILVTHGL++LP+   VLV+  +G I+E GS++ L +    F +F                                LR  + NE    E T+ V  SP  P++       + +                       N + G   +++     +    S++ +  K TD +                +A++G VK + +   +K+ G+ L I ++  + +   L +F+N WL  +T+D  +     + L+ +                   +Y  +G+   + VC Y  S ++G I AS+ +H+ +L  VLRSPM FF+ TPSG ++NRF+K+++ +D +IPM +   +  LF V  S I+I+  TP  A+ I  L +LY+ +Q FY+ +SRQ +RL+S++ SP++ HF+ETL G ++IRAF EQ+ F + +   +D + K  +    + RWL++R+E +G  +V  A LF+++ R SL+  ++GLSISY+LQ+T  L WL+R  +++ETN VA+ER++EYS    EAEW  +    P D WP  G I   ++ LRYR  L L ++NIN+   GG+K+G+VGRTGAGKSSL L LFR++E A G+I ID ++I+ +GLH+LR R+TI+PQDPV+FSGTLR NLDPF S+ D++I+++LE +HL+S+VSGL + L +EC EGG NLS+                      GQ+QLLCLARALLRK+KVL+LDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++V++ G++ E DSP NL+A     ++   D  L
Sbjct:  102 VAAVHLVSPTLLGLTMLLATLLVQYERMKGVQSSGIMLIFWLLALLCASVTFRSKILQAQD-QPEAVSGWRYTTFYVYYALLLLALVLSCLSDQMPLFSQAVKD----PN--PCPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENK---------EVRAVEESEILIVKSPKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELK-VLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVER-----PAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVM-VDGEITEVGSYQQLKEKEGAFAEF--------------------------------LRMYAANEQ--SEETEPVPNSPTKPMENGVGPGFTGSQSA-------------------SNVSKGSVSEQN-----VEQKNSKNAEAGKTTDAD----------------KALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVVNGTQPNRLMRLG------------------VYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPD-WPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSL----------------------GQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIAQKGAFYRMAKDSGL 1509          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: ENSORLT00000010371.2 (canalicular multispecific organic anion transporter 1 [Source:NCBI gene;Acc:101165337])

HSP 1 Score: 959.133 bits (2478), Expect = 0.000e+0
Identity = 580/1455 (39.86%), Postives = 877/1455 (60.27%), Query Frame = 3
Query:  678 PEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILE----------KIFY-DKIK----ISHNRKRYDLLQNSTASV--------AHLMEDEDKLTNPDNRS--------PGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYI-EHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIY-----AAFTGLQVFSNIWLKNFTED-SDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLNND 4928
            PE+ AS LS++T++W ++ +   +++ +  E  +DL  +D ++  +   +          ++ Y +K+K    I   R + +  +N  ++         A +MED+ K T    +         P   L  ++ + +   L+ +  FK + D   +  P LLK+++ + QN +   W GY  A+  L   +L SL     F    +L +++R A++  +Y+K L ++N+ R + T GE VNLMS DA+R  +   F     SCPLQI+++I+ L+ E+  ++ AGL ++V   P+NGLL    +K+    + +KD R+KI+ E+LNG+K+LK++AWE SF  ++ ++R  E++ + + +    V   ++   P L+ LA+F  +VL S  NI+T EKAF S++LFN+LRFP+ +LP  +   +   VS KR+ ++L GE+L    + H     D +F  D+A+ +R+GSFSW+++ +  L +++ +I  G+LVA+VG VG+GKSSL+SA+LGEMH   G ++++G++A+V Q+AWIQN +L++NILF   + EK ++++I+AC+L  DL+ L  G+ TEIGE+GINLSGGQKQRVSLARA Y   DIYLLDDPLSAVD+HVG+HLF+ VI  NG+LK KTRILVTHG+++LP VDEV+VL  +G ISE GS+  L      F +F+  Y  E NN+ K+   G                    D ED +E I +   T P  P++   S  +   +    S  S S+             NS V + ED                + ET         K   +L+E+E   +G VK++ Y   +++ G W + + V I       AF G     N+WL ++T D +D  N +          P W +  R      + ++  +G+    +V          S++AS+++H +LL ++LR PM FFDTTP GR++NRF+KDI  +D  IP +    L CL  V  ++ VI   TP+F I I+PLA++Y+ +Q FY+ TSRQ RRLDS++ SP+++HF ET+ G+++IRA++ Q  F   N+  ID++ K  +    S RWL++R+E LG L+VF + LF++I + SL + LVGL+ISY+L +T+ LNWL+R  +ELETN VA+ER+ EY++I +EA+W  +  P + WP+ G + F DY +RYR GL LVL  I  +    +KIG+VGRTGAGKSSL   LFR++EAA G I+ID ++ISTIGLHDLR RLTI+PQDPV+FSGTLR NLDPF    D+E++++LE +HL+ +V+GL EGL +E  EGG NLSV                      GQ+QLLCLARALLRKS++LILDEATA+VD+ETD L+ +TIR+ F   TV+ IAHR+++I+D+  ++V++ G+IVE DSP NLL      F    D  +  +
Sbjct:   62 PEIGASFLSRITFNWFNSMVVTGYKRPLVQEDMWDLNEKDGTSYLSQRFQHHMDFELAAARVRYQNKLKKHLVIHKGRSQAEASENGISNGLGKGVSRDALMMEDKGKSTEKKKKKKEKKEEDYPNSWLLSTMYKTFKWLLIESAFFKLLQDLLAFVSPQLLKLMISFTQNPNSFVWEGYMYAVLLLLVAILQSLFLQQYFQRCFVLGMKVRTAVMAAVYKKALVVSNDTRKESTVGETVNLMSADAQRFNDVTNFIHLLWSCPLQIIVSIVFLWLELGPSVLAGLLVMVLMVPINGLLATQARKYQVQNMNFKDKRMKIMNELLNGVKILKLFAWEPSFQSQVESIRGEELKVMKKFAYLSSVSTFIFSCAPALVSLASFAVFVLVSPDNILTAEKAFTSISLFNILRFPLAMLPMLIASIVQTGVSKKRLEKFLGGEDLEPDIVRH-----DPSF--DSAVSVRNGSFSWERDAEPLLKDVSLDIEPGRLVAVVGAVGSGKSSLMSALLGEMHCTEGFINIKGSLAFVPQQAWIQNATLRDNILFGSPHEEKRFQEVIQACALGPDLKLLAAGELTEIGEKGINLSGGQKQRVSLARAAYSQADIYLLDDPLSAVDSHVGKHLFDKVIGPNGVLKHKTRILVTHGVSFLPYVDEVVVL-VDGKISEIGSYNSLRASKGAFSEFLDTYAKEQNNQTKSDKDG------------------CQDTED-LEIIPEREDTQPDSPLEDTVSFTLKRENSIRRSQRSSSVRVR---------KNSTVKKSED----------------ANET---------KAGQRLIEKETMETGQVKFSVYLQYLRALG-WGYTSMVFIIYFIQNVAFIG----QNLWLSDWTNDAADYYNQTY---------PNWKRDTR------VGVFGALGIAQGFLVFLGTLLLANASVSASRILHSRLLNNILRVPMVFFDTTPVGRVVNRFAKDIFTIDEAIPQSFRSWLLCLLGVLGTLFVICLATPFFTIIILPLAVIYFFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYRHQDRFLKHNEVTIDENLKSVYPWIVSNRWLAIRLEFLGNLVVFFSALFAVISKDSLDSGLVGLAISYALNVTQTLNWLVRMSSELETNIVAVERVSEYTEIENEAKWITDCRPPERWPDEGKLQFIDYKVRYRPGLDLVLHGITCNIASSEKIGIVGRTGAGKSSLTNCLFRIIEAAEGRILIDDVDISTIGLHDLRGRLTIIPQDPVLFSGTLRMNLDPFDKFSDEELWKALELSHLKDYVAGLQEGLQHEVAEGGENLSV----------------------GQRQLLCLARALLRKSRILILDEATAAVDLETDNLIQNTIRKEFAHCTVLTIAHRLHSIMDSSRVMVLDAGKIVEFDSPSNLLENRGYFFSMAKDAGITQE 1413          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 958.748 bits (2477), Expect = 0.000e+0
Identity = 572/1509 (37.91%), Postives = 868/1509 (57.52%), Query Frame = 3
Query:  357 IDGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHC-------FSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQD---------------ESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVL-WEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEW--DLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILD 4808
            +  ++++S  +L +T++LA L  +  R        I+ IFWL A +   +     I++  D  P  +           + L L+  +  C       FS   KD    PN  PCPE  AS LS++T+ W+   +   +++ + ++  + L  +D               E  K     EK+ Y   +  H   +          V  + E E  +     +S    L  +L   +    L++C +K + D  ++  P +L++L+ ++ +     W GYF A        + SL     F +  +  +R+R A+IG IYRK L +++  R   T GEIVNLMSVDA+R M+ + +     S PLQ+VLA+  L++ +  ++ AG+ +++   P+N ++    + +   ++K KD RIK++ E+LNGIKVLK+YAWE +F +K++ +R+ E++ +L+ +A  G V    W   PFL+ L+TF  YVL  + N++  EKAFVSL LFN+LRFP+ +LP  ++  + A VSLKR+  +L  EEL    +  R     S +    +I I DG FSW + +  TL  +N  I  G LVA+VG VG+GKSSL+SA+LGEM ++ GSVSV+G++AYV Q+AWI N +LK NI+F Q   E +Y  ++EAC+L  DLE LP GDETEIGE+G+NLSGGQKQRVSLARAVY +R +YLLDDPLSAVDAHVG+H+F++VI   G+LKDKTRILVTHGL++LP+   VLV+  +G I+E GS++ L +    F +F                                LR  + NE    E T+ V  SP  P++       + +                       N + G   +++     +    S++ +  K TD +                +A++G VK + +   +K+ G+ L I ++  + +   L +F+N WL  +T+D  +     + L+ +                   +Y  +G+   + VC Y  S ++G I AS+ +H+ +L  VLRSPM FF+ TPSG ++NRF+K+++ +D +IPM +   +  LF V  S I+I+  TP  A+ I  L +LY+ +Q FY+ +SRQ +RL+S++ SP++ HF+ETL G ++IRAF EQ+ F + +   +D + K  +    + RWL++R+E +G  +V  A LF+++ R SL+  ++GLSISY+LQ+T  L WL+R  +++ETN VA+ER++EYS    EAEW  +    P D WP  G I   ++ LRYR  L L ++NIN+   GG+K+G+VGRTGAGKSSL L LFR++E A G+I ID ++I+ +GLH+LR R+TI+PQDPV+FSGTLR NLDPF S+ D++I+++LE +HL+S+VSGL + L +EC EGG NLS+                      GQ+QLLCLARALLRK+KVL+LDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D
Sbjct:  102 VAAVHLVSPTLLGLTMLLATLLVQYERMKGVQSSGIMLIFWLLALLCASVTFRSKILQAQD-QPEAVSGWRYTTFYVYYALLLLALVLSCLSDQMPLFSQAVKD----PN--PCPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENK---------EVRAVEESEILIVKSPKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELK-VLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSV-ERPAAGGSPY----SISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVM-VDGEITEVGSYQQLKEKEGAFAEF--------------------------------LRMYAANEQ--SEETEPVPNSPTKPMENGVGPGFTGSQSA-------------------SNVSKGSVSEQN-----VEQKNSKNAEAGKTTDAD----------------KALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVVNGTQPNRLMRLG------------------VYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPD-WPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSL----------------------GQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMD 1472          

HSP 2 Score: 76.2554 bits (186), Expect = 3.170e-13
Identity = 73/295 (24.75%), Postives = 125/295 (42.37%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVM-HTI--REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNL 4871
            LN L    + +    V+L+R+R +       E  +    +   P +  I+ +D    +       LK +N+    G  + VVG  G+GKSSL  AL   ++   GS+              ++  +  +PQ   I + TL+ N+      K+    + +E   L   +  L  G + E GE GVNLS                       GQKQ + LARA+     V +LD+  ++VD    + +  H I  +   +  T I++ H ++ +    +++VM +GEI E+ S + L
Sbjct:  595 LNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYS--ISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSV-------------SVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLS----------------------GGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQL 852          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 572/1509 (37.91%), Postives = 868/1509 (57.52%), Query Frame = 3
Query:  357 IDGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHC-------FSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQD---------------ESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVL-WEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEW--DLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILD 4808
            +  ++++S  +L +T++LA L  +  R        I+ IFWL A +   +     I++  D  P  +           + L L+  +  C       FS   KD    PN  PCPE  AS LS++T+ W+   +   +++ + ++  + L  +D               E  K     EK+ Y   +  H   +          V  + E E  +     +S    L  +L   +    L++C +K + D  ++  P +L++L+ ++ +     W GYF A        + SL     F +  +  +R+R A+IG IYRK L +++  R   T GEIVNLMSVDA+R M+ + +     S PLQ+VLA+  L++ +  ++ AG+ +++   P+N ++    + +   ++K KD RIK++ E+LNGIKVLK+YAWE +F +K++ +R+ E++ +L+ +A  G V    W   PFL+ L+TF  YVL  + N++  EKAFVSL LFN+LRFP+ +LP  ++  + A VSLKR+  +L  EEL    +  R     S +    +I I DG FSW + +  TL  +N  I  G LVA+VG VG+GKSSL+SA+LGEM ++ GSVSV+G++AYV Q+AWI N +LK NI+F Q   E +Y  ++EAC+L  DLE LP GDETEIGE+G+NLSGGQKQRVSLARAVY +R +YLLDDPLSAVDAHVG+H+F++VI   G+LKDKTRILVTHGL++LP+   VLV+  +G I+E GS++ L +    F +F                                LR  + NE    E T+ V  SP  P++       + +                       N + G   +++     +    S++ +  K TD +                +A++G VK + +   +K+ G+ L I ++  + +   L +F+N WL  +T+D  +     + L+ +                   +Y  +G+   + VC Y  S ++G I AS+ +H+ +L  VLRSPM FF+ TPSG ++NRF+K+++ +D +IPM +   +  LF V  S I+I+  TP  A+ I  L +LY+ +Q FY+ +SRQ +RL+S++ SP++ HF+ETL G ++IRAF EQ+ F + +   +D + K  +    + RWL++R+E +G  +V  A LF+++ R SL+  ++GLSISY+LQ+T  L WL+R  +++ETN VA+ER++EYS    EAEW  +    P D WP  G I   ++ LRYR  L L ++NIN+   GG+K+G+VGRTGAGKSSL L LFR++E A G+I ID ++I+ +GLH+LR R+TI+PQDPV+FSGTLR NLDPF S+ D++I+++LE +HL+S+VSGL + L +EC EGG NLS+                      GQ+QLLCLARALLRK+KVL+LDEATA++D+ETD L+  TIR  F+  TV+ IAHR+NTI+D
Sbjct:  140 VAAVHLVSPTLLGLTMLLATLLVQYERMKGVQSSGIMLIFWLLALLCASVTFRSKILQAQD-QPEAVSGWRYTTFYVYYALLLLALVLSCLSDQMPLFSQAVKD----PN--PCPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENK---------EVRAVEESEILIVKSPKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPSWQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELK-VLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSV-ERPAAGGSPY----SISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVM-VDGEITEVGSYQQLKEKEGAFAEF--------------------------------LRMYAANEQ--SEETEPVPNSPTKPMENGVGPGFTGSQSA-------------------SNVSKGSVSEQN-----VEQKNSKNAEAGKTTDAD----------------KALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVVNGTQPNRLMRLG------------------VYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPD-WPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSL----------------------GQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMD 1510          

HSP 2 Score: 76.2554 bits (186), Expect = 3.300e-13
Identity = 73/295 (24.75%), Postives = 125/295 (42.37%), Query Frame = 3
Query: 3996 LNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVM-HTI--REYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNL 4871
            LN L    + +    V+L+R+R +       E  +    +   P +  I+ +D    +       LK +N+    G  + VVG  G+GKSSL  AL   ++   GS+              ++  +  +PQ   I + TL+ N+      K+    + +E   L   +  L  G + E GE GVNLS                       GQKQ + LARA+     V +LD+  ++VD    + +  H I  +   +  T I++ H ++ +    +++VM +GEI E+ S + L
Sbjct:  633 LNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYS--ISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSV-------------SVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLS----------------------GGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQL 890          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc6a (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101158001])

HSP 1 Score: 957.207 bits (2473), Expect = 0.000e+0
Identity = 557/1522 (36.60%), Postives = 877/1522 (57.62%), Query Frame = 3
Query:  366 LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIF-YDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNP--DNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDL-NNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSL 4919
            ++++S +I  +T++LA+   ++ R         LF+FW+ + +  L+ L   I   +D    +     +   +         FL  CF+           K PCP   AS LSK+ + W    + K +R  +     + LR +D S K  + L++ +  +  K+    K  +    S   +   + D+ +L       +S G+ L  +LAR +G   L        HD  ++A+P +L +LL +I++     W GYF A        L SL  +   +    + +R++ A++G++YRK+L +N+  R   T GEIVNL+S D +++M+++++       P++I L +  L+Q +  +  AG+  ++  FPLNG +     K   I++K+ D R++++ EILNGIK+LK YAWEK+FL+++   R+ E++ + +    + +    +    FLI  A F  YV+  E N++  +K FVS+ L N+L+ P+  LP+ ++ +M A VSL+R+G+YL  EEL +  ++    + D     D  IE  +G+FSW KE    L  I+  + RG LVA+VG VG+GKSSL+SA+LGE  + +G V+V+G++AYV Q+AWIQN ++++NILF ++  + +Y+ ++EAC+L  DL+ LP GD TEIGE+G+NLSGGQKQRVSLARAVY+  D+YLLDDPLSAVDAHVGQH+F+ VI   G+LKD+TRILVTHG+++LP+ D +LVL  +G I+E GS+++LL     F  F+  +     +            ESA+ +A       S   +    + DF+      P  R+ S                        +   + +N+ + ++ +P S               E DQ+    + + + +L E ++A +G VK   Y    K+ GL + I  V +YA   G  +  + WL  + +D  + N +Q                       + ++  +G    + +     + ++  I AS+ +H  LL +VLRSPM FF++TPSG ++NRF K+I+ +D ++P  +   LS +F +    I+++  TP  A+ I+PLA LY  +Q FY+ TS Q RRL++++ SP++ HF ET+QG ++IRAF EQ  F       +D +    F +  + RWL++ +E +G  +V AA + S+IG+ +++  +VGL++S+SLQ+T  L+W++R +T++E N V++ER+ EY+  P EA W+   +A   +WP +G I F+DY L+YR+GL L LK I L     +KIG+VGRTGAGKSSL L +FR++EAA G I ID +NI+ IGLHDLR R+TI+PQDPV+FSG+LR NLDPF  + D+EI+ SLE AHL+ +VS L + L++EC EGG NLS+                      GQ+QL+CLARALLRK+K+L+LDEATA+VD+ETD L+  TIR  F+  TV+ IAHR+NTI+D   ++VM+ G I E+DSP NL++     ++   +  L
Sbjct:  103 VFLLSPIIRSMTVILALCIIQLERIRGCRSSIFLFLFWVLSVVCSLVPLRAKIQLAVDEGIASDIVRYLAFFSYFTIQMAQLFLC-CFADQPPQGKPNLEKNPCPVKDASFLSKILFWWFTGLVVKGYRTPLEATDLWTLREEDTSHKIISDLQQEWGAECAKLQKQEKSLE----SAPVLGSRLPDQAQLLRKLQKEQSSGFFLLRTLARKFGPYFLTGTLCIIFHDAFMFAIPQVLSLLLGFIRDPEAPQWKGYFYATLMFLLSCLQSLFNHQYMYTCFTVGMRVKTAVMGLVYRKSLVINSAARRTCTVGEIVNLVSADTQKLMDFVVYFNAVWLAPIEIGLCLFFLWQHLGPSALAGIATVILIFPLNGFIAKKRSKLQEIQMKFMDGRVRLMNEILNGIKILKFYAWEKAFLEQVLGYREKELKALKKSQVLYSISIASFNSSSFLIAFAMFGVYVMLDERNVLDAQKVFVSMALINILKTPLSQLPFAISTTMQALVSLRRLGKYLCSEELKVDGVSKALSSSDGE---DVVIE--NGTFSWSKEGPPCLKRISVRVPRGSLVAVVGHVGSGKSSLLSAMLGETEKRSGQVTVKGSVAYVPQQAWIQNATVQDNILFGREKLKTWYQRVLEACALLPDLDILPAGDATEIGEKGLNLSGGQKQRVSLARAVYRKADLYLLDDPLSAVDAHVGQHIFDKVIGPKGVLKDRTRILVTHGMSFLPQADLILVL-IDGEITESGSYQELLSHHGAFADFIHTFASTEKK------------ESAIQRAG------SRRSNARLSMVDFM------PFSRDLSQE---------------------QLIGGDTTNTNL-QNMEPVS---------------ENDQDQ---VPEDLGKLTEADKAHTGRVKLDMYKKYFKTIGLAIIIPIVFLYAFQQGASLAYSYWLSMWADDP-VVNGTQ-----------------TDRDLKLAVFGALGFVQGIAIFGTTVAISICGIIASRQLHMDLLVNVLRSPMAFFESTPSGNLLNRFVKEIDAIDCMVPEGLKMMLSYVFKLVEVCIIVLIATPIAAVIILPLAFLYAFVQSFYVATSCQLRRLEAVSRSPIYTHFNETVQGASVIRAFGEQSRFIMQANERVDFNQTSYFPRFVATRWLAVNLEFVGNGVVLAAAVLSVIGKSTVSPGIVGLAVSHSLQVTGILSWIVRSWTDVENNIVSVERVNEYADTPKEASWNTEGSALPLAWPQSGTIEFQDYGLQYRKGLELALKGITLQIQKREKIGIVGRTGAGKSSLALGIFRILEAAKGRIFIDGVNIAEIGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDIYTDEEIWSSLELAHLKDFVSNLPDKLNHECSEGGENLSL----------------------GQRQLVCLARALLRKTKILVLDEATAAVDLETDTLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDRGYISEMDSPANLISQRGQFYRMCREAGL 1509          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000000273.1 (SMESG000000273.1)

HSP 1 Score: 2447.16 bits (6341), Expect = 0.000e+0
Identity = 1253/1261 (99.37%), Postives = 1256/1261 (99.60%), Query Frame = 3
Query:  606 MNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQ 4388
            MNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHR+FTD+SAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEK YEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNN   NPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNASDRLSSSISKSIDGFSRHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKD+ENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFAIAIIPLAILYYLIQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDKSSKFKFIQQSSVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSI IDKINISTIGLHDLRKRLTILPQ
Sbjct:    1 MNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHREFTDNSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKVYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNN---NPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNASDRLSSSISKSIDGFSRHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDMENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFAIAIIPLAILYYLIQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDKSSKFKFIQQSSVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSITIDKINISTIGLHDLRKRLTILPQ 1258          

HSP 2 Score: 77.0258 bits (188), Expect = 1.258e-13
Identity = 64/253 (25.30%), Postives = 117/253 (46.25%), Query Frame = 3
Query: 4131 NGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSL-ETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVME-NGEIVEIDSPKNLL 4874
            +  I  +D    +++   L L NIN     GK + +VG+ G GKSSL  A+   +    GS+              ++  +  + Q+  I + +L+EN+  F+   ++++++ + E   L+S +  L  G + E GE G+NLS                       GQKQ + LARA+ +   + +LD+  ++VD    + +   +       +  T I++ H +N +   D ++V++ NG I E  S K+LL
Sbjct:  453 DAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSV-------------SVQGTIAYVSQEAWIQNKSLKENI-LFTQDYNEKVYEDIIEACSLKSDLEQLPGGDETEIGERGINLS----------------------GGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLL 669          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000000283.1 (SMESG000000283.1)

HSP 1 Score: 1568.52 bits (4060), Expect = 0.000e+0
Identity = 854/1536 (55.60%), Postives = 1092/1536 (71.09%), Query Frame = 3
Query:  345 SNSLI--DGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYN----IRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNS----GVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQSLN 4922
            +NSL   +GLY++SY  L   L L ++Q EIRRR  HPVC ILFIFW T +I YL+R Y  I+     S  N    I+         +  LF+ +F  +C     K   ++  + PCPE YAS +SKLT+SW D+YIYKW ++EMT+E SF+LR  DES K  N++EK F  KI+    + +     N + S  +L+ D D+       + GW+LF  L++V+  +L++A   K + D  +   P+LLKILL Y+ + +   WI Y +A  FL  G+LSS+ EN  +F+TS LS+RIRA +IGMIY KTLRL+ E RNK+T+GEIVNLMSVDAERIM +I F+WF  SCP QI++A +LLYQEM+YAIFAG GL + F PLNGLLM     FS +ELKWKD RIKI +EIL GIKV+KMY WE+SF+ KIT LR+ E++YILR    +G+V ++WEILP LI++   L +V  + +N IT EKAFVSL+LFNL+RF ++++P+GLT+++NAFVSLKRI +YL+ EE+      +     +     D AIEI+ G+FSWK+ DK+ LNNIN  I +GKL+A+VGK+G+GKSSLISAILGEM  I+G V ++G IAYVSQE WIQN++LK NILFT+DYNE FY+ ++ +C L  DLEQLP GDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVD+HV   LFEN+ISNNGIL  KTR+L+THGLNWLPKVDE++VLD++G IS+RGSFKDLL++  +F QF++   +H N  KN   G + S ES +   + +     +N+ ++ EI D   +   +  + +  +                      H  +    +S     V +D D +    +    +  + S+E + N   LI +   QL++EEQA  G VK   Y + +KSRGL LF+ TV IY++F  LQVFS IW++ FTED  IQN S  IL N S     S  IRE+T++YM+ Y+ I + M  VV  +W  F +G+ N+ K IH KLL S+LR PMEFFDTTP GRI+NR S D++ +D  +P+N+S+S SC F+V +SIIVIIYVTPWFAI IIPL I YY IQ  Y+PTSRQSRRLD+IA SPVFN FTET+QG+++IRA K + YFQ L+  +IDK+S+F+FIQ SS+RWL  RI+I+G L+VF AV+ SI     LTA LVGLSISYSLQ+TE LNWLLRQYTE+E N VALERIREYS +PSEAEW+    P ++WPN GNI F + DL+YRE L  VLKNINL  +GG K+G+VGRTGAGKSSL LALFRL+EA+ G I+ID ++ISTIGLHDLRKRLTILPQDPVIFSGTLRENLDPF+ H D++++Q LETAHLQ WVS L+EG++YECGEGGVNLS                      AGQ+QLLCLARALLRKSK+LILDEATASVD ETD+LVM T++EYF+ STVIIIAHRINTILDTD IVV+++GE+VEI SPK+LL  +DGIFKSLHDQ++N
Sbjct:   16 ANSLAVSEGLYLLSYGCLSTALFLVIIQTEIRRRICHPVCPILFIFWFTGSIAYLIRFYSEIVGYSKNSSSNDLIVIQISGALFLLFLLNLFIESFPRYC-----KLNSMINKENPCPEEYASTISKLTFSWFDSYIYKWRKEEMTEENSFELRSNDESKKYINLVEKSFLKKIEFCKEKSKQ---INKSNSSKNLLTDNDEEFREKKHNSGWILFSCLSKVFLFQLVVAWVLKLIGDTLLLFTPYLLKILLRYVNSENKTTWISYGIAFTFLANGILSSIMENYSYFMTSYLSVRIRAVIIGMIYSKTLRLSREARNKYTTGEIVNLMSVDAERIMVFIDFSWFIFSCPFQIIIATVLLYQEMNYAIFAGFGLFLVFLPLNGLLMKYAHGFSDVELKWKDERIKIFSEILTGIKVIKMYGWEQSFISKITGLRNLEVKYILRSQIIWGIVYIIWEILPSLIIMVMILSFVFMNRFNFITAEKAFVSLSLFNLIRFSLIIVPYGLTETVNAFVSLKRIAEYLMVEEMEPIGFTYLQNLYEEQLENDPAIEIQGGTFSWKRSDKVILNNINLSIAKGKLIAVVGKIGSGKSSLISAILGEMVTISGDVKIKGRIAYVSQEPWIQNRTLKNNILFTEDYNETFYKKVVVSCCLTQDLEQLPMGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDSHVAHSLFENIISNNGILGGKTRVLITHGLNWLPKVDEIVVLDNSGHISDRGSFKDLLENSLKFKQFIK---DHMNPGKNSVNGANFSHESII--EEKVKHHSPENDQLLYEIPD---SGSGIETEFDLDY----------------------HGPFISKESSPLQFTVVDDADIE----LHNKIKDLEFSEENNHN---LISRSNGQLIDEEQAFVGNVKAKEYFVYVKSRGLLLFLLTVLIYSSFVALQVFSFIWIEKFTEDKVIQNLSNLILKNASYVIDQSNQIRERTEFYMIRYSFICIAMIGVVSLFWVCFAMGTYNSMKYIHGKLLYSILRCPMEFFDTTPVGRILNRLSHDMDLMDRKMPVNLSESFSCFFVVLSSIIVIIYVTPWFAIVIIPLFIFYYFIQFLYMPTSRQSRRLDAIATSPVFNIFTETIQGISIIRACKVESYFQELSYEIIDKNSRFRFIQVSSMRWLCFRIDIIGSLVVFFAVILSITNVSYLTAGLVGLSISYSLQVTEALNWLLRQYTEVEMNMVALERIREYSMVPSEAEWNSLMPPPENWPNIGNIKFIELDLKYRESLSFVLKNINLDLNGGYKVGIVGRTGAGKSSLTLALFRLMEASNGKIVIDGLDISTIGLHDLRKRLTILPQDPVIFSGTLRENLDPFNVHTDEDLYQCLETAHLQDWVSSLNEGMNYECGEGGVNLS----------------------AGQRQLLCLARALLRKSKILILDEATASVDFETDKLVMTTVKEYFRQSTVIIIAHRINTILDTDKIVVLDSGEVVEIGSPKDLLEQADGIFKSLHDQNIN 1484          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000000283.1 (SMESG000000283.1)

HSP 1 Score: 1213.36 bits (3138), Expect = 0.000e+0
Identity = 660/1252 (52.72%), Postives = 862/1252 (68.85%), Query Frame = 3
Query:  345 SNSLI--DGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYN----IRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYWIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNS----GVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYS 4070
            +NSL   +GLY++SY  L   L L ++Q EIRRR  HPVC ILFIFW T +I YL+R Y  I+     S  N    I+         +  LF+ +F  +C     K   ++  + PCPE YAS +SKLT+SW D+YIYKW ++EMT+E SF+LR  DES K  N++EK F  KI+    + +     N + S  +L+ D D+       + GW+LF  L++V+  +L++A   K + D  +   P+LLKILL Y+ + +   WI Y +A  FL  G+LSS+ EN  +F+TS LS+RIRA +IGMIY KTLRL+ E RNK+T+GEIVNLMSVDAERIM +I F+WF  SCP QI++A +LLYQEM+YAIFAG GL + F PLNGLLM     FS +ELKWKD RIKI +EIL GIKV+KMY WE+SF+ KIT LR+ E++YILR    +G+V ++WEILP LI++   L +V  + +N IT EKAFVSL+LFNL+RF ++++P+GLT+++NAFVSLKRI +YL+ EE+      +     +     D AIEI+ G+FSWK+ DK+ LNNIN  I +GKL+A+VGK+G+GKSSLISAILGEM  I+G V ++G IAYVSQE WIQN++LK NILFT+DYNE FY+ ++ +C L  DLEQLP GDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVD+HV   LFEN+ISNNGIL  KTR+L+THGLNWLPKVDE++VLD++G IS+RGSFKDLL++  +F QF++   +H N  KN   G + S ES +   + +     +N+ ++ EI D   +   +  + +  +                      H  +    +S     V +D D +    +    +  + S+E + N   LI +   QL++EEQA  G VK   Y + +KSRGL LF+ TV IY++F  LQVFS IW++ FTED  IQN S  IL N S     S  IRE+T++YM+ Y+ I + M  VV  +W  F +G+ N+ K IH KLL S+LR PMEFFDTTP GRI+NR S D++ +D  +P+N+S+S SC F+V +SIIVIIYVTPWFAI IIPL I YY IQ  Y+PTSRQSRRLD+IA SPVFN FTET+QG+++IRA K + YFQ L+  +IDK+S+F+FIQ SS+RWL  RI+I+G L+VF AV+ SI     LTA LVGLSISYSLQ+TE LNWLLRQYTE+E N VALERIREYS
Sbjct:   16 ANSLAVSEGLYLLSYGCLSTALFLVIIQTEIRRRICHPVCPILFIFWFTGSIAYLIRFYSEIVGYSKNSSSNDLIVIQISGALFLLFLLNLFIESFPRYC-----KLNSMINKENPCPEEYASTISKLTFSWFDSYIYKWRKEEMTEENSFELRSNDESKKYINLVEKSFLKKIEFCKEKSKQ---INKSNSSKNLLTDNDEEFREKKHNSGWILFSCLSKVFLFQLVVAWVLKLIGDTLLLFTPYLLKILLRYVNSENKTTWISYGIAFTFLANGILSSIMENYSYFMTSYLSVRIRAVIIGMIYSKTLRLSREARNKYTTGEIVNLMSVDAERIMVFIDFSWFIFSCPFQIIIATVLLYQEMNYAIFAGFGLFLVFLPLNGLLMKYAHGFSDVELKWKDERIKIFSEILTGIKVIKMYGWEQSFISKITGLRNLEVKYILRSQIIWGIVYIIWEILPSLIIMVMILSFVFMNRFNFITAEKAFVSLSLFNLIRFSLIIVPYGLTETVNAFVSLKRIAEYLMVEEMEPIGFTYLQNLYEEQLENDPAIEIQGGTFSWKRSDKVILNNINLSIAKGKLIAVVGKIGSGKSSLISAILGEMVTISGDVKIKGRIAYVSQEPWIQNRTLKNNILFTEDYNETFYKKVVVSCCLTQDLEQLPMGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDSHVAHSLFENIISNNGILGGKTRVLITHGLNWLPKVDEIVVLDNSGHISDRGSFKDLLENSLKFKQFIK---DHMNPGKNSVNGANFSHESII--EEKVKHHSPENDQLLYEIPD---SGSGIETEFDLDY----------------------HGPFISKESSPLQFTVVDDADIE----LHNKIKDLEFSEENNHN---LISRSNGQLIDEEQAFVGNVKAKEYFVYVKSRGLLLFLLTVLIYSSFVALQVFSFIWIEKFTEDKVIQNLSNLILKNASYVIDQSNQIRERTEFYMIRYSFICIAMIGVVSLFWVCFAMGTYNSMKYIHGKLLYSILRCPMEFFDTTPVGRILNRLSHDMDLMDRKMPVNLSESFSCFFVVLSSIIVIIYVTPWFAIVIIPLFIFYYFIQFLYMPTSRQSRRLDAIATSPVFNIFTETIQGISIIRACKVESYFQELSYEIIDKNSRFRFIQVSSMRWLCFRIDIIGSLVVFFAVILSITNVSYLTAGLVGLSISYSLQVTEALNWLLRQYTEVEMNMVALERIREYS 1222          

HSP 2 Score: 83.5741 bits (205), Expect = 1.404e-15
Identity = 105/401 (26.18%), Postives = 175/401 (43.64%), Query Frame = 3
Query: 3729 FTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVL-FSIIGRFS-LTA--SLVGLS----ISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWD---LNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQS-LETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTDIIVVMEN-GEIVEIDSPKNLLAMS 4883
            F+E L G+ +I+ +  +Q F +    L +   K+    Q     + +  EIL  L++   +L F  + RF+ +TA  + V LS    I +SL I  +        TE     V+L+RI EY  +          L N   +   N+  I  +     ++    ++L NINL    GK I VVG+ G+GKSSL  A+   +    G +              ++ R+  + Q+P I + TL+ N+  F+   ++  ++  + +  L   +  L  G + E GE G+NLS                       GQKQ + LARA+ +   + +LD+  ++VD      +   I          T ++I H +N +   D IVV++N G I +  S K+LL  S
Sbjct:  414 FSEILTGIKVIKMYGWEQSFISKITGLRNLEVKYILRSQIIWGIVYIIWEILPSLIIMVMILSFVFMNRFNFITAEKAFVSLSLFNLIRFSLIIVPY------GLTETVNAFVSLKRIAEYLMVEEMEPIGFTYLQNLYEEQLENDPAIEIQGGTFSWKRSDKVILNNINLSIAKGKLIAVVGKIGSGKSSLISAILGEMVTISGDV-------------KIKGRIAYVSQEPWIQNRTLKNNI-LFTEDYNETFYKKVVVSCCLTQDLEQLPMGDETEIGERGINLS----------------------GGQKQRVSLARAVYQNRDIYLLDDPLSAVDSHVAHSLFENIISNNGILGGKTRVLITHGLNWLPKVDEIVVLDNSGHISDRGSFKDLLENS 772          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000074229.1 (SMESG000074229.1)

HSP 1 Score: 1125.92 bits (2911), Expect = 0.000e+0
Identity = 688/1642 (41.90%), Postives = 975/1642 (59.38%), Query Frame = 3
Query:   78 ICQDGFWNSTSFSNVKYPIFTECFQYVILLI-PSGXXXXXXXXXXXXKKYKSHPIIKVPCTFYYGLKLSSQAXXXXXXXXXXXXXXXXTKSNSLIDGLY--------IMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPN--KIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNR-KRYDLLQNSTASVAHLMEDEDKLTNPDNRSP------GWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNY-WIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQ--------------NRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGG--QHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFK 4898
            +CQD FW+++ F +  YPIFT CFQY +L+I PS  FI+   +       K H  +K+     + L+ S + ++ IL  + +        +  LID LY         +S  +L  +L       E+RRR    +  ILF+FW     GY  R Y + I LL  S  N R  L   S+    +F+++ +   F  F       PN  +   PE+ ASI S+LTY W+D++IY W++ +MTD+TSFDL   ++S+ N+ I  + F       HN  +R D+ + ++ S     EDE+ L N + +        G VL  S+   +   +L+AC  + V D  I  +P +LK+LL Y + +  NY W G   A  FL  G++ S+ EN CF +T+ +SIR+R ++IGMI RKTLRL+ E +  +++G+I+N+  VD E+IMNWI+++W  LSCP QI+L ++LLY E+  +IF G+ +IV   P+   +M L +K+S  EL WKD R+ ILTEILNGIKV+KMY WEKSF +KI ++R  E++     S  + ++ V+++++PFL+M +TF  Y+    ++II+ EK F+++ LFN ++ PM++LPWG+T ++ A VS  RIG++L+  E+          T  S    DA+IEI+ G FSW K     L NI   + + KL+A+VG+VG GKSSL+SAILGEM+ +NG+V  +G IAYV QEAWIQN +L+ NIL T+ +N+ FY  +++AC L+ D+E LP  D+TEIGERG+NLSGGQKQRVSLARAVYQ              + DIYLLDDPLSAVD +VGQ LF  +ISN G+LK KTR+LVTHGL                                +++ FV E    N++ +    G  +HL D     + K+ L + SD  D  +      L  P+ P +R                                            K  R+ T GSQ      + ++N +   +K  + +  EE+ MSG V   +     K+ G+++F +++     F  LQ F N+WL    +   + N S     N S         R   K+Y+  Y IIGL   L V  +W  FT G + ASK IH  LL +VLRS ++FF+ TPSGRI+NRFSKD+  +DH + +NI+D ++   ++  S++VI  VTPWF I  IP+ I Y L+Q+FYI +SRQ+RRLDS A+S V  H  ET  G ++IR+ + +  F+++    IDKS+KFK IQ  S+RWL LR++ILG L+VF +V+F+++ RFSL+ASLVGLSISY+LQ+T  LNWL RQ  E ETN V++ERIR+Y+ IP E+  + NN  S++W +NGNI  +++ L+Y   LP VLKNI ++ +GG+KIGVVGRTGAGKSSL LALFRLVE   G I ID +NI++IGLH LR++LTILPQDPVIFSGTL+ NLDPF  + DD++ +SLE + +  WV+ L +GL Y+CG  G NLS                       GQKQL+CLAR +L+ SK++ILDEATASVD +TDR V   I   F+ STVIIIAHRI TI+  D I+  ENG +VE  SP+ LL  ++G F+
Sbjct:    7 LCQDSFWSNSHFQSPNYPIFTNCFQYTLLIIGPSIFFIMFSILLLESLFNKKH--LKIITFHSFDLRHSIKIILPILGGILVF-------AEMLIDNLYTTNKDSMLFISCGLLSASLFSVSFATELRRRGNKSIDVILFVFWWMVFCGYFFRYYSHFIALLQNSKPN-RIILFLFSSFAILIFIVSIILDTFLRFP------PNLRETKHPEIIASIFSQLTYKWMDSFIYNWYKVDMTDKTSFDLHSTEKSSINSEISAQYF-------HNYGEREDIFRRASKS-----EDEEFLINSEEKESFILEHSGKVLIKSIFGAHFHIILIACLLRIVRDILILTLPLVLKLLLNYFKEKQKNYTWKGVLYAFVFLIQGLIGSVFENYCFTLTNKISIRVRGSVIGMISRKTLRLSAEAKATYSAGDIINMTMVDMEQIMNWIVYSWILLSCPFQIILTVVLLYYELGNSIFVGVAMIVTVIPVKIAIMRLTKKYSEKELMWKDKRMNILTEILNGIKVIKMYVWEKSFFNKIESIRHEELKNFRNYSIGWCILNVMFDLVPFLVMYSTFTFYIYFVPFSIISAEKVFIAIVLFNNIQLPMLLLPWGVTQTITAVVSFGRIGKFLLSNEIYPRSSVPLVVTQMSP---DASIEIQSGRFSWTKIGNPVLKNIQLTVEKQKLIAVVGRVGVGKSSLLSAILGEMYTLNGAVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGTVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQVNLKGKFQILKYFKDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGL--------------------------------KWLPFVDEICVINDQGQISERGTYEHLMDFGT--EFKSFLNESSDKVDKNQN----NLIQPSAPNKR--------------------------------------------KRSRLSTSGSQGF----DGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNST---FNQS---------RNSAKFYINCYGIIGLGQLLAVILFWGGFTFGGLRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFSKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVVNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITMNINGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNLLKDGLYYDCGYMGANLS----------------------TGQKQLVCLARTVLKNSKIIILDEATASVDEDTDRRVFDAITSQFRNSTVIIIAHRIKTIIGCDKILYFENGSVVEFGSPQELLLKANGKFR 1497          

HSP 2 Score: 90.5077 bits (223), Expect = 1.018e-17
Identity = 112/498 (22.49%), Postives = 217/498 (43.57%), Query Frame = 3
Query: 1206 SIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVD---AERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAF----VSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQF 2639
            S +I + L+  + R TL+  N       SG I+N  S D    +  +N  I     ++  + ++ +++++     +    G+ +++ +  L    ++  ++   ++ K     +  L E  +G  +++    E  F        D   ++ L    +   +C+  +IL  LI+  + +  V+    N  +   + V L++   L+   + L W LT     F    VS++RI QY +   + +  IN  +      +  +  I + + S  +       L NI   I  G+ + +VG+ G GKSSL  A+   +   +G + + G              +  + Q+  I + +LK N+    +Y +      +E   +   +  L  G   + G  G NLS GQKQ V LAR V +N  I +LD+  ++VD    + +F+ + S     ++ T I++ H +  +   D++L  + NGS+ E GS ++LL   N   +F
Sbjct: 1020 SKKIHSVLLDTVLRSTLQFFNAT----PSGRILNRFSKDLFIIDHTLNLNITD--IINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVV----NRFSLSASLVGLSISYALQVTGI-LNW-LTRQCAEFETNAVSIERIRQYTM---IPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITMNINGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNLLKDGLYYDCGYMGANLSTGQKQLVCLARTVLKNSKIIILDEATASVDEDTDRRVFDAITSQ---FRNSTVIIIAHRIKTIIGCDKILYFE-NGSVVEFGSPQELLLKANGKFRF 1498          

HSP 3 Score: 58.5362 bits (140), Expect = 5.609e-8
Identity = 67/263 (25.48%), Postives = 111/263 (42.21%), Query Frame = 3
Query: 4188 VLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQS--LETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARAL--------------LRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTD-IIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            VLKNI L     K I VVGR G GKSSL  A+   +    G++                 ++  +PQ+  I + TLR N+    +   ++IF    L+   L+  +  L      E GE GVNLS                       GQKQ + LARA+               + S + +LD+  ++VDV   + + + +   +   +  T +++ H +  +   D I V+ + G+I E  + ++L+      FKS  ++S
Sbjct:  642 VLKNIQLTVEKQKLIAVVGRVGVGKSSLLSAILGEMYTLNGAVQT-------------EGKIAYVPQEAWIQNNTLRNNI--LCTKSFNKIFYGTVLDACCLEYDIESLPNRDQTEIGERGVNLS----------------------GGQKQRVSLARAVYQVNLKGKFQILKYFKDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTE-FKSFLNES 866          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000074226.1 (SMESG000074226.1)

HSP 1 Score: 1092.41 bits (2824), Expect = 0.000e+0
Identity = 665/1538 (43.24%), Postives = 941/1538 (61.18%), Query Frame = 3
Query:  360 DGLYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIF-WLTATIGYLLRLYCNIIRLLDASPYNIRNGXXXXXXXXXXXXXMNFLTHCFSSFSKDRLVLPNKIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDN-----RSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNY-WIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQ--------------NRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNRAKNPSGG--QHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNAXXXXXXXXXXXXXXXXXHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFXXXXXXXXXXXXXXQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDXXXXXXXXXXXXVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDVETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPKNLLAMSDGIFKSL 4904
            D L I+SY  L  ++++A+   E+ RR  H    +LFI+ WL    GY +R Y N+I+ L  S   +R     +S+ I  L  ++ +    S +  + L        PE ++S+LS++TY W+D YIY+WF++EM DETSFDL   + S++N+    K             + +L   +  S  H +ED+  L    N     +  G  L  SL RVY   +      K   D  +  +P +LK+LL Y++N+  +Y W G  +A+ F F G+  SL EN CF ITS +++R+RAAL GMIY+KTLRL+ E R+  ++G+IVN+ SVD E++MN I ++W F+SCP QI+LAI+LLY E+ Y+IFAG+  I A  PLN ++M   +KFS  EL +KD R+ ILTEI +G+K++KMYAWEK F  KI  +R+ E++ I  VS  + ++ VLW+++PF +M  TF  ++     ++ITPEK FVSL LFN L+ P+++LPWGL+ +++A VS  RI  +L+  E    + N  + +     +  A IEI++GSFSW ++ + TLNNIN  + + KL+A+VG+VG GKSSL+SAILGEM+ +NG+V  +G IAYV QEAWIQN +L+ NIL T+ +N+  Y  +++AC L+ D+  LP  D+TEIGERG+NLSGGQKQRVSLARAVYQ              + DIYLLDDPLSAVD +VGQ LF  +ISN G+LK KTR+LVTHGL                                +++ FV E    N++ +    G  +HL D     + K+ L + SD  D  +      L  P+ P +R                                            K  R+ T GSQ      + ++N +   +K  + + +EE+ MSG V   +     K+ G+++F +++     F  LQ   N+WL    +   + N S     N S         R   K+Y+  Y IIGL   L V  +W  FT GS+ ASK IH  LL +VLRS ++FF+ TPSGRI+NRF+KD+  +DH++ +NI+D ++   ++  S++VI  VTPWF I  IP+ I Y L+Q+FYI +SRQ+RRLDS A+S V  H  ET  G ++IR+ + +  F+++    IDKS+KFK IQ  S+RWL LR++ILG L+VF +V+F+++ RFSL+ASLVGLSISY+LQ+T  LNWL RQ  E ETN V++ERIR+Y+ IP E+  + NN  S++W +NGNI  +++ L+Y   LP VLKNI ++ +GG+KIGVVGRTGAGKSSL LALFRLVE   G I ID +NI++IGLH LR++LTILPQDPVIFSGTL+ NLDPF  + DD++ +SLE + +  WV+ L+EG++Y+CG  G NLS+                      GQKQL+CLAR LL+KSK++ILDEATASVD ETDR V+  I+  F +STVIIIAHR+ TI+D D I+ +++G I+E  SPK LL+ S G FK+L
Sbjct:   26 DSLLIISYGSLMASMIVAVFTMELGRRGNHFFKVVLFIYSWLIFG-GYAIRFYNNLIKFLKYST-KMRMIYFSISSVIMILLFLSVIMDSISCYYTNDLT-----ENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYL-----------KENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFLIKSLCRVYFPIIFFGWILKIFRDILVLTLPLVLKLLLNYLKNKDLSYTWKGILMALLFFFQGLFGSLCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQIILAILLLYLELGYSIFAGVTAIGAIIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSLVLFNNLQLPILLLPWGLSQAISALVSFGRIENFLLASE----KENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVEKQKLIAVVGRVGVGKSSLLSAILGEMYTLNGAVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKILYGTVLDACCLEYDIGSLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQVNLKGKFQILKYFKDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGL--------------------------------KWLPFVDEICVINDQGQISERGTYEHLMDFGT--EFKSFLNESSDKVDKNQN----NLIQPSAPNKR--------------------------------------------KRSRLSTSGSQGF----DDNENAEENYEKYFNDISQEEEIMSGRVSLNSIVWYFKATGIFVFASSILACVIFGVLQAIGNVWLGMLADTQSLLNNST---FNQS---------RNSAKFYINCYGIIGLGQLLAVILFWGGFTFGSLRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHILNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKHNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSM----------------------GQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKAL 1421          

HSP 2 Score: 90.1225 bits (222), Expect = 1.378e-17
Identity = 116/511 (22.70%), Postives = 222/511 (43.44%), Query Frame = 3
Query: 1206 SIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVD---AERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAF----VSLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCN-EFMQFVQ--EYIEHNNR 2669
            S +I + L+  + R TL+  N       SG I+N  + D    + I+N  I     ++  + ++ +++++     +    G+ +++ +  L    ++  ++   ++ K     +  L E  +G  +++    E  F        D   ++ L    +   +C+  +IL  LI+  + +  VL    N  +   + V L++   L+   + L W LT     F    VS++RI QY +   + +  IN  +      +  +  I + + S  +       L NI   I  G+ + +VG+ G GKSSL  A+   +   +G + + G              +  + Q+  I + +LK N+    +Y +      +E   +   +  L  G   + G  G NLS GQKQ + LAR + +   I +LD+  ++VD    + + E +          T I++ H L  +   D+++ LD +GSI E GS K+LL + +  F    Q  EYI+H ++
Sbjct:  942 SKKIHSVLLDTVLRSTLQFFNAT----PSGRILNRFTKDLFIIDHILNLNITD--IINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVL----NRFSLSASLVGLSISYALQVTGI-LNW-LTRQCAEFETNAVSIERIRQYTM---IPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKHNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQ---FVSSTVIIIAHRLKTIIDCDKIIHLD-DGSIIEFGSPKELLSNSSGHFKALAQADEYIKHEDK 1433          

HSP 3 Score: 64.3142 bits (155), Expect = 1.055e-9
Identity = 76/310 (24.52%), Postives = 125/310 (40.32%), Query Frame = 3
Query: 4041 VALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSXXXXXXXXXXXGLHDLRKRLTILPQDPVIFSGTLRENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCITHTHIFIYALFINFHNFIQAGQKQLLCLARAL--------------LRKSKVLILDEATASVDVETDRLVMHTI---REYFQASTVIIIAHRINTILDTD-IIVVMENGEIVEIDSPKNLLAMSDGIFKSLHDQS 4916
            V+  RI  +  + SE E D NN+          I  ++    + E     L NINL+    K I VVGR G GKSSL  A+   +    G++                 ++  +PQ+  I + TLR N+    S         L+   L+  +  L      E GE GVNLS                       GQKQ + LARA+               + S + +LD+  ++VDV   + + + +   +   +  T +++ H +  +   D I V+ + G+I E  + ++L+      FKS  ++S
Sbjct:  516 VSFGRIENF-LLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVEKQKLIAVVGRVGVGKSSLLSAILGEMYTLNGAVQT-------------EGKIAYVPQEAWIQNNTLRNNILCTKSFNKILYGTVLDACCLEYDIGSLPNRDQTEIGERGVNLS----------------------GGQKQRVSLARAVYQVNLKGKFQILKYFKDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTE-FKSFLNES 788          
The following BLAST results are available for this feature:
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCC22.874e-1639.89ATP binding cassette subfamily C member 2 [Source:... [more]
ABCC30.000e+038.28ATP binding cassette subfamily C member 3 [Source:... [more]
ABCC35.744e-1534.51ATP binding cassette subfamily C member 3 [Source:... [more]
ABCC17.511e-17140.05ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC17.511e-17140.05ATP binding cassette subfamily C member 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrp-10.000e+038.31pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-20.000e+039.01pep chromosome:WBcel235:X:563719:572701:-1 gene:WB... [more]
mrp-10.000e+038.18pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-10.000e+038.12pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-10.000e+038.05pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRP0.000e+039.78gene:FBgn0032456 transcript:FBtr0090025[more]
MRP0.000e+039.63gene:FBgn0032456 transcript:FBtr0090020[more]
MRP0.000e+039.49gene:FBgn0032456 transcript:FBtr0090022[more]
MRP0.000e+039.63gene:FBgn0032456 transcript:FBtr0090023[more]
MRP0.000e+039.28gene:FBgn0032456 transcript:FBtr0090026[more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc32.674e-1238.65ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc20.000e+039.69ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc20.000e+039.83ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc120.000e+032.41ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc15.384e-16837.18ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
septin91.018e-1639.12septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
septin91.117e-1638.79septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
septin96.452e-1438.70septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
septin92.499e-1538.62septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
septin92.700e-1538.24septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abcc11.203e-1739.21ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc30.000e+038.42ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc30.000e+038.55ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc25.815e-1440.08ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc121.607e-1431.98ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CG09|MRP1_RAT5.811e-1739.95Multidrug resistance-associated protein 1 OS=Rattu... [more]
sp|Q6UR05|MRP1_CANLF1.050e-1540.20Multidrug resistance-associated protein 1 OS=Canis... [more]
sp|O35379|MRP1_MOUSE8.417e-1739.21Multidrug resistance-associated protein 1 OS=Mus m... [more]
sp|B2RX12|MRP3_MOUSE0.000e+038.22Canalicular multispecific organic anion transporte... [more]
sp|O88563|MRP3_RAT0.000e+037.92Canalicular multispecific organic anion transporte... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QB021.660e-2039.72Multidrug resistance-associated protein 1 OS=Mizuh... [more]
A0A1I8HN921.649e-1042.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GTT58.414e-1142.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JGC80.000e+041.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EF930.000e+041.90Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc10.000e+038.57ATP binding cassette subfamily C member 1 [Source:... [more]
abcc32.522e-1638.69ATP binding cassette subfamily C member 3 [Source:... [more]
abcc33.331e-1638.53ATP binding cassette subfamily C member 3 [Source:... [more]
abcc10.000e+038.53ATP binding cassette subfamily C member 1 [Source:... [more]
abcc33.142e-1638.10ATP binding cassette subfamily C member 3 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc30.000e+036.24ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
ENSPMAT00000006454.11.582e-10840.40pep scaffold:Pmarinus_7.0:GL483531:32:7621:1 gene:... [more]
ENSPMAT00000007076.15.933e-10838.94pep scaffold:Pmarinus_7.0:GL480539:10051:22495:1 g... [more]
ENSPMAT00000001536.16.150e-10137.50pep scaffold:Pmarinus_7.0:GL479104:2125:31869:1 ge... [more]
ABCC85.075e-9338.19ATP binding cassette subfamily C member 8 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BPT10.000e+033.65ABC type transmembrane transporter of MRP/CFTR fam... [more]
YOR13.474e-14933.77Plasma membrane ATP-binding cassette (ABC) transpo... [more]
YCF12.555e-13242.04Vacuolar glutathione S-conjugate transporter; ABC-... [more]
YBT18.406e-10836.04Transporter of the ATP-binding cassette (ABC) fami... [more]
VMR11.203e-10035.65Vacuolar membrane protein; involved in multiple dr... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO364741.478e-1641.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350711.194e-13641.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434334.060e-12148.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352503.465e-11336.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468464.142e-11336.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc10.000e+037.65multidrug resistance-associated protein 1 [Source:... [more]
ENSORLT00000010371.20.000e+039.86canalicular multispecific organic anion transporte... [more]
abcc13.170e-1337.91multidrug resistance-associated protein 1 [Source:... [more]
abcc13.300e-1337.91multidrug resistance-associated protein 1 [Source:... [more]
abcc6a0.000e+036.60multidrug resistance-associated protein 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000273.11.258e-1399.37SMESG000000273.1[more]
SMESG000000283.10.000e+055.60SMESG000000283.1[more]
SMESG000000283.11.404e-1552.72SMESG000000283.1[more]
SMESG000074229.11.018e-1741.90SMESG000074229.1[more]
SMESG000074226.11.378e-1743.24SMESG000074226.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027178 ID=SMED30027178|Name=Multidrug resistance-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5109bp
ATTCAGTATATAAATGTTTCAAATTTGTTTTTGCATATTGTGCAATTCGT
ATTTAACACTTTTTAATGAAGTCAGAGATTTGTCAAGATGGATTTTGGAA
CTCCACTTCATTTTCCAATGTTAAATATCCTATTTTTACTGAATGCTTCC
AATATGTGATATTATTAATTCCATCGGGAATTTTTATTATTCTTTTTACA
ATGTTTTTTATATTTAAAAAATACAAATCTCATCCAATAATAAAAGTTCC
TTGTACTTTTTACTATGGTCTGAAATTATCTAGTCAGGCGTTAATAATTA
TTTTGCTTATTGTGGAAATAATATTGGAAAAGTTACTTACGAAAAGTAAT
TCGCTAATAGATGGCTTATATATTATGTCATATGTTATATTATGCATAAC
TTTGGTTCTGGCCATGCTGCAGGCTGAAATCAGGCGGCGGACAATGCATC
CCGTGTGCTCCATACTTTTCATATTTTGGTTAACTGCCACTATAGGATAT
TTGCTGAGATTATATTGTAACATTATCCGCCTACTTGATGCTTCTCCGTA
CAATATCAGAAATGGGTTAATATTTCTCTCTGCTGCAATATTTTTCCTTT
TTCTAATGAACTTTTTGACTCATTGCTTTTCTTCATTCTCAAAAGACAGA
TTAGTTCTGCCAAATAAGATTCCTTGTCCAGAGGTTTACGCTTCAATTCT
GTCAAAATTGACCTATTCATGGCTGGATGCGTACATTTATAAGTGGTTTC
GGAAGGAAATGACAGATGAAACATCATTTGACCTAAGACGCCAAGATGAA
TCGACTAAAAATACAAATATACTGGAAAAGATATTTTACGACAAAATAAA
GATTTCTCATAATAGGAAAAGATATGACCTCCTCCAGAATTCAACCGCTA
GTGTTGCGCATCTAATGGAAGATGAAGATAAATTAACGAATCCTGATAAT
CGATCTCCAGGCTGGGTTTTATTTATCAGCCTAGCAAGAGTTTATGGGCT
TGAACTACTTCTTGCATGTGCTTTCAAAACAGTTCATGATTTCTCGATTT
ACGCAATGCCTTTTCTATTAAAAATCCTTTTGGAATATATCCAAAATAGA
AGCGATAATTATTGGATTGGATATTTCCTGGCTATTGCTTTTCTTTTCTT
TGGAGTTCTTAGCAGTTTAGCAGAGAACGGCTGCTTTTTTATTACATCCA
TCCTCAGCATCAGGATTCGAGCAGCGCTCATTGGAATGATTTATAGAAAG
ACTCTCAGACTGAACAATGAAATACGTAATAAATTCACTTCGGGTGAAAT
TGTCAATCTCATGAGTGTTGATGCTGAAAGAATTATGAATTGGATCATTT
TTGCATGGTTTTTCTTGTCATGTCCATTGCAAATTGTGTTGGCCATTATT
TTACTCTATCAGGAAATGAGCTACGCCATTTTCGCTGGTCTAGGATTAAT
AGTTGCATTTTTCCCTTTAAATGGCTTATTAATGAATCTTATGCAAAAAT
TTTCCACGATCGAATTAAAATGGAAAGATTTAAGAATAAAGATTTTAACT
GAAATTCTAAATGGAATTAAAGTTCTTAAAATGTATGCCTGGGAAAAATC
TTTTTTAGATAAAATCACTAATTTACGTGATACAGAAATGAGATATATTT
TAAGGGTTTCGGCAGCATTCGGTGTTGTATGTGTCTTGTGGGAAATATTG
CCGTTCTTGATAATGCTCGCAACATTCCTGTGCTATGTTTTAACCAGTGA
ATATAATATTATCACTCCTGAGAAGGCTTTCGTATCTTTAACACTTTTCA
ATTTGTTGCGTTTCCCCATGGTTGTTTTACCATGGGGGTTGACGGATTCG
ATGAATGCTTTTGTATCTCTCAAACGTATTGGACAATATTTAGTAGGAGA
AGAGTTGAATTTAACTGAAATCAATCATAGAGATTTTACAGATGATTCAG
CATTTAATTATGATGCTGCTATTGAAATTCGCGATGGTTCTTTTTCTTGG
AAAAAAGAAGACAAATTAACACTTAACAATATTAATTTTGAAATTGGTAG
AGGAAAATTAGTAGCCATCGTTGGAAAAGTTGGTACTGGGAAATCATCGC
TAATTTCCGCTATTTTGGGAGAAATGCATAGAATTAATGGTTCGGTTTCA
GTTCAGGGTACAATTGCATATGTTTCTCAGGAAGCCTGGATTCAGAATAA
ATCATTGAAAGAAAACATTTTATTTACTCAAGATTATAACGAAAAATTTT
ACGAGGATATCATAGAAGCATGCTCTTTAAAATCAGACTTAGAACAATTA
CCCGGGGGAGATGAAACTGAGATAGGAGAAAGAGGAATTAATCTTAGTGG
AGGACAAAAACAAAGAGTCAGTTTAGCAAGAGCAGTTTATCAAAATCGTG
ACATTTACCTATTAGATGATCCTCTTTCAGCAGTAGACGCGCATGTCGGG
CAACATTTATTTGAAAATGTTATTTCAAACAATGGAATTCTGAAAGACAA
AACTCGTATTCTTGTAACTCATGGTCTTAATTGGCTTCCGAAAGTTGATG
AGGTTCTAGTTTTGGATTCAAATGGATCAATATCAGAAAGAGGTTCTTTC
AAGGACCTGTTGAAAGATTGTAATGAATTCATGCAGTTCGTGCAGGAATA
TATTGAACATAATAATCGCGCCAAAAACCCCTCTGGTGGTCAACATTTAT
CAGATGAATCAGCTTTAGGAAAAGCTAAAAATCTATTACGACAATTATCG
GACAATGAAGATGTAGTTGAGGAAATCACTGATTTTGTGTTGACATCACC
CGCAGTGCCCATTCAGAGAAATGACAGTCACAGAGTATCAAATGCCAGTG
ACAGACTTTCTTCTTCAATTTCCAAATCTATTGACGGGTTTTCACGCCAT
GTAAAATATTTTGAAAATTCCAATTCTGGAGTATTTGAAGACGAAGACCC
TAAATCTCCAAGGATTATGACACCTGGTTCACAATCACGCCAAATATCTA
AAGAGACTGATCAAAATACTGACAGATTAATTGATAAACCGATAAGCCAA
TTGGTGGAAGAAGAACAAGCCATGTCAGGAACAGTAAAATGGGCCACTTA
TTCAATGTGCATCAAATCAAGGGGATTATGGTTGTTTATTGCCACTGTTG
CTATATATGCGGCGTTTACTGGCTTACAAGTTTTCAGTAATATATGGCTG
AAGAACTTTACGGAAGATTCAGATATTCAAAACGCTAGTCAACATATTTT
GTTGAATATTTCCGGATCTCCTTATTGGTCAAAAATAATCCGTGAACAAA
CTAAATATTATATGGTAATTTACACAATAATAGGTTTATGTATGACATTG
GTTGTTTGTTTCTACTGGGCTAGTTTCACTGTCGGATCTATAAATGCTTC
AAAAGTTATTCACAAGAAACTTCTCAGATCAGTTCTCCGTAGTCCTATGG
AATTTTTCGATACTACACCTTCAGGTCGAATAATTAATCGATTTAGTAAA
GATATTGAAAATCTTGATCATTTGATTCCCATGAATATTAGTGACTCTCT
TAGTTGTCTTTTCATTGTTTTTGCATCAATCATTGTTATTATATATGTCA
CGCCATGGTTTGCGATTGCAATAATTCCTCTAGCCATACTTTACTATTTG
ATTCAACTTTTCTACATACCAACTTCTCGGCAATCTCGTCGTTTAGACTC
TATTGCTGCATCGCCTGTTTTTAACCATTTCACTGAAACATTGCAAGGTG
TAGCGTTGATCCGAGCATTCAAAGAGCAGCAATACTTTCAAAATTTAAAT
CAAACTTTGATTGATAAAAGTAGCAAGTTCAAATTCATCCAACAATCCTC
AGTTCGTTGGTTGTCACTTCGAATTGAAATTCTCGGACAGTTGATGGTTT
TCGCTGCGGTTCTCTTTTCAATCATTGGTCGATTTAGTCTTACTGCCAGT
CTTGTTGGGTTATCAATATCATATTCTTTACAGATAACAGAATTCTTGAA
TTGGCTGTTGCGACAGTACACGGAACTGGAAACCAATTGCGTTGCATTGG
AAAGAATTCGAGAATACTCAAAAATTCCAAGCGAGGCAGAATGGGATTTA
AATAATGCTCCTTCTGACTCATGGCCTAATAATGGAAATATTACGTTTAA
AGATTATGATTTGAGATACCGAGAGGGACTCCCATTGGTTTTAAAGAATA
TAAATTTGCACTTTCATGGTGGAAAGAAAATCGGTGTTGTAGGAAGAACA
GGTGCTGGTAAATCCAGTTTAAACCTTGCCTTGTTTCGATTGGTTGAAGC
AGCTGGTGGAAGTATTATCATTGACAAGATTAATATTTCCACAATCGGAC
TTCATGATTTACGGAAGAGACTTACGATTTTACCTCAAGATCCAGTTATC
TTCTCAGGGACGTTAAGAGAAAACTTGGATCCATTTAGTTCGCATAAAGA
CGATGAAATTTTCCAATCCCTCGAAACAGCGCATTTGCAGTCATGGGTTT
CTGGATTGAGTGAGGGATTAGATTATGAATGTGGTGAAGGCGGAGTCAAT
TTATCGGTATGTATTACACACACGCATATATTTATATATGCATTGTTTAT
CAACTTTCATAATTTCATTCAGGCTGGCCAGAAACAACTGTTGTGCTTGG
CGAGAGCACTTTTGCGAAAGTCGAAAGTTTTGATTTTAGATGAAGCTACA
GCTTCTGTGGATGTTGAGACCGACCGATTGGTAATGCACACGATTCGGGA
ATATTTCCAGGCGAGCACAGTGATCATTATTGCCCACAGGATAAACACGA
TCCTCGACACCGACATAATTGTTGTCATGGAAAATGGGGAAATCGTAGAA
ATTGATTCTCCGAAAAATCTTCTCGCAATGTCAGATGGAATATTCAAATC
TTTGCATGATCAAAGTTTAAATAATGATTTGTGATGATGAAAGAGATGGA
AAACTATTGATTTGTATCTGTGCTTCAGTTGATCATTTTCATATTGAACT
TGTTTAATAAATATTTTCTTGCCATTCCTTTCTGTTTACATTTGACCGAG
AATTTGTTATGTTGTTATTATTACAAATGTGCTTTATTTTATCGCAATAA
ATATTTTCG
back to top

protein sequence of SMED30027178-orf-1

>SMED30027178-orf-1 ID=SMED30027178-orf-1|Name=SMED30027178-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1623bp
MKSEICQDGFWNSTSFSNVKYPIFTECFQYVILLIPSGIFIILFTMFFIF
KKYKSHPIIKVPCTFYYGLKLSSQALIIILLIVEIILEKLLTKSNSLIDG
LYIMSYVILCITLVLAMLQAEIRRRTMHPVCSILFIFWLTATIGYLLRLY
CNIIRLLDASPYNIRNGLIFLSAAIFFLFLMNFLTHCFSSFSKDRLVLPN
KIPCPEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNT
NILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDNRSPGW
VLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNYW
IGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLN
NEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQE
MSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNG
IKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIM
LATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFV
SLKRIGQYLVGEELNLTEINHRDFTDDSAFNYDAAIEIRDGSFSWKKEDK
LTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTI
AYVSQEAWIQNKSLKENILFTQDYNEKFYEDIIEACSLKSDLEQLPGGDE
TEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFE
NVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLK
DCNEFMQFVQEYIEHNNRAKNPSGGQHLSDESALGKAKNLLRQLSDNEDV
VEEITDFVLTSPAVPIQRNDSHRVSNASDRLSSSISKSIDGFSRHVKYFE
NSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEE
QAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTE
DSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFY
WASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDIENL
DHLIPMNISDSLSCLFIVFASIIVIIYVTPWFAIAIIPLAILYYLIQLFY
IPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLID
KSSKFKFIQQSSVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLS
ISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPS
DSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKS
SLNLALFRLVEAAGGSIIIDKINISTIGLHDLRKRLTILPQDPVIFSGTL
RENLDPFSSHKDDEIFQSLETAHLQSWVSGLSEGLDYECGEGGVNLSVCI
THTHIFIYALFINFHNFIQAGQKQLLCLARALLRKSKVLILDEATASVDV
ETDRLVMHTIREYFQASTVIIIAHRINTILDTDIIVVMENGEIVEIDSPK
NLLAMSDGIFKSLHDQSLNNDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0008559xenobiotic-transporting ATPase activity
GO:0015431glutathione S-conjugate-exporting ATPase activity
GO:0016787hydrolase activity
GO:0022857transmembrane transporter activity
GO:0042910xenobiotic transporter activity
GO:0005524ATP binding
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0016887ATPase activity
GO:0000166nucleotide binding
GO:0005215transporter activity
GO:0008514organic anion transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0042493response to drug
GO:0042908xenobiotic transport
GO:0050729positive regulation of inflammatory response
GO:0071716leukotriene transport
GO:0006810transport
GO:0055085transmembrane transport
GO:0015711organic anion transport
Vocabulary: INTERPRO
TermDefinition
IPR036640ABC1_TM_sf
IPR003593AAA+_ATPase
IPR011527ABC1_TM_dom
IPR027417P-loop_NTPase
IPR003439ABC_transporter-like
IPR017871ABC_transporter_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 662..931
e-value: 1.0E-10
score: 51.6
coord: 1382..1589
e-value: 5.3E-10
score: 49.2
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 1373..1543
e-value: 6.1E-24
score: 85.1
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 653..787
e-value: 8.5E-24
score: 84.6
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 636..861
score: 21.555
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 1358..1612
score: 16.107
IPR011527ABC transporter type 1, transmembrane domainPFAMPF00664ABC_membranecoord: 1032..1304
e-value: 6.6E-40
score: 137.5
coord: 314..585
e-value: 1.4E-30
score: 106.9
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 1022..1320
score: 41.038
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 315..597
score: 35.957
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 612..879
e-value: 1.6E-74
score: 252.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1340..1611
e-value: 1.3E-79
score: 269.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 956..981
NoneNo IPR availablePANTHERPTHR24223:SF350CANALICULAR MULTISPECIFIC ORGANIC ANION TRANSPORTER 2coord: 58..1612
NoneNo IPR availablePANTHERPTHR24223FAMILY NOT NAMEDcoord: 58..1612
NoneNo IPR availableCDDcd03250ABCC_MRP_domain1coord: 636..838
e-value: 7.7851E-112
score: 350.231
NoneNo IPR availableCDDcd18603ABC_6TM_MRP1_2_3_6_D2_likecoord: 1021..1332
e-value: 2.87779E-125
score: 391.456
NoneNo IPR availableCDDcd18595ABC_6TM_MRP1_2_3_6_D1_likecoord: 316..605
e-value: 4.58514E-118
score: 371.417
NoneNo IPR availableCDDcd03244ABCC_MRP_domain2coord: 1354..1596
e-value: 4.69729E-105
score: 332.151
NoneNo IPR availableTMHMMTMhelixcoord: 374..393
NoneNo IPR availableTMHMMTMhelixcoord: 350..369
NoneNo IPR availableTMHMMTMhelixcoord: 1019..1041
NoneNo IPR availableTMHMMTMhelixcoord: 426..448
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 298..320
NoneNo IPR availableTMHMMTMhelixcoord: 453..475
NoneNo IPR availableTMHMMTMhelixcoord: 1162..1193
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 1079..1101
NoneNo IPR availableTMHMMTMhelixcoord: 28..50
NoneNo IPR availableTMHMMTMhelixcoord: 1262..1284
NoneNo IPR availableTMHMMTMhelixcoord: 132..154
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 527..549
IPR036640ABC transporter type 1, transmembrane domain superfamilyGENE3DG3DSA:1.20.1560.10coord: 282..611
e-value: 6.8E-21
score: 76.7
coord: 986..1339
e-value: 5.8E-44
score: 152.6
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 1018..1337
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 303..605
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 760..774
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1348..1612
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 630..860