Paired amphipathic helix protein

Overview
NamePaired amphipathic helix protein
Smed IDSMED30027169
Length (bp)4215
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Paired amphipathic helix protein (SMED30027169) t-SNE clustered cells

Violin plots show distribution of expression levels for Paired amphipathic helix protein (SMED30027169) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Paired amphipathic helix protein (SMED30027169) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Paired amphipathic helix protein (SMED30027169) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027169

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027169h1SMcG0020144 SmedASXL_009309SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30027169h1SMcG0020144 dd_Smed_v4_7034_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30027169h1SMcG0020144 dd_Smed_v4_7034_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027169h1SMcG0020144 dd_Smed_v4_7034_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Paired amphipathic helix protein vs. Ensembl Human
Match: SIN3B (SIN3 transcription regulator family member B [Source:HGNC Symbol;Acc:HGNC:19354])

HSP 1 Score: 188.348 bits (477), Expect = 1.237e-47
Identity = 171/692 (24.71%), Postives = 296/692 (42.77%), Query Frame = 1
Query: 1357 LPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNV------SDDEEDSVNGNNCHLDTSSCSRIKNNADK--------------------------------ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEK----------KQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF 3288
            L S+  Y +F+  I LFN+ +++  +L   V PF  K  E++  F S L                              V  +S A   +  S   I+                       + ++ +  +  GS YR LP+ + +P+     +  ICKEVLN +++   S S ED+ FV SKKT +EE + + EDER+E+D+V+E N A +  L  +Q +L  M  +    F  +++L  +S ++  +AI RIYGDKA +II  LK +P   VP+VL+           ++K     WR+           Q  N   K       K  L  LD        + +N++   +     +SLL+   +   E  E+     +S G       + +PS + H++ ++  D Q                        +L DAA+L+ +++KRQ    K+D+  +  L+   +  +F  ++ ++      +D++ DS  G      T+  S  K  A                                  ++ Y LF  N  WY F+RL+  L  RL  +  +A++ + +Y+ EK          ++   + A  L  K+ +++  E+YY   +++V+ LL+   D   +ED +REMF IH Y+ F+MDKL+  + +QL  +  +D+   K+  L+
Sbjct:  318 LKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFL-----------------------------GVKELSFAPPMSDRSGDGIS-----------------------REIDYASCKRIGSSYRALPKTYQQPK--CSGRTAICKEVLNDTWVSFPSWS-EDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKFRLDDSLGGTSEVIQRRAIYRIYGDKAPEIIESLKKNPVTAVPVVLK-----------RLKAKEEEWREAQ---------QGFN---KIWREQYEKAYLKSLDH-------QAVNFKQNDTKALRSKSLLNEIESVYDEHQEQ-----HSEG-------RSAPSSEPHLIFVYE-DRQ------------------------ILEDAAALISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDRDSPQGQ-----TTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPPLPPPAPHKPLDDVYSLFFANNNWYFFLRLHQTLCSRLLKIYRQAQKQLLEYRTEKEREKLLCEGRREKGSDPAMELRLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYVGFTMDKLVQNIARQLHHL-VSDDVCLKVVELY 881          

HSP 2 Score: 143.665 bits (361), Expect = 8.869e-34
Identity = 98/248 (39.52%), Postives = 126/248 (50.81%), Query Frame = 1
Query:  154 LKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVK-RKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDS 888
            + VEDAL Y+D+VK RF  +   Y  FLE+MK+FK+Q I+T  VI+ V  LFH H DLI GFN FLP GY+         I+ P N        +N  S + SQ                    + SH +    E  +    Q+P           K   P +P      EFN+A+ YVNKIK RF   P++Y+ FLEILH YQKEQ N      R  +E EV  EVA LF  ++DLL EF  FLP++
Sbjct:   39 VHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYR---------IDIPKN------GKLNIQSPLTSQ--------------------ENSHNHGDGAEDFK---QQVPY----------KEDKPQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEA 238          

HSP 3 Score: 56.225 bits (134), Expect = 5.662e-7
Identity = 73/304 (24.01%), Postives = 130/304 (42.76%), Query Frame = 1
Query:  145 SGKLKVEDALKYIDRVKGRF--NEEIYKKFLEVMKDFKAQKINT----------ETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIIN-TP--SIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLP-DSVSFGNNLSDN---------DLCSGRRSSSGYKTIPNSTQN 981
            S  ++  +A+ Y++++K RF  + EIY+ FLE++  ++ +++NT          E V   V  LF G +DL+  F  FLP      A ++    N P  +H    N  + TP  S   S+P      S++ P              VS    ++  +        G   +S+ ++     +  T  EF+    + +K++ R  K  +VY+ FL  +  +     N +LV    + +E+ Q V+       +L  +F +FL    +SF   +SD          D  S +R  S Y+ +P + Q 
Sbjct:  157 SDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLP-----EAKRSLFTGNGPCEMHSVQKNEHDKTPEHSRKRSRP------SLLRP--------------VSAPAKKKMKLR-------GTKDLSIAAVG----KYGTLQEFS----FFDKVR-RVLKSQEVYENFLRCIALF-----NQELV----SGSELLQLVSPFLGKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQ 410          
BLAST of Paired amphipathic helix protein vs. Ensembl Human
Match: SIN3A (SIN3 transcription regulator family member A [Source:HGNC Symbol;Acc:HGNC:19353])

HSP 1 Score: 182.57 bits (462), Expect = 1.132e-45
Identity = 119/396 (30.05%), Postives = 198/396 (50.00%), Query Frame = 1
Query: 1357 LPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVW---QNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            L S  AY +F+  + +FN+ +++  +L   V PF  K  E++   +NF+   E +  H + Y  + + +   M                                                     ++ +  +  GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ ++   F  +  L  +S ++  KA+QRIY DKA DII+GL+ +P+I VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I              V + P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  474 LRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESV--HLETYPKERATEGIAM----------------------------------------------------EIDYASCKRLGSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALI--IHHVKRQTGIQKEDKY 810          

HSP 2 Score: 172.555 bits (436), Expect = 1.286e-42
Identity = 113/278 (40.65%), Postives = 151/278 (54.32%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI---------------VNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  +H    + I        Q  +  S                  V+ P ++   +  S +   +    S R+     P +Q    +      +P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  120 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRS-----PPVQPHTPVTISLGTAPSL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 385          

HSP 3 Score: 108.227 bits (269), Expect = 7.505e-23
Identity = 76/240 (31.67%), Postives = 125/240 (52.08%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR--------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF 3288
            +L DAA+L+IHH+KRQ+   K+DK  +K +M   + D+   +R ++SD EE+     +    T +  +                N A +     +  Y LF  N  WY+F+RL+ +L  RL  +  +AE+ + +   E          K+      A  L  K+   ++ EDYY   +++V+ LLD   D++ +ED +REMF IH YI F+MDKLI ++V+QLQ I  +D    +++ L+
Sbjct:  786 ILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI-VSDEICVQVTDLY 1024          
BLAST of Paired amphipathic helix protein vs. Ensembl Human
Match: SIN3A (SIN3 transcription regulator family member A [Source:HGNC Symbol;Acc:HGNC:19353])

HSP 1 Score: 182.57 bits (462), Expect = 1.132e-45
Identity = 119/396 (30.05%), Postives = 198/396 (50.00%), Query Frame = 1
Query: 1357 LPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVW---QNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            L S  AY +F+  + +FN+ +++  +L   V PF  K  E++   +NF+   E +  H + Y  + + +   M                                                     ++ +  +  GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ ++   F  +  L  +S ++  KA+QRIY DKA DII+GL+ +P+I VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I              V + P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  474 LRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESV--HLETYPKERATEGIAM----------------------------------------------------EIDYASCKRLGSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALI--IHHVKRQTGIQKEDKY 810          

HSP 2 Score: 172.555 bits (436), Expect = 1.286e-42
Identity = 113/278 (40.65%), Postives = 151/278 (54.32%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI---------------VNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  +H    + I        Q  +  S                  V+ P ++   +  S +   +    S R+     P +Q    +      +P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  120 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRS-----PPVQPHTPVTISLGTAPSL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 385          

HSP 3 Score: 108.227 bits (269), Expect = 7.505e-23
Identity = 76/240 (31.67%), Postives = 125/240 (52.08%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR--------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF 3288
            +L DAA+L+IHH+KRQ+   K+DK  +K +M   + D+   +R ++SD EE+     +    T +  +                N A +     +  Y LF  N  WY+F+RL+ +L  RL  +  +AE+ + +   E          K+      A  L  K+   ++ EDYY   +++V+ LLD   D++ +ED +REMF IH YI F+MDKLI ++V+QLQ I  +D    +++ L+
Sbjct:  786 ILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI-VSDEICVQVTDLY 1024          
BLAST of Paired amphipathic helix protein vs. Ensembl Human
Match: SIN3A (SIN3 transcription regulator family member A [Source:HGNC Symbol;Acc:HGNC:19353])

HSP 1 Score: 182.57 bits (462), Expect = 1.132e-45
Identity = 119/396 (30.05%), Postives = 198/396 (50.00%), Query Frame = 1
Query: 1357 LPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVW---QNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            L S  AY +F+  + +FN+ +++  +L   V PF  K  E++   +NF+   E +  H + Y  + + +   M                                                     ++ +  +  GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ ++   F  +  L  +S ++  KA+QRIY DKA DII+GL+ +P+I VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I              V + P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  474 LRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESV--HLETYPKERATEGIAM----------------------------------------------------EIDYASCKRLGSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALI--IHHVKRQTGIQKEDKY 810          

HSP 2 Score: 172.555 bits (436), Expect = 1.286e-42
Identity = 113/278 (40.65%), Postives = 151/278 (54.32%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI---------------VNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  +H    + I        Q  +  S                  V+ P ++   +  S +   +    S R+     P +Q    +      +P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  120 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRS-----PPVQPHTPVTISLGTAPSL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 385          

HSP 3 Score: 108.227 bits (269), Expect = 7.505e-23
Identity = 76/240 (31.67%), Postives = 125/240 (52.08%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR--------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF 3288
            +L DAA+L+IHH+KRQ+   K+DK  +K +M   + D+   +R ++SD EE+     +    T +  +                N A +     +  Y LF  N  WY+F+RL+ +L  RL  +  +AE+ + +   E          K+      A  L  K+   ++ EDYY   +++V+ LLD   D++ +ED +REMF IH YI F+MDKLI ++V+QLQ I  +D    +++ L+
Sbjct:  786 ILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI-VSDEICVQVTDLY 1024          
BLAST of Paired amphipathic helix protein vs. Ensembl Human
Match: SIN3B (SIN3 transcription regulator family member B [Source:HGNC Symbol;Acc:HGNC:19354])

HSP 1 Score: 171.785 bits (434), Expect = 1.743e-42
Identity = 171/724 (23.62%), Postives = 296/724 (40.88%), Query Frame = 1
Query: 1357 LPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKE--------------------------------VLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNV------SDDEEDSVNGNNCHLDTSSCSRIKNNADK--------------------------------ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEK----------KQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF 3288
            L S+  Y +F+  I LFN+ +++  +L   V PF  K  E++  F S L                              V  +S A   +  S   I+                       + ++ +  +  GS YR LP+ + +P+     +  ICKE                                VLN +++   S S ED+ FV SKKT +EE + + EDER+E+D+V+E N A +  L  +Q +L  M  +    F  +++L  +S ++  +AI RIYGDKA +II  LK +P   VP+VL           +++K     WR+           Q  N   K       K  L  LD        + +N++   +     +SLL+   +   E  E+     +S G       + +PS + H++ ++  D Q                        +L DAA+L+ +++KRQ    K+D+  +  L+   +  +F  ++ ++      +D++ DS  G      T+  S  K  A                                  ++ Y LF  N  WY F+RL+  L  RL  +  +A++ + +Y+ EK          ++   + A  L  K+ +++  E+YY   +++V+ LL+   D   +ED +REMF IH Y+ F+MDKL+  + +QL  +  +D+   K+  L+
Sbjct:  318 LKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFL-----------------------------GVKELSFAPPMSDRSGDGIS-----------------------REIDYASCKRIGSSYRALPKTYQQPK--CSGRTAICKELDHWTLLQGSWTDDYCMSKFKNTCWIPGYSAGVLNDTWVSFPSWS-EDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKFRLDDSLGGTSEVIQRRAIYRIYGDKAPEIIESLKKNPVTAVPVVL-----------KRLKAKEEEWREAQ---------QGFN---KIWREQYEKAYLKSLDH-------QAVNFKQNDTKALRSKSLLNEIESVYDEHQEQ-----HSEG-------RSAPSSEPHLIFVYE-DRQ------------------------ILEDAAALISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDRDSPQGQ-----TTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPPLPPPAPHKPLDDVYSLFFANNNWYFFLRLHQTLCSRLLKIYRQAQKQLLEYRTEKEREKLLCEGRREKGSDPAMELRLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYVGFTMDKLVQNIARQLHHL-VSDDVCLKVVELY 913          

HSP 2 Score: 144.05 bits (362), Expect = 7.174e-34
Identity = 98/248 (39.52%), Postives = 126/248 (50.81%), Query Frame = 1
Query:  154 LKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVK-RKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDS 888
            + VEDAL Y+D+VK RF  +   Y  FLE+MK+FK+Q I+T  VI+ V  LFH H DLI GFN FLP GY+         I+ P N        +N  S + SQ                    + SH +    E  +    Q+P           K   P +P      EFN+A+ YVNKIK RF   P++Y+ FLEILH YQKEQ N      R  +E EV  EVA LF  ++DLL EF  FLP++
Sbjct:   39 VHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYR---------IDIPKN------GKLNIQSPLTSQ--------------------ENSHNHGDGAEDFK---QQVPY----------KEDKPQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEA 238          

HSP 3 Score: 56.225 bits (134), Expect = 5.511e-7
Identity = 73/304 (24.01%), Postives = 130/304 (42.76%), Query Frame = 1
Query:  145 SGKLKVEDALKYIDRVKGRF--NEEIYKKFLEVMKDFKAQKINT----------ETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIIN-TP--SIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLP-DSVSFGNNLSDN---------DLCSGRRSSSGYKTIPNSTQN 981
            S  ++  +A+ Y++++K RF  + EIY+ FLE++  ++ +++NT          E V   V  LF G +DL+  F  FLP      A ++    N P  +H    N  + TP  S   S+P      S++ P              VS    ++  +        G   +S+ ++     +  T  EF+    + +K++ R  K  +VY+ FL  +  +     N +LV    + +E+ Q V+       +L  +F +FL    +SF   +SD          D  S +R  S Y+ +P + Q 
Sbjct:  157 SDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLP-----EAKRSLFTGNGPCEMHSVQKNEHDKTPEHSRKRSRP------SLLRP--------------VSAPAKKKMKLR-------GTKDLSIAAVG----KYGTLQEFS----FFDKVR-RVLKSQEVYENFLRCIALF-----NQELV----SGSELLQLVSPFLGKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQ 410          
BLAST of Paired amphipathic helix protein vs. Ensembl Celegans
Match: sin-3 (Paired amphipathic helix protein sin-3 [Source:UniProtKB/Swiss-Prot;Acc:A5JYW9])

HSP 1 Score: 76.6406 bits (187), Expect = 1.302e-13
Identity = 53/179 (29.61%), Postives = 90/179 (50.28%), Query Frame = 1
Query: 1720 KNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRD 2256
            KNVE + +   G  YR + +      S     +   K VLN ++    S S+EDT     KK+  EE  FK EDERYE+D++++ N+  + +L+      + M+ +    F  ++ L  SS     + + +++ + A D I+  + +P + +  +LE LKEKD+ W    +   R WRD
Sbjct:  791 KNVEAATVCTLGPSYRFMKDTKATDCSGRVELDDDLKGVLNDTWTSIPSWSSEDTGSQAIKKSNLEEFHFKTEDERYELDIIVDSNRTVIEQLSKTLRDYEAMSDEDKKSFKLDKWLNASSRSTTIRVLAKVFTNSAQDFIDAAQKNPLVGLRRILESLKEKDLLWSRFQQDTNRTWRD 969          

HSP 2 Score: 72.7886 bits (177), Expect = 2.115e-12
Identity = 33/75 (44.00%), Postives = 52/75 (69.33%), Query Frame = 1
Query:  148 GKLKVEDALKYIDRVKGRFNEEI--YKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMS 366
            G  +V++AL Y+  +K  F+ ++  Y +FLE+MKDF+AQ+I T  VI+ V  L +   +L+ GFNTFLP GY+++
Sbjct:  282 GPPRVDEALAYLRVIKSTFSSDVPVYHRFLEIMKDFRAQRIETPDVIEQVAELLYDSPELVLGFNTFLPTGYRIT 356          
BLAST of Paired amphipathic helix protein vs. Ensembl Celegans
Match: sin-3 (Paired amphipathic helix protein sin-3 [Source:UniProtKB/Swiss-Prot;Acc:A5JYW9])

HSP 1 Score: 76.6406 bits (187), Expect = 1.314e-13
Identity = 53/179 (29.61%), Postives = 90/179 (50.28%), Query Frame = 1
Query: 1720 KNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRD 2256
            KNVE + +   G  YR + +      S     +   K VLN ++    S S+EDT     KK+  EE  FK EDERYE+D++++ N+  + +L+      + M+ +    F  ++ L  SS     + + +++ + A D I+  + +P + +  +LE LKEKD+ W    +   R WRD
Sbjct:  791 KNVEAATVCTLGPSYRFMKDTKATDCSGRVELDDDLKGVLNDTWTSIPSWSSEDTGSQAIKKSNLEEFHFKTEDERYELDIIVDSNRTVIEQLSKTLRDYEAMSDEDKKSFKLDKWLNASSRSTTIRVLAKVFTNSAQDFIDAAQKNPLVGLRRILESLKEKDLLWSRFQQDTNRTWRD 969          

HSP 2 Score: 72.7886 bits (177), Expect = 2.115e-12
Identity = 33/75 (44.00%), Postives = 52/75 (69.33%), Query Frame = 1
Query:  148 GKLKVEDALKYIDRVKGRFNEEI--YKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMS 366
            G  +V++AL Y+  +K  F+ ++  Y +FLE+MKDF+AQ+I T  VI+ V  L +   +L+ GFNTFLP GY+++
Sbjct:  282 GPPRVDEALAYLRVIKSTFSSDVPVYHRFLEIMKDFRAQRIETPDVIEQVAELLYDSPELVLGFNTFLPTGYRIT 356          
BLAST of Paired amphipathic helix protein vs. Ensembl Fly
Match: Sin3A (gene:FBgn0022764 transcript:FBtr0339651)

HSP 1 Score: 197.208 bits (500), Expect = 2.453e-50
Identity = 160/594 (26.94%), Postives = 271/594 (45.62%), Query Frame = 1
Query: 1042 NVPKIDSIDESIEKNQIDYFRPA-STSVPPVSIASVSQTPKRNLVQDLNTDRRIS--TSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEED 2811
             +P +      I  N +D   P  S + PP+      Q    +  +    D  +    S  PP KR +     +S  +A      S   +S    FD +         L S   Y +F+  + LFN+ I++  +L   V PF  K  ++ + F   L             S + +  + D   +       +T +     SN S +             +       + ++V+LS  +  G+ Y  LP+  T P+  +  +  +C+EVLN  ++   + ++ED+ FV S+KT FEE++++ EDER+E+D+V+E+N A +  L ++Q ++  M+T++++ F+ +++L  +S  +  +AI RIYGDK+ +II G+K +P + VPIVL+RLK K+ EW+E  K F + WR+Q + Y LKSLD+QAINF+  D    R K+L  +                        IE+L   +   + +  E +G                      H++L               P++ K  L D          AA+L+IHH+KRQ+   K +K  +K ++R  + D+F   R  +SDDE D
Sbjct:  835 GIPSVIGSMPHISDNSLDRSSPGISYATPPLPSGPHGQHNSGSATRRPGDDSLVGHYASGAPPAKRPKPYCRDVSFSEAS-----SKCTISDAAFFDKVRKA------LRSPEVYDNFLRCLTLFNQEIVSKTELLGLVSPFLMKFPDLLRWFTDFLGP----------PSGQPAGGLIDGMPL------AATQRQGGGSSNSSHD-----------RGTSHQSAAEYVQDVDLSSCKRLGASYCALPQS-TVPKKCS-GRTALCREVLNDKWVSFPTWASEDSTFVTSRKTQFEETIYRTEDERFELDLVIEVNSATIRVLENLQKKMSRMSTEELSKFHLDDHLGGTSQTIHQRAIHRIYGDKSGEIITGMKKNPFVAVPIVLKRLKVKEEEWREAQKTFNKQWREQNEKYYLKSLDHQAINFKPNDMKALRSKSLFNE------------------------IETLYDERHDQEDDAMEPFGP---------------------HLVL---------------PYKDKTILDD----------AANLLIHHVKRQTGIQKQEKQKIKQIIRQFVPDLFFAPRQPLSDDERD 1318          

HSP 2 Score: 100.908 bits (250), Expect = 6.479e-21
Identity = 52/88 (59.09%), Postives = 61/88 (69.32%), Query Frame = 1
Query:  640 QSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQ---KNPDLVKRKQ-TETEVSQEVAKLFDNEQDLLQEFSTFLPDSV 891
            Q   P EFNHA+ YVNKIKNRFQ QP  YK+FLEILH YQ+EQ   K   L + K  TE EV  +VAKLF  ++DLL+EF  FLPD+ 
Sbjct:  562 QQNQPVEFNHAITYVNKIKNRFQNQPAKYKKFLEILHDYQREQKVMKEGSLNQGKMLTEQEVYTQVAKLFGQDEDLLREFGQFLPDAT 649          

HSP 3 Score: 97.8265 bits (242), Expect = 6.560e-20
Identity = 48/118 (40.68%), Postives = 76/118 (64.41%), Query Frame = 1
Query: 2890 YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKE-VADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQ 3240
            Y LF  N  WY+F+RL+ +L DRL  +  +A +L++  +E  + N +E  A  L  K   ++  EDYY   ++++K++LD   D+  FED MREMFGI+ YI F++DK+++  V+QLQ
Sbjct: 1495 YTLFFANNNWYLFLRLHAILCDRLHVMYERA-RLLAIEEERCRVNRRESTATALRLKPKPEIQVEDYYPTFLDMLKNVLDGNMDSNTFEDTMREMFGIYAYISFTLDKVVSNAVRQLQ 1611          

HSP 4 Score: 88.1965 bits (217), Expect = 5.054e-17
Identity = 45/103 (43.69%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQ-----TPPIINYPDNIH-PTSINIIN 435
            +LKVEDAL Y+D+VK ++ ++  IY  FL++MK+FK+  I+T  VI+ V TLF GH +LI GFN FLPPGY++  +      + P+++ P     PTS   ++
Sbjct:  269 RLKVEDALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIYGFNMFLPPGYKIEIHSDALGCSVPVVSMPSPPGAPTSTGTVH 371          
BLAST of Paired amphipathic helix protein vs. Ensembl Fly
Match: Sin3A (gene:FBgn0022764 transcript:FBtr0087889)

HSP 1 Score: 196.823 bits (499), Expect = 3.094e-50
Identity = 160/594 (26.94%), Postives = 271/594 (45.62%), Query Frame = 1
Query: 1042 NVPKIDSIDESIEKNQIDYFRPA-STSVPPVSIASVSQTPKRNLVQDLNTDRRIS--TSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEED 2811
             +P +      I  N +D   P  S + PP+      Q    +  +    D  +    S  PP KR +     +S  +A      S   +S    FD +         L S   Y +F+  + LFN+ I++  +L   V PF  K  ++ + F   L             S + +  + D   +       +T +     SN S +             +       + ++V+LS  +  G+ Y  LP+  T P+  +  +  +C+EVLN  ++   + ++ED+ FV S+KT FEE++++ EDER+E+D+V+E+N A +  L ++Q ++  M+T++++ F+ +++L  +S  +  +AI RIYGDK+ +II G+K +P + VPIVL+RLK K+ EW+E  K F + WR+Q + Y LKSLD+QAINF+  D    R K+L  +                        IE+L   +   + +  E +G                      H++L               P++ K  L D          AA+L+IHH+KRQ+   K +K  +K ++R  + D+F   R  +SDDE D
Sbjct:  835 GIPSVIGSMPHISDNSLDRSSPGISYATPPLPSGPHGQHNSGSATRRPGDDSLVGHYASGAPPAKRPKPYCRDVSFSEAS-----SKCTISDAAFFDKVRKA------LRSPEVYDNFLRCLTLFNQEIVSKTELLGLVSPFLMKFPDLLRWFTDFLGP----------PSGQPAGGLIDGMPL------AATQRQGGGSSNSSHD-----------RGTSHQSAAEYVQDVDLSSCKRLGASYCALPQS-TVPKKCS-GRTALCREVLNDKWVSFPTWASEDSTFVTSRKTQFEETIYRTEDERFELDLVIEVNSATIRVLENLQKKMSRMSTEELSKFHLDDHLGGTSQTIHQRAIHRIYGDKSGEIITGMKKNPFVAVPIVLKRLKVKEEEWREAQKTFNKQWREQNEKYYLKSLDHQAINFKPNDMKALRSKSLFNE------------------------IETLYDERHDQEDDAMEPFGP---------------------HLVL---------------PYKDKTILDD----------AANLLIHHVKRQTGIQKQEKQKIKQIIRQFVPDLFFAPRQPLSDDERD 1318          

HSP 2 Score: 100.908 bits (250), Expect = 6.879e-21
Identity = 52/88 (59.09%), Postives = 61/88 (69.32%), Query Frame = 1
Query:  640 QSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQ---KNPDLVKRKQ-TETEVSQEVAKLFDNEQDLLQEFSTFLPDSV 891
            Q   P EFNHA+ YVNKIKNRFQ QP  YK+FLEILH YQ+EQ   K   L + K  TE EV  +VAKLF  ++DLL+EF  FLPD+ 
Sbjct:  562 QQNQPVEFNHAITYVNKIKNRFQNQPAKYKKFLEILHDYQREQKVMKEGSLNQGKMLTEQEVYTQVAKLFGQDEDLLREFGQFLPDAT 649          

HSP 3 Score: 97.4413 bits (241), Expect = 6.790e-20
Identity = 48/118 (40.68%), Postives = 76/118 (64.41%), Query Frame = 1
Query: 2890 YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKE-VADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQ 3240
            Y LF  N  WY+F+RL+ +L DRL  +  +A +L++  +E  + N +E  A  L  K   ++  EDYY   ++++K++LD   D+  FED MREMFGI+ YI F++DK+++  V+QLQ
Sbjct: 1495 YTLFFANNNWYLFLRLHAILCDRLHVMYERA-RLLAIEEERCRVNRRESTATALRLKPKPEIQVEDYYPTFLDMLKNVLDGNMDSNTFEDTMREMFGIYAYISFTLDKVVSNAVRQLQ 1611          

HSP 4 Score: 88.1965 bits (217), Expect = 5.365e-17
Identity = 45/103 (43.69%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQ-----TPPIINYPDNIH-PTSINIIN 435
            +LKVEDAL Y+D+VK ++ ++  IY  FL++MK+FK+  I+T  VI+ V TLF GH +LI GFN FLPPGY++  +      + P+++ P     PTS   ++
Sbjct:  269 RLKVEDALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIYGFNMFLPPGYKIEIHSDALGCSVPVVSMPSPPGAPTSTGTVH 371          
BLAST of Paired amphipathic helix protein vs. Ensembl Fly
Match: Sin3A (gene:FBgn0022764 transcript:FBtr0347014)

HSP 1 Score: 191.43 bits (485), Expect = 1.273e-48
Identity = 160/594 (26.94%), Postives = 270/594 (45.45%), Query Frame = 1
Query: 1042 NVPKIDSIDESIEKNQIDYFRPA-STSVPPVSIASVSQTPKRNLVQDLNTDRRIS--TSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEED 2811
             +P +      I  N +D   P  S + PP+      Q    +  +    D  +    S  PP KR +     +S  +A      S   +S    FD +         L S   Y +F+  + LFN+ I++  +L   V PF  K  ++ + F   L             S + +  + D   +       +T +     SN S +             +       + ++V+LS  +  G+ Y  LP+  T P+  +  +  +C+EVLN  ++   + ++ED+ FV S+KT FEE++++ EDER+E+D+V+E+N A +  L ++Q ++  M+T++++ F+ +++L  +S  +  +AI RIYGDK+ +II G+K +P + VPIVL+RLK K+ EW+E  K F + WR+Q + Y LKSLD+QAINF+  D    R K+L  +                        IE+L   +   + +  E +G                      H++L +       K+ILD             D  +LL       IHH+KRQ+   K +K  +K ++R  + D+F   R  +SDDE D
Sbjct:  835 GIPSVIGSMPHISDNSLDRSSPGISYATPPLPSGPHGQHNSGSATRRPGDDSLVGHYASGAPPAKRPKPYCRDVSFSEAS-----SKCTISDAAFFDKVRKA------LRSPEVYDNFLRCLTLFNQEIVSKTELLGLVSPFLMKFPDLLRWFTDFLGP----------PSGQPAGGLIDGMPL------AATQRQGGGSSNSSHD-----------RGTSHQSAAEYVQDVDLSSCKRLGASYCALPQS-TVPKKCS-GRTALCREVLNDKWVSFPTWASEDSTFVTSRKTQFEETIYRTEDERFELDLVIEVNSATIRVLENLQKKMSRMSTEELSKFHLDDHLGGTSQTIHQRAIHRIYGDKSGEIITGMKKNPFVAVPIVLKRLKVKEEEWREAQKTFNKQWREQNEKYYLKSLDHQAINFKPNDMKALRSKSLFNE------------------------IETLYDERHDQEDDAMEPFGP---------------------HLVLPY-----KDKTILD-------------DAANLL-------IHHVKRQTGIQKQEKQKIKQIIRQFVPDLFFAPRQPLSDDERD 1318          

HSP 2 Score: 100.908 bits (250), Expect = 7.042e-21
Identity = 52/88 (59.09%), Postives = 61/88 (69.32%), Query Frame = 1
Query:  640 QSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQ---KNPDLVKRKQ-TETEVSQEVAKLFDNEQDLLQEFSTFLPDSV 891
            Q   P EFNHA+ YVNKIKNRFQ QP  YK+FLEILH YQ+EQ   K   L + K  TE EV  +VAKLF  ++DLL+EF  FLPD+ 
Sbjct:  562 QQNQPVEFNHAITYVNKIKNRFQNQPAKYKKFLEILHDYQREQKVMKEGSLNQGKMLTEQEVYTQVAKLFGQDEDLLREFGQFLPDAT 649          

HSP 3 Score: 97.8265 bits (242), Expect = 6.550e-20
Identity = 48/118 (40.68%), Postives = 76/118 (64.41%), Query Frame = 1
Query: 2890 YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKE-VADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQ 3240
            Y LF  N  WY+F+RL+ +L DRL  +  +A +L++  +E  + N +E  A  L  K   ++  EDYY   ++++K++LD   D+  FED MREMFGI+ YI F++DK+++  V+QLQ
Sbjct: 1495 YTLFFANNNWYLFLRLHAILCDRLHVMYERA-RLLAIEEERCRVNRRESTATALRLKPKPEIQVEDYYPTFLDMLKNVLDGNMDSNTFEDTMREMFGIYAYISFTLDKVVSNAVRQLQ 1611          

HSP 4 Score: 88.1965 bits (217), Expect = 5.579e-17
Identity = 45/103 (43.69%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQ-----TPPIINYPDNIH-PTSINIIN 435
            +LKVEDAL Y+D+VK ++ ++  IY  FL++MK+FK+  I+T  VI+ V TLF GH +LI GFN FLPPGY++  +      + P+++ P     PTS   ++
Sbjct:  269 RLKVEDALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIYGFNMFLPPGYKIEIHSDALGCSVPVVSMPSPPGAPTSTGTVH 371          
BLAST of Paired amphipathic helix protein vs. Ensembl Fly
Match: Sin3A (gene:FBgn0022764 transcript:FBtr0087888)

HSP 1 Score: 190.274 bits (482), Expect = 3.315e-48
Identity = 128/443 (28.89%), Postives = 221/443 (49.89%), Query Frame = 1
Query: 1042 NVPKIDSIDESIEKNQIDYFRPA-STSVPPVSIASVSQTPKRNLVQDLNTDRRIS--TSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLD 2358
             +P +      I  N +D   P  S + PP+      Q    +  +    D  +    S  PP KR +     +S  +A      S   +S    FD +         L S   Y +F+  + LFN+ I++  +L   V PF  K  ++ + F   L             S + +  + D   +       +T +     SN S +             +       + ++V+LS  +  G+ Y  LP+  T P+  +  +  +C+EVLN  ++   + ++ED+ FV S+KT FEE++++ EDER+E+D+V+E+N A +  L ++Q ++  M+T++++ F+ +++L  +S  +  +AI RIYGDK+ +II G+K +P + VPIVL+RLK K+ EW+E  K F + WR+Q + Y LKSLD+QAINF+  D    R K+L  +++
Sbjct:  835 GIPSVIGSMPHISDNSLDRSSPGISYATPPLPSGPHGQHNSGSATRRPGDDSLVGHYASGAPPAKRPKPYCRDVSFSEAS-----SKCTISDAAFFDKVRKA------LRSPEVYDNFLRCLTLFNQEIVSKTELLGLVSPFLMKFPDLLRWFTDFLGP----------PSGQPAGGLIDGMPL------AATQRQGGGSSNSSHD-----------RGTSHQSAAEYVQDVDLSSCKRLGASYCALPQS-TVPKKCS-GRTALCREVLNDKWVSFPTWASEDSTFVTSRKTQFEETIYRTEDERFELDLVIEVNSATIRVLENLQKKMSRMSTEELSKFHLDDHLGGTSQTIHQRAIHRIYGDKSGEIITGMKKNPFVAVPIVLKRLKVKEEEWREAQKTFNKQWREQNEKYYLKSLDHQAINFKPNDMKALRSKSLFNEIE 1237          

HSP 2 Score: 100.523 bits (249), Expect = 8.114e-21
Identity = 52/88 (59.09%), Postives = 61/88 (69.32%), Query Frame = 1
Query:  640 QSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQ---KNPDLVKRKQ-TETEVSQEVAKLFDNEQDLLQEFSTFLPDSV 891
            Q   P EFNHA+ YVNKIKNRFQ QP  YK+FLEILH YQ+EQ   K   L + K  TE EV  +VAKLF  ++DLL+EF  FLPD+ 
Sbjct:  562 QQNQPVEFNHAITYVNKIKNRFQNQPAKYKKFLEILHDYQREQKVMKEGSLNQGKMLTEQEVYTQVAKLFGQDEDLLREFGQFLPDAT 649          

HSP 3 Score: 97.4413 bits (241), Expect = 7.548e-20
Identity = 48/118 (40.68%), Postives = 76/118 (64.41%), Query Frame = 1
Query: 2890 YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKE-VADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQ 3240
            Y LF  N  WY+F+RL+ +L DRL  +  +A +L++  +E  + N +E  A  L  K   ++  EDYY   ++++K++LD   D+  FED MREMFGI+ YI F++DK+++  V+QLQ
Sbjct: 1495 YTLFFANNNWYLFLRLHAILCDRLHVMYERA-RLLAIEEERCRVNRRESTATALRLKPKPEIQVEDYYPTFLDMLKNVLDGNMDSNTFEDTMREMFGIYAYISFTLDKVVSNAVRQLQ 1611          

HSP 4 Score: 88.1965 bits (217), Expect = 5.207e-17
Identity = 45/103 (43.69%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQ-----TPPIINYPDNIH-PTSINIIN 435
            +LKVEDAL Y+D+VK ++ ++  IY  FL++MK+FK+  I+T  VI+ V TLF GH +LI GFN FLPPGY++  +      + P+++ P     PTS   ++
Sbjct:  269 RLKVEDALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIYGFNMFLPPGYKIEIHSDALGCSVPVVSMPSPPGAPTSTGTVH 371          
BLAST of Paired amphipathic helix protein vs. Ensembl Fly
Match: Sin3A (gene:FBgn0022764 transcript:FBtr0303566)

HSP 1 Score: 190.274 bits (482), Expect = 3.315e-48
Identity = 128/443 (28.89%), Postives = 221/443 (49.89%), Query Frame = 1
Query: 1042 NVPKIDSIDESIEKNQIDYFRPA-STSVPPVSIASVSQTPKRNLVQDLNTDRRIS--TSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLD 2358
             +P +      I  N +D   P  S + PP+      Q    +  +    D  +    S  PP KR +     +S  +A      S   +S    FD +         L S   Y +F+  + LFN+ I++  +L   V PF  K  ++ + F   L             S + +  + D   +       +T +     SN S +             +       + ++V+LS  +  G+ Y  LP+  T P+  +  +  +C+EVLN  ++   + ++ED+ FV S+KT FEE++++ EDER+E+D+V+E+N A +  L ++Q ++  M+T++++ F+ +++L  +S  +  +AI RIYGDK+ +II G+K +P + VPIVL+RLK K+ EW+E  K F + WR+Q + Y LKSLD+QAINF+  D    R K+L  +++
Sbjct:  835 GIPSVIGSMPHISDNSLDRSSPGISYATPPLPSGPHGQHNSGSATRRPGDDSLVGHYASGAPPAKRPKPYCRDVSFSEAS-----SKCTISDAAFFDKVRKA------LRSPEVYDNFLRCLTLFNQEIVSKTELLGLVSPFLMKFPDLLRWFTDFLGP----------PSGQPAGGLIDGMPL------AATQRQGGGSSNSSHD-----------RGTSHQSAAEYVQDVDLSSCKRLGASYCALPQS-TVPKKCS-GRTALCREVLNDKWVSFPTWASEDSTFVTSRKTQFEETIYRTEDERFELDLVIEVNSATIRVLENLQKKMSRMSTEELSKFHLDDHLGGTSQTIHQRAIHRIYGDKSGEIITGMKKNPFVAVPIVLKRLKVKEEEWREAQKTFNKQWREQNEKYYLKSLDHQAINFKPNDMKALRSKSLFNEIE 1237          

HSP 2 Score: 100.523 bits (249), Expect = 8.114e-21
Identity = 52/88 (59.09%), Postives = 61/88 (69.32%), Query Frame = 1
Query:  640 QSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQ---KNPDLVKRKQ-TETEVSQEVAKLFDNEQDLLQEFSTFLPDSV 891
            Q   P EFNHA+ YVNKIKNRFQ QP  YK+FLEILH YQ+EQ   K   L + K  TE EV  +VAKLF  ++DLL+EF  FLPD+ 
Sbjct:  562 QQNQPVEFNHAITYVNKIKNRFQNQPAKYKKFLEILHDYQREQKVMKEGSLNQGKMLTEQEVYTQVAKLFGQDEDLLREFGQFLPDAT 649          

HSP 3 Score: 97.4413 bits (241), Expect = 7.548e-20
Identity = 48/118 (40.68%), Postives = 76/118 (64.41%), Query Frame = 1
Query: 2890 YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKE-VADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQ 3240
            Y LF  N  WY+F+RL+ +L DRL  +  +A +L++  +E  + N +E  A  L  K   ++  EDYY   ++++K++LD   D+  FED MREMFGI+ YI F++DK+++  V+QLQ
Sbjct: 1495 YTLFFANNNWYLFLRLHAILCDRLHVMYERA-RLLAIEEERCRVNRRESTATALRLKPKPEIQVEDYYPTFLDMLKNVLDGNMDSNTFEDTMREMFGIYAYISFTLDKVVSNAVRQLQ 1611          

HSP 4 Score: 88.1965 bits (217), Expect = 5.207e-17
Identity = 45/103 (43.69%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQ-----TPPIINYPDNIH-PTSINIIN 435
            +LKVEDAL Y+D+VK ++ ++  IY  FL++MK+FK+  I+T  VI+ V TLF GH +LI GFN FLPPGY++  +      + P+++ P     PTS   ++
Sbjct:  269 RLKVEDALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIYGFNMFLPPGYKIEIHSDALGCSVPVVSMPSPPGAPTSTGTVH 371          
BLAST of Paired amphipathic helix protein vs. Ensembl Zebrafish
Match: sin3ab (SIN3 transcription regulator family member Ab [Source:ZFIN;Acc:ZDB-GENE-030131-2066])

HSP 1 Score: 276.944 bits (707), Expect = 1.285e-75
Identity = 232/773 (30.01%), Postives = 363/773 (46.96%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDER-------FNVSDDEEDSVNGNNCHLDTSSC------SRIKNNADK----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF-KQCSKHFYGQDERENKLKINITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTKCSGHMCITLLDVSPGNSSGSESQEDASKIKEEPSSSTPAIPHVSKSVISESNLPPVMSWKHYIERYVTCSEKLGFSDGLHNIGLNKRISV-PVFLLRSLRKSINNISFIKGRNDESLNEEQTDSLIKRSAQATD--WHSSIVQL----ICYVFDGADENFLYR 3963
            GS YR LP+ F +PR     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q R+  M+ ++   F  +  +  SS ++  KAIQRIYGDKA DII+GLK +PA+ VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R KTLL +                        IE+L         E+ E+            E N  +   P  HM L++  DSQ                        +L DAA+L+IHH+KRQS   KDDK  +K ++   + D+    R           ++ E   +G   H  T+S       S    +  K    ++ Y LF  N  WY+F+RL+++L  RL  +  +AE+ + +   E          K++     A  L  K+   +  EDYY   + +V++LLD   +T+ +ED++REMF IH YI F+MDKLI ++V+QLQ I  +D+   +++ L+  +C+          NK       TG    T++  +   E +Y + + +L    +E    +LF +   +K +  + + LLD    NS G    E                                  W  Y+ERY+  S          +  L + +S  PVFL R+LR+        K +  + +   +     K+S++  D      + +L    + YVF    E+++YR
Sbjct:  551 GSSYRALPKSFQQPRCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAVQKRISRMSAEEQAKFRLDNTIGGSSEVIHRKAIQRIYGDKAPDIIDGLKTNPAVSVPIVLKRLKIKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGINFKQNDTKVFRSKTLLNE------------------------IETLYD-------ERQEQ----------ASEDNAAVPSGP--HMTLMYE-DSQ------------------------ILEDAAALIIHHVKRQSGIHKDDKYKIKQIIYHFIPDMLFARRGELSDVEEEDEEETEPDEDGTKKHNGTTSSKSKLLFSHTAASQQKLSSCDDAYNLFFVNNNWYIFLRLHYILCSRLLRIYGQAEKQIEEDTREREWERNVLGLKREKNDSPAIQLRLKEPMDIEVEDYYSAFLEMVRNLLDGNMETSQYEDQLREMFTIHAYIAFTMDKLIQSIVRQLQHI-VSDDICVQVTDLYLSECA----------NK------ATGGSLSTQSSRS-NAETSYQRKSEQLMS--DENCFKLLFQK---SKGTVQLAVELLDTEEENSDGPVDTE---------------------------------RWPDYVERYLNTSSA--------SPELREHLSQKPVFLPRNLRR------IRKCQRGQEMQMREAKETAKKSSEGGDDSKMECMFKLNSYKMVYVFKS--EDYMYR 1180          

HSP 2 Score: 185.652 bits (470), Expect = 8.173e-47
Identity = 132/324 (40.74%), Postives = 177/324 (54.63%), Query Frame = 1
Query:   37 LQPMSNPGTDHSHF-PSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIH---PTSINIINTP-------------------SIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +QP+   G  HSH  P+   T+  G Q +          +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  IH   P  I++ N P                    ++ SQP    + + ++ P++    +  S  N SI    S R+     P +QS   I S  + S  + Q+  P EFNHA+ YVNKIKNRFQ QP+VYK FLEILH YQKEQ+N         P L     TE +V  +VA+LF N++DLL EF  FLPD+ S
Sbjct:   89 VQPV---GQAHSHATPAPAPTL--GQQQFQ---------RLKVEDALSYLDQVKLQFGNQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQIHHITPHGISVQNIPITQPAPHQPQPAPPTSTAALVIPSQP----TPAKISKPMQSPALTPTSQPNPSIPSYASPRS-----PSVQSHTPISSSTAGSTPL-QNNQPVEFNHAINYVNKIKNRFQGQPEVYKSFLEILHTYQKEQRNAKEAGGNYTPTL-----TEQQVYAQVAQLFKNQEDLLSEFGQFLPDANS 382          
BLAST of Paired amphipathic helix protein vs. Ensembl Zebrafish
Match: sin3ab (SIN3 transcription regulator family member Ab [Source:ZFIN;Acc:ZDB-GENE-030131-2066])

HSP 1 Score: 276.944 bits (707), Expect = 1.285e-75
Identity = 232/773 (30.01%), Postives = 363/773 (46.96%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDER-------FNVSDDEEDSVNGNNCHLDTSSC------SRIKNNADK----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF-KQCSKHFYGQDERENKLKINITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTKCSGHMCITLLDVSPGNSSGSESQEDASKIKEEPSSSTPAIPHVSKSVISESNLPPVMSWKHYIERYVTCSEKLGFSDGLHNIGLNKRISV-PVFLLRSLRKSINNISFIKGRNDESLNEEQTDSLIKRSAQATD--WHSSIVQL----ICYVFDGADENFLYR 3963
            GS YR LP+ F +PR     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q R+  M+ ++   F  +  +  SS ++  KAIQRIYGDKA DII+GLK +PA+ VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R KTLL +                        IE+L         E+ E+            E N  +   P  HM L++  DSQ                        +L DAA+L+IHH+KRQS   KDDK  +K ++   + D+    R           ++ E   +G   H  T+S       S    +  K    ++ Y LF  N  WY+F+RL+++L  RL  +  +AE+ + +   E          K++     A  L  K+   +  EDYY   + +V++LLD   +T+ +ED++REMF IH YI F+MDKLI ++V+QLQ I  +D+   +++ L+  +C+          NK       TG    T++  +   E +Y + + +L    +E    +LF +   +K +  + + LLD    NS G    E                                  W  Y+ERY+  S          +  L + +S  PVFL R+LR+        K +  + +   +     K+S++  D      + +L    + YVF    E+++YR
Sbjct:  551 GSSYRALPKSFQQPRCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAVQKRISRMSAEEQAKFRLDNTIGGSSEVIHRKAIQRIYGDKAPDIIDGLKTNPAVSVPIVLKRLKIKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGINFKQNDTKVFRSKTLLNE------------------------IETLYD-------ERQEQ----------ASEDNAAVPSGP--HMTLMYE-DSQ------------------------ILEDAAALIIHHVKRQSGIHKDDKYKIKQIIYHFIPDMLFARRGELSDVEEEDEEETEPDEDGTKKHNGTTSSKSKLLFSHTAASQQKLSSCDDAYNLFFVNNNWYIFLRLHYILCSRLLRIYGQAEKQIEEDTREREWERNVLGLKREKNDSPAIQLRLKEPMDIEVEDYYSAFLEMVRNLLDGNMETSQYEDQLREMFTIHAYIAFTMDKLIQSIVRQLQHI-VSDDICVQVTDLYLSECA----------NK------ATGGSLSTQSSRS-NAETSYQRKSEQLMS--DENCFKLLFQK---SKGTVQLAVELLDTEEENSDGPVDTE---------------------------------RWPDYVERYLNTSSA--------SPELREHLSQKPVFLPRNLRR------IRKCQRGQEMQMREAKETAKKSSEGGDDSKMECMFKLNSYKMVYVFKS--EDYMYR 1180          

HSP 2 Score: 185.652 bits (470), Expect = 8.173e-47
Identity = 132/324 (40.74%), Postives = 177/324 (54.63%), Query Frame = 1
Query:   37 LQPMSNPGTDHSHF-PSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIH---PTSINIINTP-------------------SIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +QP+   G  HSH  P+   T+  G Q +          +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  IH   P  I++ N P                    ++ SQP    + + ++ P++    +  S  N SI    S R+     P +QS   I S  + S  + Q+  P EFNHA+ YVNKIKNRFQ QP+VYK FLEILH YQKEQ+N         P L     TE +V  +VA+LF N++DLL EF  FLPD+ S
Sbjct:   89 VQPV---GQAHSHATPAPAPTL--GQQQFQ---------RLKVEDALSYLDQVKLQFGNQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQIHHITPHGISVQNIPITQPAPHQPQPAPPTSTAALVIPSQP----TPAKISKPMQSPALTPTSQPNPSIPSYASPRS-----PSVQSHTPISSSTAGSTPL-QNNQPVEFNHAINYVNKIKNRFQGQPEVYKSFLEILHTYQKEQRNAKEAGGNYTPTL-----TEQQVYAQVAQLFKNQEDLLSEFGQFLPDANS 382          
BLAST of Paired amphipathic helix protein vs. Ensembl Zebrafish
Match: sin3aa (SIN3 transcription regulator family member Aa [Source:ZFIN;Acc:ZDB-GENE-070620-3])

HSP 1 Score: 185.652 bits (470), Expect = 8.345e-47
Identity = 125/308 (40.58%), Postives = 169/308 (54.87%), Query Frame = 1
Query:   67 HSHFPSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIH---PTSINI-------------------INTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQ----TETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            H+H P+   + T G Q +          +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  IH   P  I++                    N P++  + P      +    P++  + +  S  N SI    S R+     P +Q  N+ +S   I+P + Q+  P EFNHA+ YVNKIKNRFQ QP++YK FLEILH YQKEQ+N            TE EV  EVA+LF N++DLL EF  FLPD+ S
Sbjct:  102 HAHPPTPSAS-TQGQQQFQ---------RLKVEDALSYLDQVKLQFGNQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQIHHITPHGISVQNIPIVPPPPPSQQQNQITTNPPNLATTPPAQPAPKT---KPLQSPVLTPSSQPNPSIPPYASPRS-----PPLQP-NTPVSSMPIAPPL-QNNQPVEFNHAINYVNKIKNRFQGQPNIYKSFLEILHKYQKEQRNAKEAGGSYTPVLTEQEVYAEVAQLFKNQEDLLSEFGQFLPDANS 388          

HSP 2 Score: 179.489 bits (454), Expect = 5.274e-45
Identity = 96/205 (46.83%), Postives = 134/205 (65.37%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI 2364
            GS YR LP+ +  P+     +  ICKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L   Q +L  M+ ++   F  +  L   S I+  KAIQRIYGDKA DII+GLK +PA  VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R KTLL +++ I
Sbjct:  558 GSSYRALPKSYQLPKCTG--RTAICKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHMYRCEDERFELDVVLETNLATIRVLETTQKKLSRMSAEEQAKFRLDNTLGGFSEIIHRKAIQRIYGDKAPDIIDGLKKNPAASVPIVLKRLKLKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGINFKQNDTKVLRSKTLLNEIESI 759          

HSP 3 Score: 114.775 bits (286), Expect = 4.986e-25
Identity = 73/232 (31.47%), Postives = 117/232 (50.43%), Query Frame = 1
Query: 2650 YDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVS-----------------DDEEDSVNGNNCHLDTSS-----CSRIKNNADKENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADL-----------LLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQII 3246
            + +L DAA+L+IHH+KRQS+ +K+DK  +K ++   + D+   +R  +S                   + + + G      T S      S  +     E+ Y LF  N  WY+F+RL+ +L  RL  L  +AE+ + +   E++   +EV  L           L  K+   +  EDYY   + +V++LLD   + + +ED +REMF IH YI F+MDKLI  + +QLQ I
Sbjct:  788 HQILEDAAALIIHHVKRQSSINKEDKYKIKQIVYHFIPDMLFAQRGVLSDVEEEDEEEDMELDEGASKKHNGLAGGASASPTKSKLLFSASTAQRLRSCEDAYNLFYVNNNWYIFLRLHQILCSRLLRLYAQAERQIEEDMREREWE-REVLGLKRDKNENTAVQLRLKEPMDVEVEDYYSAFLEMVRNLLDGNMEASQYEDSLREMFTIHAYIAFTMDKLIQNIARQLQHI 1018          
BLAST of Paired amphipathic helix protein vs. Ensembl Zebrafish
Match: sin3b (SIN3 transcription regulator family member B [Source:ZFIN;Acc:ZDB-GENE-030131-8264])

HSP 1 Score: 172.17 bits (435), Expect = 1.047e-42
Identity = 107/337 (31.75%), Postives = 170/337 (50.45%), Query Frame = 1
Query: 1357 LPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI 2364
            L S+  Y +F+  I LFN+ +++  +L   V PF  K  E++  F S    + D +  + +    D  YM                                                   + V+ +  +  GS YR LP+ + +P+     +  ICKEVLN +++   S S ED+ FV SKKT +EE + + EDER+E+D+V+E N A +  L  +Q +L  ++ +    F  ++ L  +S ++  +A+ RIYGDKA +II GLK  PA  VP+VL+RLK K+ EW+E  + F + WR+Q +   LKSLD+Q +NF+  D    R K+LL +++ I
Sbjct:  361 LKSQEVYENFLRCIALFNQEVVSGAELLQLVTPFLGKFPELYTQFKSF---LGDKELSHVISGLSDR-YMEGGG-----------------------------------------------REVDYASCKRLGSSYRALPKTYQQPK--CSGRTAICKEVLNDTWVSFPSWS-EDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRLSLEDQERFRLDDCLGGTSEVIQRRAVYRIYGDKAPEIIEGLKRSPATAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQGVNFKQNDMKALRSKSLLNEIESI 643          

HSP 2 Score: 158.303 bits (399), Expect = 1.628e-38
Identity = 104/262 (39.69%), Postives = 144/262 (54.96%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMS------AYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPII-QSGNSIISLKSISPGIPQSQ-TPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRK----QTETEVSQEVAKLFDNEQDLLQEFSTFLPDS 888
            KLKVEDAL Y+D+VK RF  +  IY KFL++MK+FK+Q I+T  VI  V  LFHGH DL+ GFN FLPPGY++       A+   P  +   P     T  ++++  S    +      N  V  P  ++  S    ++  +          +P+  +   S  +  S+SP  P S+ +P EF+ A+ YVNKIKNRF   P+ Y+ FLEILH YQKEQ      + +     TE EV  +VA LF  ++DLL EF  FLPD+
Sbjct:   35 KLKVEDALSYLDQVKIRFGNDPGIYNKFLDIMKEFKSQSIDTPGVINRVSQLFHGHPDLVLGFNAFLPPGYRIEIPKNGMAFLQSPFSSQVSPGAGRSTGSSVVSASSSAVVEAAGPAQNEAVTSPESIASSSGPPEQSSKL---------SLPLPNRESQSQPAATSVSP--PTSEPSPVEFDSAISYVNKIKNRFLDNPETYRAFLEILHTYQKEQLEVKESRGRSTGGMTEDEVFSKVASLFKGQEDLLAEFGQFLPDA 285          

HSP 3 Score: 110.153 bits (274), Expect = 1.222e-23
Identity = 72/252 (28.57%), Postives = 124/252 (49.21%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEE-----------------------DSVNGNN----C----HLDTSSCSR---------------IKNNADKENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE-----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQ 3240
            +L DAASL+I+H+KRQ    KDDK ++K +++    D+F   R  +S+ EE                         +NG +    C     +DTS+ +                 ++  + +  Y LF  N  WY F+RL+  L  RL  +  +AE+ + +++ E           +++   ++A  L  K+ +++  E+YY   +++V+ LLD   ++  +ED +REMF IH YI F++DKLI  +V+QLQ
Sbjct:  684 ILEDAASLIIYHVKRQPTIHKDDKDHIKRIIQHFAPDLFFARRGELSETEEFTDEEGEGEDGAAAGGGVSSTGQQQLNGESRRRRCTSPQSMDTSTVAHSINPEGEAVDLRDPEAEHQKEMDGVYNLFFVNNNWYFFLRLHQTLCSRLLKIYRQAERQLLEHRAEQNRERLLMGEGRREKANDLAMELRLKQPSEVELEEYYPAFLDMVRSLLDGNLESTQYEDTLREMFTIHAYIGFTIDKLIQNIVRQLQ 935          
BLAST of Paired amphipathic helix protein vs. Ensembl Zebrafish
Match: sin3ab (SIN3 transcription regulator family member Ab [Source:ZFIN;Acc:ZDB-GENE-030131-2066])

HSP 1 Score: 73.559 bits (179), Expect = 5.178e-14
Identity = 49/170 (28.82%), Postives = 87/170 (51.18%), Query Frame = 1
Query: 3046 LLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF-KQCSKHFYGQDERENKLKINITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTKCSGHMCITLLDVSPGNSSG 3552
            L  K+   +  EDYY   + +V++LLD   +T+ +ED++REMF IH YI F+MDKLI ++V+QLQ I  +D+   +++ L+  +C+    G        + N   +   ++ ++E+ + DE  +                 +LF +   +K +  + + LLD    NS G
Sbjct:   21 LRLKEPMDIEVEDYYSAFLEMVRNLLDGNMETSQYEDQLREMFTIHAYIAFTMDKLIQSIVRQLQHI-VSDDICVQVTDLYLSECANKATGGSLSTQSSRSNAETS---YQRKSEQLMSDENCF----------------KLLFQK---SKGTVQLAVELLDTEEENSDG 167          
BLAST of Paired amphipathic helix protein vs. Ensembl Xenopus
Match: gas2l1 (growth arrest specific 2 like 1 [Source:Xenbase;Acc:XB-GENE-940187])

HSP 1 Score: 253.062 bits (645), Expect = 9.917e-68
Identity = 213/714 (29.83%), Postives = 323/714 (45.24%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR-----------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQCSKHFYGQDERENKLKINITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTKCSGHMCITLLDVSPGNSSGSESQEDASKIKEEPSSSTPAIPHVSKSVISESNLPPVMSWKHYIERYVTCSEKLGFSDGLHNIGLNKRISVPVFLLRSLRK 3795
            GS YR LP+ F +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ +    F  +  L  +S ++  KA+QRIY DKA DII+GLK +PA+ VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q IN                               Y+ I +     +SLL+   +   E+ E+            E N  IS  P  H+ L +                         D   +L DAASL+IHH+KRQ+   K+DK  +K ++   + D+   +R  +SD EE+         D  +                      N A +     E+ Y LF  N  WY+F+RL+ +L  RL  +  +AE+ V +   E          K+      A  L  K+   +  EDYY   +++V++LLD   D+  +ED +REMF IH +I F+MDKLI ++V+QLQ I  +D    +++ L+   S               +   TG L  T+    + +E  Y + A +L    +E    ++F +   ++    + I LLD                   EE +S  PA                   W  YIERY+ C      S  L      K    PVFL R+LR+
Sbjct:  557 GSSYRALPKSFQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLETIQKKLSRLSAEDQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLKKNPAVAVPIVLKRLKMKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGIN-------------------------------YKQIDTKVLRSKSLLNEIESIYDERQEQ----------ASEDNSGISSGP--HLTLTY-------------------------DDKQILEDAASLIIHHVKRQTGIQKEDKYKIKQIVYHFIPDLLFSQRGELSDVEEEEEEETAETEDGVTKKHNGVGVGGGSSPPKAKLMFGNTAAQKWRGVEDAYNLFYVNNNWYIFLRLHQILCSRLLRIYNQAEKQVEEEMREREWEREVLGLKRDKNDSPAIQLRLKEPMDIEAEDYYPAFLDMVRNLLDGNMDSNQYEDSLREMFTIHAFIAFTMDKLIQSIVRQLQHI-VSDEICVQVTELYLSES---------------SSNATGGLLTTQASRNL-NEANYQRKAEQLMS--DENCFKLMFSQ---SRGQVQLTIELLDT------------------EEENSDDPA---------------ETERWSDYIERYMNCDST---SPELREHLAQK----PVFLPRNLRR 1137          

HSP 2 Score: 167.548 bits (423), Expect = 3.884e-41
Identity = 109/276 (39.49%), Postives = 150/276 (54.35%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI--------------VNPPIEVSIDSDLSHENVSI-VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH +LI GFNTFLPPGY++   QT  ++N   P  +H  + + +  P      P    +  I              ++ P++    +  + ++  I   S R+   Q              + +    Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  117 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPELIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQVHQITTHGLQPPVPQAPPPSQPSAQPIPSPVHPTPQPPPAKISKPMQSQAHTPTNQQSTPIQYPSPRSPPAQPHTPGPLAHATPTATAATPTMQNNQPVEFNHAINYVNKIKNRFQGQPDIYKSFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 386          
BLAST of Paired amphipathic helix protein vs. Ensembl Xenopus
Match: gas2l1 (growth arrest specific 2 like 1 [Source:Xenbase;Acc:XB-GENE-940187])

HSP 1 Score: 249.98 bits (637), Expect = 1.432e-67
Identity = 176/554 (31.77%), Postives = 273/554 (49.28%), Query Frame = 1
Query: 1726 VELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR-----------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF 3288
            ++ +  +  GS YR LP+ F +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ +    F  +  L  +S ++  KA+QRIY DKA DII+GLK +PA+ VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q IN                               Y+ I +     +SLL+   +   E+ E+            E N  IS  P  H+ L +                         D   +L DAASL+IHH+KRQ+   K+DK  +K ++   + D+   +R  +SD EE+         D  +                      N A +     E+ Y LF  N  WY+F+RL+ +L  RL  +  +AE+ V +   E          K+      A  L  K+   +  EDYY   +++V++LLD   D+  +ED +REMF IH +I F+MDKLI ++V+QLQ I  +D    +++ L+
Sbjct:  461 IDYASCKRLGSSYRALPKSFQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLETIQKKLSRLSAEDQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLKKNPAVAVPIVLKRLKMKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGIN-------------------------------YKQIDTKVLRSKSLLNEIESIYDERQEQ----------ASEDNSGISSGP--HLTLTY-------------------------DDKQILEDAASLIIHHVKRQTGIQKEDKYKIKQIVYHFIPDLLFSQRGELSDVEEEEEEETAETEDGVTKKHNGVGVGGGSSPPKAKLMFGNTAAQKWRGVEDAYNLFYVNNNWYIFLRLHQILCSRLLRIYNQAEKQVEEEMREREWEREVLGLKRDKNDSPAIQLRLKEPMDIEAEDYYPAFLDMVRNLLDGNMDSNQYEDSLREMFTIHAFIAFTMDKLIQSIVRQLQHI-VSDEICVQVTELY 942          

HSP 2 Score: 130.568 bits (327), Expect = 8.316e-30
Identity = 84/222 (37.84%), Postives = 119/222 (53.60%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI--------------VNPPIEVSIDSDLSHENVSI-VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQ 759
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH +LI GFNTFLPPGY++   QT  ++N   P  +H  + + +  P      P    +  I              ++ P++    +  + ++  I   S R+   Q              + +    Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQ
Sbjct:  117 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPELIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQVHQITTHGLQPPVPQAPPPSQPSAQPIPSPVHPTPQPPPAKISKPMQSQAHTPTNQQSTPIQYPSPRSPPAQPHTPGPLAHATPTATAATPTMQNNQPVEFNHAINYVNKIKNRFQGQPDIYKSFLEILHTYQ 337          
BLAST of Paired amphipathic helix protein vs. Ensembl Xenopus
Match: gas2l1 (growth arrest specific 2 like 1 [Source:Xenbase;Acc:XB-GENE-940187])

HSP 1 Score: 251.136 bits (640), Expect = 1.702e-67
Identity = 213/714 (29.83%), Postives = 324/714 (45.38%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR-----------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQCSKHFYGQDERENKLKINITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTKCSGHMCITLLDVSPGNSSGSESQEDASKIKEEPSSSTPAIPHVSKSVISESNLPPVMSWKHYIERYVTCSEKLGFSDGLHNIGLNKRISVPVFLLRSLRK 3795
            GS YR LP+ F +P+   ++   +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ +    F  +  L  +S ++  KA+QRIY DKA DII+GLK +PA+ VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q IN                               Y+ I +     +SLL+   +   E+ E+            E N  IS  P  H+ L +                         D   +L DAASL+IHH+KRQ+   K+DK  +K ++   + D+   +R  +SD EE+         D  +                      N A +     E+ Y LF  N  WY+F+RL+ +L  RL  +  +AE+ V +   E          K+      A  L  K+   +  EDYY   +++V++LLD   D+  +ED +REMF IH +I F+MDKLI ++V+QLQ I  +D    +++ L+   S               +   TG L  T+    + +E  Y + A +L    +E    ++F +   ++    + I LLD                   EE +S  PA                   W  YIERY+ C      S  L      K    PVFL R+LR+
Sbjct:  397 GSSYRALPKSFQQPKCTGRTP--LCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLETIQKKLSRLSAEDQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLKKNPAVAVPIVLKRLKMKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGIN-------------------------------YKQIDTKVLRSKSLLNEIESIYDERQEQ----------ASEDNSGISSGP--HLTLTY-------------------------DDKQILEDAASLIIHHVKRQTGIQKEDKYKIKQIVYHFIPDLLFSQRGELSDVEEEEEEETAETEDGVTKKHNGVGVGGGSSPPKAKLMFGNTAAQKWRGVEDAYNLFYVNNNWYIFLRLHQILCSRLLRIYNQAEKQVEEEMREREWEREVLGLKRDKNDSPAIQLRLKEPMDIEAEDYYPAFLDMVRNLLDGNMDSNQYEDSLREMFTIHAFIAFTMDKLIQSIVRQLQHI-VSDEICVQVTELYLSES---------------SSNATGGLLTTQASRNL-NEANYQRKAEQLMS--DENCFKLMFSQ---SRGQVQLTIELLDT------------------EEENSDDPA---------------ETERWSDYIERYMNCDST---SPELREHLAQK----PVFLPRNLRR 977          

HSP 2 Score: 128.257 bits (321), Expect = 3.900e-29
Identity = 87/232 (37.50%), Postives = 118/232 (50.86%), Query Frame = 1
Query:  262 INTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI--------------VNPPIEVSIDSDLSHENVSI-VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQ----TETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            I+T  VI  V  LF GH +LI GFNTFLPPGY++   QT  ++N   P  +H  + + +  P      P    +  I              ++ P++    +  + ++  I   S R+   Q              + +    Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N            TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:   32 IDTPGVISRVSQLFKGHPELIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQVHQITTHGLQPPVPQAPPPSQPSAQPIPSPVHPTPQPPPAKISKPMQSQAHTPTNQQSTPIQYPSPRSPPAQPHTPGPLAHATPTATAATPTMQNNQPVEFNHAINYVNKIKNRFQGQPDIYKSFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 262          
BLAST of Paired amphipathic helix protein vs. Ensembl Xenopus
Match: gas2l1 (growth arrest specific 2 like 1 [Source:Xenbase;Acc:XB-GENE-940187])

HSP 1 Score: 251.136 bits (640), Expect = 2.305e-67
Identity = 213/714 (29.83%), Postives = 323/714 (45.24%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR-----------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQCSKHFYGQDERENKLKINITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTKCSGHMCITLLDVSPGNSSGSESQEDASKIKEEPSSSTPAIPHVSKSVISESNLPPVMSWKHYIERYVTCSEKLGFSDGLHNIGLNKRISVPVFLLRSLRK 3795
            GS YR LP+ F +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ +    F  +  L  +S ++  KA+QRIY DKA DII+GLK +PA+ VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q IN                               Y+ I +     +SLL+   +   E+ E+            E N  IS  P  H+ L +                         D   +L DAASL+IHH+KRQ+   K+DK  +K ++   + D+   +R  +SD EE+         D  +                      N A +     E+ Y LF  N  WY+F+RL+ +L  RL  +  +AE+ V +   E          K+      A  L  K+   +  EDYY   +++V++LLD   D+  +ED +REMF IH +I F+MDKLI ++V+QLQ I  +D    +++ L+   S               +   TG L  T+    + +E  Y + A +L    +E    ++F +   ++    + I LLD                   EE +S  PA                   W  YIERY+ C      S  L      K    PVFL R+LR+
Sbjct:  471 GSSYRALPKSFQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLETIQKKLSRLSAEDQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLKKNPAVAVPIVLKRLKMKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGIN-------------------------------YKQIDTKVLRSKSLLNEIESIYDERQEQ----------ASEDNSGISSGP--HLTLTY-------------------------DDKQILEDAASLIIHHVKRQTGIQKEDKYKIKQIVYHFIPDLLFSQRGELSDVEEEEEEETAETEDGVTKKHNGVGVGGGSSPPKAKLMFGNTAAQKWRGVEDAYNLFYVNNNWYIFLRLHQILCSRLLRIYNQAEKQVEEEMREREWEREVLGLKRDKNDSPAIQLRLKEPMDIEAEDYYPAFLDMVRNLLDGNMDSNQYEDSLREMFTIHAFIAFTMDKLIQSIVRQLQHI-VSDEICVQVTELYLSES---------------SSNATGGLLTTQASRNL-NEANYQRKAEQLMS--DENCFKLMFSQ---SRGQVQLTIELLDT------------------EEENSDDPA---------------ETERWSDYIERYMNCDST---SPELREHLAQK----PVFLPRNLRR 1051          

HSP 2 Score: 163.31 bits (412), Expect = 7.588e-40
Identity = 105/268 (39.18%), Postives = 145/268 (54.10%), Query Frame = 1
Query:  160 VEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI--------------VNPPIEVSIDSDLSHENVSI-VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQ----TETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            VEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH +LI GFNTFLPPGY++   QT  ++N   P  +H  + + +  P      P    +  I              ++ P++    +  + ++  I   S R+   Q              + +    Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N            TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:   34 VEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPELIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQVHQITTHGLQPPVPQAPPPSQPSAQPIPSPVHPTPQPPPAKISKPMQSQAHTPTNQQSTPIQYPSPRSPPAQPHTPGPLAHATPTATAATPTMQNNQPVEFNHAINYVNKIKNRFQGQPDIYKSFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 300          
BLAST of Paired amphipathic helix protein vs. Ensembl Xenopus
Match: gas2l1 (growth arrest specific 2 like 1 [Source:Xenbase;Acc:XB-GENE-940187])

HSP 1 Score: 249.595 bits (636), Expect = 1.034e-66
Identity = 213/714 (29.83%), Postives = 319/714 (44.68%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR-----------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQCSKHFYGQDERENKLKINITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTKCSGHMCITLLDVSPGNSSGSESQEDASKIKEEPSSSTPAIPHVSKSVISESNLPPVMSWKHYIERYVTCSEKLGFSDGLHNIGLNKRISVPVFLLRSLRK 3795
            GS YR LP+ F +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ +    F  +  L  +S ++  KA+QRIY DKA DII+GLK +PA+ VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q IN                               Y+ I +     +SLL+   +   E+ E+            E N  IS  P  H+ L +                         D   +L DAASL+IHH+KRQ+   K+DK  +K ++   + D+   +R  +SD EE+         D  +                      N A +     E+ Y LF  N  WY+F+RL+ +L  RL  +  +AE+ V +   E          K+      A  L  K+   +  EDYY   +++V++LLD   D+  +ED +REMF IH +I F+MDKLI ++V+QLQ I  +D    +++ L+   S               +   TG L  T+    + +E  Y + A +L    N       F     ++    + I LLD                   EE +S  PA                   W  YIERY+ C      S  L      K    PVFL R+LR+
Sbjct:  521 GSSYRALPKSFQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLETIQKKLSRLSAEDQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLKKNPAVAVPIVLKRLKMKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGIN-------------------------------YKQIDTKVLRSKSLLNEIESIYDERQEQ----------ASEDNSGISSGP--HLTLTY-------------------------DDKQILEDAASLIIHHVKRQTGIQKEDKYKIKQIVYHFIPDLLFSQRGELSDVEEEEEEETAETEDGVTKKHNGVGVGGGSSPPKAKLMFGNTAAQKWRGVEDAYNLFYVNNNWYIFLRLHQILCSRLLRIYNQAEKQVEEEMREREWEREVLGLKRDKNDSPAIQLRLKEPMDIEAEDYYPAFLDMVRNLLDGNMDSNQYEDSLREMFTIHAFIAFTMDKLIQSIVRQLQHI-VSDEICVQVTELYLSES---------------SSNATGGLLTTQASRNL-NEANYQRKAEQLMSDEN------CFK----SRGQVQLTIELLDT------------------EEENSDDPA---------------ETERWSDYIERYMNCDST---SPELREHLAQK----PVFLPRNLRR 1096          

HSP 2 Score: 167.162 bits (422), Expect = 5.077e-41
Identity = 107/271 (39.48%), Postives = 148/271 (54.61%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI--------------VNPPIEVSIDSDLSHENVSI-VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQ----TETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH +LI GFNTFLPPGY++   QT  ++N   P  +H  + + +  P      P    +  I              ++ P++    +  + ++  I   S R+   Q              + +    Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N            TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  117 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPELIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQVHQITTHGLQPPVPQAPPPSQPSAQPIPSPVHPTPQPPPAKISKPMQSQAHTPTNQQSTPIQYPSPRSPPAQPHTPGPLAHATPTATAATPTMQNNQPVEFNHAINYVNKIKNRFQGQPDIYKSFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 386          
BLAST of Paired amphipathic helix protein vs. Ensembl Mouse
Match: Sin3a (transcriptional regulator, SIN3A (yeast) [Source:MGI Symbol;Acc:MGI:107157])

HSP 1 Score: 181.03 bits (458), Expect = 2.310e-45
Identity = 100/261 (38.31%), Postives = 157/261 (60.15%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ ++   F  +  L  +S ++  KA+QRIY DKA DII+GL+ +P+I VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I              V + P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  556 GSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALI--IHHVKRQTGIQKEDKY 811          

HSP 2 Score: 172.555 bits (436), Expect = 8.541e-43
Identity = 113/278 (40.65%), Postives = 152/278 (54.68%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI---------------VNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  +H    + I        Q  +  S+                 V+ P ++   +  S +   +    S R+     P +Q    +      +P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  120 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRS-----PPVQPHTPVTISLGTAPSL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 385          

HSP 3 Score: 107.457 bits (267), Expect = 9.098e-23
Identity = 74/226 (32.74%), Postives = 118/226 (52.21%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR--------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQII 3246
            +L DAA+L+IHH+KRQ+   K+DK  +K +M   + D+   +R ++SD EE+     +    T +  +                N A +     +  Y LF  N  WY+F+RL+ +L  RL  +  +AE+ + +   E          K+      A  L  K+   ++ EDYY   +++V+ LLD   D++ +ED +REMF IH YI F+MDKLI ++V+QLQ I
Sbjct:  787 ILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI 1012          
BLAST of Paired amphipathic helix protein vs. Ensembl Mouse
Match: Sin3a (transcriptional regulator, SIN3A (yeast) [Source:MGI Symbol;Acc:MGI:107157])

HSP 1 Score: 181.03 bits (458), Expect = 2.310e-45
Identity = 100/261 (38.31%), Postives = 157/261 (60.15%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ ++   F  +  L  +S ++  KA+QRIY DKA DII+GL+ +P+I VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I              V + P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  556 GSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALI--IHHVKRQTGIQKEDKY 811          

HSP 2 Score: 172.555 bits (436), Expect = 8.541e-43
Identity = 113/278 (40.65%), Postives = 152/278 (54.68%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI---------------VNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  +H    + I        Q  +  S+                 V+ P ++   +  S +   +    S R+     P +Q    +      +P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  120 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRS-----PPVQPHTPVTISLGTAPSL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 385          

HSP 3 Score: 107.457 bits (267), Expect = 9.098e-23
Identity = 74/226 (32.74%), Postives = 118/226 (52.21%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR--------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQII 3246
            +L DAA+L+IHH+KRQ+   K+DK  +K +M   + D+   +R ++SD EE+     +    T +  +                N A +     +  Y LF  N  WY+F+RL+ +L  RL  +  +AE+ + +   E          K+      A  L  K+   ++ EDYY   +++V+ LLD   D++ +ED +REMF IH YI F+MDKLI ++V+QLQ I
Sbjct:  787 ILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI 1012          
BLAST of Paired amphipathic helix protein vs. Ensembl Mouse
Match: Sin3a (transcriptional regulator, SIN3A (yeast) [Source:MGI Symbol;Acc:MGI:107157])

HSP 1 Score: 181.03 bits (458), Expect = 2.310e-45
Identity = 100/261 (38.31%), Postives = 157/261 (60.15%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ ++   F  +  L  +S ++  KA+QRIY DKA DII+GL+ +P+I VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I              V + P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  556 GSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALI--IHHVKRQTGIQKEDKY 811          

HSP 2 Score: 172.555 bits (436), Expect = 8.541e-43
Identity = 113/278 (40.65%), Postives = 152/278 (54.68%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI---------------VNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  +H    + I        Q  +  S+                 V+ P ++   +  S +   +    S R+     P +Q    +      +P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  120 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRS-----PPVQPHTPVTISLGTAPSL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 385          

HSP 3 Score: 107.457 bits (267), Expect = 9.098e-23
Identity = 74/226 (32.74%), Postives = 118/226 (52.21%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR--------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQII 3246
            +L DAA+L+IHH+KRQ+   K+DK  +K +M   + D+   +R ++SD EE+     +    T +  +                N A +     +  Y LF  N  WY+F+RL+ +L  RL  +  +AE+ + +   E          K+      A  L  K+   ++ EDYY   +++V+ LLD   D++ +ED +REMF IH YI F+MDKLI ++V+QLQ I
Sbjct:  787 ILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI 1012          
BLAST of Paired amphipathic helix protein vs. Ensembl Mouse
Match: Sin3a (transcriptional regulator, SIN3A (yeast) [Source:MGI Symbol;Acc:MGI:107157])

HSP 1 Score: 180.644 bits (457), Expect = 2.463e-45
Identity = 100/261 (38.31%), Postives = 157/261 (60.15%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ ++   F  +  L  +S ++  KA+QRIY DKA DII+GL+ +P+I VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I              V + P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  556 GSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALI--IHHVKRQTGIQKEDKY 811          

HSP 2 Score: 172.555 bits (436), Expect = 8.646e-43
Identity = 113/278 (40.65%), Postives = 152/278 (54.68%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI---------------VNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  +H    + I        Q  +  S+                 V+ P ++   +  S +   +    S R+     P +Q    +      +P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  120 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRS-----PPVQPHTPVTISLGTAPSL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 385          

HSP 3 Score: 107.457 bits (267), Expect = 9.346e-23
Identity = 74/226 (32.74%), Postives = 118/226 (52.21%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR--------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQII 3246
            +L DAA+L+IHH+KRQ+   K+DK  +K +M   + D+   +R ++SD EE+     +    T +  +                N A +     +  Y LF  N  WY+F+RL+ +L  RL  +  +AE+ + +   E          K+      A  L  K+   ++ EDYY   +++V+ LLD   D++ +ED +REMF IH YI F+MDKLI ++V+QLQ I
Sbjct:  787 ILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI 1012          
BLAST of Paired amphipathic helix protein vs. Ensembl Mouse
Match: Sin3a (transcriptional regulator, SIN3A (yeast) [Source:MGI Symbol;Acc:MGI:107157])

HSP 1 Score: 180.644 bits (457), Expect = 2.463e-45
Identity = 100/261 (38.31%), Postives = 157/261 (60.15%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ ++   F  +  L  +S ++  KA+QRIY DKA DII+GL+ +P+I VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I              V + P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  556 GSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALI--IHHVKRQTGIQKEDKY 811          

HSP 2 Score: 172.555 bits (436), Expect = 8.646e-43
Identity = 113/278 (40.65%), Postives = 152/278 (54.68%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI---------------VNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  +H    + I        Q  +  S+                 V+ P ++   +  S +   +    S R+     P +Q    +      +P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  120 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRS-----PPVQPHTPVTISLGTAPSL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 385          

HSP 3 Score: 107.457 bits (267), Expect = 9.346e-23
Identity = 74/226 (32.74%), Postives = 118/226 (52.21%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR--------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQII 3246
            +L DAA+L+IHH+KRQ+   K+DK  +K +M   + D+   +R ++SD EE+     +    T +  +                N A +     +  Y LF  N  WY+F+RL+ +L  RL  +  +AE+ + +   E          K+      A  L  K+   ++ EDYY   +++V+ LLD   D++ +ED +REMF IH YI F+MDKLI ++V+QLQ I
Sbjct:  787 ILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI 1012          
BLAST of Paired amphipathic helix protein vs. UniProt/SwissProt
Match: sp|Q09750|PST1_SCHPO (Paired amphipathic helix protein pst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pst1 PE=1 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 2.869e-54
Identity = 200/768 (26.04%), Postives = 342/768 (44.53%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPIEVS---IDSDLSHENVSIVESERAD-VNQIP---IIQSGNSIISLKSISPGIPQS-QTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPD-SVSFGNNLSDNDLCSGRRSSSGY-KTIPNSTQNCYINPSNIIPVNEKSKIQCVNVPKIDSIDESIEKNQIDYFRPASTSVPPVSIASVSQTPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAI--SNRDAIKINLLSNHELSKIRHFDVISAMCQELLE-----LPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPE-EFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYG-DKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRD-QDLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRL 2388
            +L V DAL Y+D VK +F++E  IY +FL++MK+FK+Q I T  VI  V  LF G+ +LI+GFNTFLPPGY +           P ++    I     P ++N         +   PP   S   + +  S+ ++++ +S  +  V Q P    +Q   S        P +  S +  ++ + A+ +VN +KNRF  +P+ Y  FL+IL  YQ +Q+   LV           +V++LF    DLL+EF  FLPD SV+      D      + S++   K  P++T      P++ +P                               P     PP +  +     KR        +  + T NH  +KR RTA+S++  +   A  + +  N   S++           E LE     L +E+ Y  F+  ++L+++ + +   L      FF   +E   N++  L K N  + +                 V  P V ++  K C                                           G  YR+LP+ E   P S    ++ +C  +LN +++   +L++ED+ F+  +K  FEE++ K+E+ERYE D  +  N   +  L     ++ +M+  +  ++    NL   S  +++K I+++YG + A  II  L+ +P++ +PIVLERLK+KD EW+     +   W D ++    +SLD+Q ++F++ D   T PK L+ +L  + + + + L
Sbjct:  179 QLNVTDALSYLDLVKLQFHQEPEIYNEFLDIMKEFKSQAIETPEVITRVSKLFAGYPNLIQGFNTFLPPGYSIEISSAD-----PGSLAGIHITTPQGPLMIND-----LGKTTAPPPPHGSTTPLPAAASYTSMNMKQSSASHPVLQPPAPSTLQFNPSPSPAAPSYPPVDASVKQAADLDQAINFVNNVKNRFSHKPEAYNSFLDILKSYQHDQRPIQLVYF---------QVSQLFAEAPDLLEEFKRFLPDVSVNAPAETQDKSTVVPQESATATPKRSPSAT------PTSALP-------------------------------PIGKFAPPTTAKAQPAPEKR------RGEPAVQTRNH--SKRTRTATSSVEETTPRAFNVPIAQNKNPSEL-----------EFLEHARQYLANESKYNEFIKLLELYSQEVFDKNALVERCYVFFGS-NEHLMNWLKDLVKYNPANPI----------------PVPRPRVDLTQCKSC-------------------------------------------GPSYRLLPKIELLLPCS---GRDDLCWTILNDAWVSFPTLASEDSGFIAHRKNQFEENLHKLEEERYEYDRHIGANMRFIELLQIHADKMLKMSEVEKANWTLPSNLGGKSVSIYHKVIKKVYGKEHAQQIIENLQKNPSVTIPIVLERLKKKDREWRSLQNHWNELWHDIEEKNFYRSLDHQGVSFKSVDKKSTTPKFLISELRNLAQQQKVEL 808          

HSP 2 Score: 73.9442 bits (180), Expect = 1.169e-11
Identity = 52/176 (29.55%), Postives = 87/176 (49.43%), Query Frame = 1
Query: 2797 DDEEDSVNGN-----NCHLDTSSCSRIKNNADKENH--YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLN-----PEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF 3288
            DDE  SV        NC    +  S + +     +   Y LF GN   Y F RL+H L  RL  +K   EQ+    + + K N   V   L+   S +L       +  Y++AI L + L++   D   FED +R ++GIH +  ++++KL+T+++KQL  ++     +R+L+ +F
Sbjct:  964 DDESSSVFSTGEVWVNCKFTDTDGSLLDDGTKLSDRSVYNLF-GNMSLYCFFRLFHTLYSRLEEIK-NLEQMAYSKQHDVKSNPVAVELGLVRHPSERLGFALPTADTVYEQAIQLCERLMEGEIDQNGFEDALRCLYGIHAFRLYTVEKLVTSIIKQLHSVTT----NRRLAQVF 1133          
BLAST of Paired amphipathic helix protein vs. UniProt/SwissProt
Match: sp|Q96ST3|SIN3A_HUMAN (Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 5.437e-45
Identity = 119/396 (30.05%), Postives = 198/396 (50.00%), Query Frame = 1
Query: 1357 LPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVW---QNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            L S  AY +F+  + +FN+ +++  +L   V PF  K  E++   +NF+   E +  H + Y  + + +   M                                                     ++ +  +  GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ ++   F  +  L  +S ++  KA+QRIY DKA DII+GL+ +P+I VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I              V + P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  474 LRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESV--HLETYPKERATEGIAM----------------------------------------------------EIDYASCKRLGSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALI--IHHVKRQTGIQKEDKY 810          

HSP 2 Score: 172.555 bits (436), Expect = 6.175e-42
Identity = 113/278 (40.65%), Postives = 151/278 (54.32%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI---------------VNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  +H    + I        Q  +  S                  V+ P ++   +  S +   +    S R+     P +Q    +      +P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  120 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRS-----PPVQPHTPVTISLGTAPSL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 385          

HSP 3 Score: 108.227 bits (269), Expect = 3.604e-22
Identity = 76/240 (31.67%), Postives = 125/240 (52.08%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR--------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF 3288
            +L DAA+L+IHH+KRQ+   K+DK  +K +M   + D+   +R ++SD EE+     +    T +  +                N A +     +  Y LF  N  WY+F+RL+ +L  RL  +  +AE+ + +   E          K+      A  L  K+   ++ EDYY   +++V+ LLD   D++ +ED +REMF IH YI F+MDKLI ++V+QLQ I  +D    +++ L+
Sbjct:  786 ILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI-VSDEICVQVTDLY 1024          
BLAST of Paired amphipathic helix protein vs. UniProt/SwissProt
Match: sp|Q60520|SIN3A_MOUSE (Paired amphipathic helix protein Sin3a OS=Mus musculus OX=10090 GN=Sin3a PE=1 SV=3)

HSP 1 Score: 181.03 bits (458), Expect = 1.616e-44
Identity = 100/261 (38.31%), Postives = 157/261 (60.15%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  ++ ++   F  +  L  +S ++  KA+QRIY DKA DII+GL+ +P+I VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I              V + P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  556 GSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALI--IHHVKRQTGIQKEDKY 811          

HSP 2 Score: 172.555 bits (436), Expect = 5.974e-42
Identity = 113/278 (40.65%), Postives = 152/278 (54.68%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIHPTSINIINTPSIVNSQPYAIYSNSI---------------VNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  +H    + I        Q  +  S+                 V+ P ++   +  S +   +    S R+     P +Q    +      +P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  120 RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRS-----PPVQPHTPVTISLGTAPSL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 385          

HSP 3 Score: 107.457 bits (267), Expect = 6.364e-22
Identity = 74/226 (32.74%), Postives = 118/226 (52.21%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSR--------------IKNNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQII 3246
            +L DAA+L+IHH+KRQ+   K+DK  +K +M   + D+   +R ++SD EE+     +    T +  +                N A +     +  Y LF  N  WY+F+RL+ +L  RL  +  +AE+ + +   E          K+      A  L  K+   ++ EDYY   +++V+ LLD   D++ +ED +REMF IH YI F+MDKLI ++V+QLQ I
Sbjct:  787 ILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI 1012          
BLAST of Paired amphipathic helix protein vs. UniProt/SwissProt
Match: sp|O75182|SIN3B_HUMAN (Paired amphipathic helix protein Sin3b OS=Homo sapiens OX=9606 GN=SIN3B PE=1 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 8.372e-42
Identity = 171/724 (23.62%), Postives = 296/724 (40.88%), Query Frame = 1
Query: 1357 LPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKE--------------------------------VLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNV------SDDEEDSVNGNNCHLDTSSCSRIKNNADK--------------------------------ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEK----------KQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF 3288
            L S+  Y +F+  I LFN+ +++  +L   V PF  K  E++  F S L                              V  +S A   +  S   I+                       + ++ +  +  GS YR LP+ + +P+     +  ICKE                                VLN +++   S S ED+ FV SKKT +EE + + EDER+E+D+V+E N A +  L  +Q +L  M  +    F  +++L  +S ++  +AI RIYGDKA +II  LK +P   VP+VL           +++K     WR+           Q  N   K       K  L  LD        + +N++   +     +SLL+   +   E  E+     +S G       + +PS + H++ ++  D Q                        +L DAA+L+ +++KRQ    K+D+  +  L+   +  +F  ++ ++      +D++ DS  G      T+  S  K  A                                  ++ Y LF  N  WY F+RL+  L  RL  +  +A++ + +Y+ EK          ++   + A  L  K+ +++  E+YY   +++V+ LL+   D   +ED +REMF IH Y+ F+MDKL+  + +QL  +  +D+   K+  L+
Sbjct:  318 LKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFL-----------------------------GVKELSFAPPMSDRSGDGIS-----------------------REIDYASCKRIGSSYRALPKTYQQPK--CSGRTAICKELDHWTLLQGSWTDDYCMSKFKNTCWIPGYSAGVLNDTWVSFPSWS-EDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKFRLDDSLGGTSEVIQRRAIYRIYGDKAPEIIESLKKNPVTAVPVVL-----------KRLKAKEEEWREAQ---------QGFN---KIWREQYEKAYLKSLDH-------QAVNFKQNDTKALRSKSLLNEIESVYDEHQEQ-----HSEG-------RSAPSSEPHLIFVYE-DRQ------------------------ILEDAAALISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDRDSPQGQ-----TTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPPLPPPAPHKPLDDVYSLFFANNNWYFFLRLHQTLCSRLLKIYRQAQKQLLEYRTEKEREKLLCEGRREKGSDPAMELRLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYVGFTMDKLVQNIARQLHHL-VSDDVCLKVVELY 913          

HSP 2 Score: 144.05 bits (362), Expect = 3.445e-33
Identity = 98/248 (39.52%), Postives = 126/248 (50.81%), Query Frame = 1
Query:  154 LKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVK-RKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDS 888
            + VEDAL Y+D+VK RF  +   Y  FLE+MK+FK+Q I+T  VI+ V  LFH H DLI GFN FLP GY+         I+ P N        +N  S + SQ                    + SH +    E  +    Q+P           K   P +P      EFN+A+ YVNKIK RF   P++Y+ FLEILH YQKEQ N      R  +E EV  EVA LF  ++DLL EF  FLP++
Sbjct:   39 VHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYR---------IDIPKN------GKLNIQSPLTSQ--------------------ENSHNHGDGAEDFK---QQVPY----------KEDKPQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEA 238          
BLAST of Paired amphipathic helix protein vs. UniProt/SwissProt
Match: sp|Q62141|SIN3B_MOUSE (Paired amphipathic helix protein Sin3b OS=Mus musculus OX=10090 GN=Sin3b PE=1 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 5.460e-41
Identity = 107/337 (31.75%), Postives = 170/337 (50.45%), Query Frame = 1
Query: 1357 LPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI 2364
            L S+  Y +F+  I LFN+ +++  +L   V PF  K  E++  F S L                              V  +S A   +  S   I+                       + ++ +  +  GS YR LP+ + +P+     +  ICKEVLN +++   S S ED+ FV SKKT +EE + + EDER+E+D+V+E N A +  L  +Q +L  M  +       ++ L  +S ++  +AI RIYGDKA ++I  LK +PA  VP+VL+RLK K+ EW+E  + F + WR+Q +   LKSLD+QA+NF+  D    R K+LL +++ +
Sbjct:  309 LKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFL-----------------------------GVKELSFAPPMSDRSGDGIS-----------------------REIDYASCKRIGSSYRALPKTYQQPK--CSGRTAICKEVLNDTWVSFPSWS-EDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKLRLDDCLGGTSEVIQRRAIHRIYGDKAPEVIESLKRNPATAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQAVNFKQNDTKALRSKSLLNEIESV 590          

HSP 2 Score: 141.739 bits (356), Expect = 1.649e-32
Identity = 97/246 (39.43%), Postives = 124/246 (50.41%), Query Frame = 1
Query:  160 VEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQ-KNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDS 888
            VEDAL Y+D+VK RF  +   Y  FLE+MK+FK+Q I+T  VI+ V  LFH H DLI GFN FLP GY+         I+ P N        +N  S ++SQ                  D+  SH +         D  Q+          S K     +P      EFN+A+ YVNKIK RF   P++Y+ FLEILH YQKEQ        R  +E EV  EVA LF  ++DLL EF  FLP++
Sbjct:   34 VEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYR---------IDIPKN------GKLNIQSPLSSQ------------------DNSHSHGDCG------EDFKQM----------SYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEA 230          
BLAST of Paired amphipathic helix protein vs. TrEMBL
Match: A0A5J4NYC3 (Paired amphipathic helix protein Sin3a OS=Paragonimus westermani OX=34504 GN=DEA37_0006550 PE=4 SV=1)

HSP 1 Score: 457.603 bits (1176), Expect = 1.019e-132
Identity = 329/969 (33.95%), Postives = 492/969 (50.77%), Query Frame = 1
Query:  154 LKVEDALKYIDRVKGRF--NEEIYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQM----------SAYQTPPIINYPDNIHPTSINIINT---------PSIVN---SQPYAIYSNSIVNPPIEVSIDSDLSHENV-----SIVESERAD-VNQIPIIQS------GNSIISLK-SISP--GIPQSQ-------TPSEFNHAVEYVNKIK---------------NRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSD---NDLCSGRRSSSGYKTIPNSTQNCYINPSNIIPVNEKSKIQCVNVPKIDSIDES-----IEKNQIDYFRPASTSVPPVSIASVSQTPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAISNRDAIKINLLSNHE----LSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNV----SIN---APXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLY-LLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIK-----PLRLINYQDISSVT--CLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVS 2796
            LKVEDAL Y+D VK RF   E IY  FLEVM++FK Q I TE VI+ V  LF GH DLIEGFN F+P GY+M          +  +   + +  +NI PT     N+         P  V    ++     + S   PP+ VS  + LS         S+   E +  VN  PI+ S       NS       ++P  GIP +            FNHAV YVNKIK               +RFQ  PDVYKRFL+IL WYQKEQ++ D ++ KQ E +V Q+VAKLFD ++DLLQEFS FLP+S    N +++   N   SG++ S    T  +S++     P  I  V+E   +      ++DS + S     ++  ++    PA+ +   +  ASVS T K                          A SA+ +     +N L++      L KIR       +  E      + +Y +F+ T+ LFN+ ++ A+ L  + +P F +  +VW+ F  ++   +   +      S D      + TVN         ++  S +N+    SIN   +P+      +    + S  +  R +++ +KL  CG+ YR+LP  F + +   + K  + +EVLN SFI   SL++ED+ FV SKK  +EE ++++EDERYE+DMV E+N+AAM  L   + R+  MT ++++ F  ++NL  +S+IL  KAI R+YGDKA D+I GLKN P+ VVP+V++R+++KD EW+E I+ ++R W +QD    L+SLD+Q  +F+ +DA + R KT++ Q+D I +       P   I     +S+T  CLI       RT  L+ P  +G+       +I  N+        H+ L++P            P  + +          LL DAASL+IHH+KRQ+N SK+DK  MK LMR  +QD F+ ERF +S
Sbjct:    4 LKVEDALFYLDEVKERFAGQEAIYMDFLEVMREFKTQTIGTEVVIRRVRELFDGHPDLIEGFNNFIPQGYRMDTVSSRGCATAGCRASSVTSATENISPTKTFTTNSKSEGTDWTIPGCVALNVARQLECTTRSGFGPPV-VSGTTLLSESATVRSFNSMAPPEASSAVNSQPILGSMFQENLANSAFRGPCGMTPNAGIPNAHIYQQQQQQAQSFNHAVHYVNKIKVGINRIGNRESNQLQHRFQGFPDVYKRFLDILQWYQKEQRHSDPLRGKQAEKQVYQDVAKLFDGQEDLLQEFSMFLPESTGVTNAVTEAFINRKISGQQQS----TADSSSEMVISVPQVINRVSEGISMALSCRQRLDSTNVSAHLPTLDAKKLKRLAPAANTQTSLLNASVSATKK--------------------------ARSAVRDTSVADVNQLASGLDISLLHKIR-------LLLEADNAGGDRSYQTFLQTLSLFNRNLITADTLLESTRPLFPRNIDVWKRFCDMISTASPRSQHDQPTGSPD----VRSQTVNDVWDKEKCDREWRSSNNIPAYDSINFQSSPSSISAGNNHVLPLTSDGINKRLDLDFAKLRTCGTSYRVLPASFPQSKCSGRLKCPVAREVLNDSFISFSSLTSEDSQFVSSKKNQYEEHMYRVEDERYEVDMVTELNRAAMQNLVVAKRRMDRMTQEELSRFTLDDNLGGTSAILMRKAIHRVYGDKAGDVIYGLKNCPSKVVPVVIQRMRQKDSEWREAIRTYQRSWEEQDARNYLRSLDHQGASFKQRDAPLIRSKTMVSQIDAIARDDRHWHIPADPIGAMISASLTQHCLI------TRT-DLKTPGTFGS------ALINVNEGYRDPGAPHLSLVYPS-----------PAVRNL----------LLEDAASLIIHHVKRQTNTSKEDKRTMKFLMRTVVQDFFMAERFPMS 896          

HSP 2 Score: 112.079 bits (279), Expect = 8.032e-21
Identity = 57/138 (41.30%), Postives = 89/138 (64.49%), Query Frame = 1
Query: 2878 KENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFK 3291
            +E HY L  GN  WY F+RL+HLL+ RL   + ++ +L  +   EK     + A++L  K+  +++P DYY  A+NLVKDLLD  ED   +ED++R MFGI+ Y WF++D+L+  +V+QL  ++  D  S +L+AL +
Sbjct: 1034 REEHYTLLYGNNHWYAFLRLHHLLLCRLHLFRSRSTELSIQATIEKNSTPIQAAEVLRLKRHGEMDPSDYYGNALNLVKDLLDGGEDVNRYEDRLRNMFGIYAYPWFTLDRLVINIVRQLHALTSGDELSSRLTALHR 1171          
BLAST of Paired amphipathic helix protein vs. TrEMBL
Match: A0A183R0W2 (HDAC_interact domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 1.095e-126
Identity = 322/958 (33.61%), Postives = 496/958 (51.77%), Query Frame = 1
Query:  154 LKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAY-----------------QTPPIINYPDNIHPTS-----INIINTPS----------IVNS--QPYA-------IYSNSI---VNPPIEVSIDSDLSHENVSIVESERADV------NQIP--IIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSDNDLCSGRRSSSGYKTIPNSTQNCYINPSNIIP--VNEKSK------IQCVNVPKIDSIDESIEKNQIDYFRPASTSVPPVSIASVSQTPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAISNRDA------IKINLLSNHELSKIRHFDVISAMCQELLELP-SETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLL-------EKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLY-LLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVS 2796
            LKVEDAL Y+D+VK RF+ +  IY  FL+VM+DFKAQ I TE VI+ V  LF GH DLI GFNTF+P GY+M                    +T   I+  DN+ P       + I   PS          +V+S  +P +       + SNS+      P+ V +  ++  +N S+  S +  +        +P  +++S ++  +L        Q Q    F+HA++YVNKIKNRFQ  PDVYKRFL+IL WYQKEQ++ D + RKQ E +V Q+VAKLF  ++DLLQEFS FLP+S    + +++  +    R +S Y  +  S     ++PS  +P  +N  S+        C   P  +    + +  ++    PA +  P             N+V  LN           P K+ R++   +S  DA      I I+LL      KIR  D + A      + P    +Y +F+  + LFN+RI++A++L     P F +  EVW+ F   +       E+   H + +T    +D  +  D   + S +       D  +L N   N P  ++  + S  S        R +++ +KL  CG  YR LP  F + +   + K  + KEVLN S+I   SL++ED+ FV SKK  +EE+++++EDERYE+DMV E+N+AAM  L  ++  +  M+ +++N F+ ++ L  +S++L  KAI R+YGDKA D+I GLKN P  V+P+V++R+++KD EW+E I+ ++R W DQD    L+SLD+Q   F+ +DA   R KT++ Q++ I +    ++ +    S     + S L T+R          GT+  +   V+E N++   +   H+ L++P            P   +           LL DAASL+IHH+KRQSN SK+DK +MK L+R  +QDIF+  RF +S
Sbjct:    5 LKVEDALSYLDQVKARFSGQGAIYMDFLDVMRDFKAQTIGTEVVIRRVRELFEGHPDLITGFNTFIPQGYRMDTLTSHQSLNAKPTCTVIPSRTTLSISSADNVTPVKGICALLKITEAPSEWTPPGSLTSLVSSHHEPASRPNSYVPVVSNSLPLTSASPVHV-LTPNIQPDNPSLNSSSQQQLLPTDCQENLPNVMLRSSHNTSNLTHSPHVYQQHQQIQSFHHALQYVNKIKNRFQGIPDVYKRFLDILQWYQKEQRHSDPMCRKQAELQVYQDVAKLFGGQEDLLQEFSQFLPESFGVTSAVTETII---NRKNSSYSQLSGSD---VLDPSVPVPHLINRVSEGISLALSSCKQRPSQEGSPANPDTKKLKRLAPAQSIFP-------------NVVPSLN-----------PPKKSRSSVRDVSVVDANQLTTGIGISLLQ-----KIR--DALDA------DSPVGNRSYQTFLQNVCLFNRRIISADELLEATHPLFLRHVEVWKRFSDFIMSSRNSSEEGFGHLQHHTHGFGRDK-HDRDKHNICSFLCDPHACSD--ALPNNMNNQPPASLISLVSEVSQK------RLDLDFTKLRTCGVSYRALPSNFPQSKCSGRQKCPVAKEVLNDSYISFSSLTSEDSQFVSSKKNQYEENMYRVEDERYEVDMVTELNRAAMQNLVVVKRCMDRMSKEELNQFHLDDKLGGTSAVLMKKAIHRVYGDKAGDVIYGLKNCPNTVLPLVIQRMRQKDSEWRETIRNYQRSWADQDARNYLRSLDHQGATFKQRDAPFIRSKTMISQIETIARND--KIPSCHSTSDPVGKMISTLITQRNLISRDISNPGTMGSALANVLEGNNEDESA---HLTLVYP------------PPDVR---------NTLLEDAASLIIHHVKRQSNASKNDKRSMKCLIRTVLQDIFMANRFPMS 883          

HSP 2 Score: 103.605 bits (257), Expect = 2.649e-18
Identity = 56/138 (40.58%), Postives = 84/138 (60.87%), Query Frame = 1
Query: 2878 KENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFK 3291
            K   Y +  GN  WY F+RL+HLL+ RL  L+        ++  E+ +   + A++L  ++     P  YY  A+NLVKDLLD  ED   FED++R+MF I+ Y WF+MD+LI  +V+QLQ ++  D  SR+L+AL +
Sbjct: 1018 KNECYSVLYGNNHWYSFLRLHHLLLCRLHHLRSYCAVAAQQFTLERDEYHVQAAEVLRLRRHGGTEPSQYYSRALNLVKDLLDGGEDINTFEDRLRDMFSIYAYPWFTMDRLIINIVRQLQALASGDELSRRLTALHR 1155          
BLAST of Paired amphipathic helix protein vs. TrEMBL
Match: A0A504Z318 (Paired amphipathic helix protein Sin3a OS=Fasciola gigantica OX=46835 GN=FGIG_00773 PE=4 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 2.022e-126
Identity = 313/953 (32.84%), Postives = 481/953 (50.47%), Query Frame = 1
Query:  154 LKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAY--------------------QTPPIINYPDNIHPTS-----INIINTPSIVNSQ---PYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSG------NSIISLKSI--SPGIPQSQTPSE----------FNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSDNDLCSGRRSSSGYK-TIPNSTQNCYINPSNIIPVNEKSKIQCVNVP----KIDSIDESIEKNQIDYF---------RPASTSVPPVSIASVSQTPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTA--------KDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLY-LLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVK-IKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVS 2796
            LKVEDAL Y+D+VK RF  +  IY  FL+VM++FK Q I TE VI+ V  LF GH DLI GFNTF+P GY+M A                        P+  Y  N+  +            PS ++ Q       Y  S   PP+  S  S     +     +      Q P++ S       N++    S+  S G PQ   PS           FNHA+ YVNKIKNRFQ  PD Y+RFL+IL WYQKEQ++ D ++RKQ E +V Q+V+KLFD ++DLLQEFS FLP+S    + ++++ +  GR+ S   + T P+   N    P+ + PV+  S+   V  P    +++S + S+  + + +          R A     P+S++S   TP     +  +  R +S S+          +  +++ DA+ +     H++      D  S           + AY +F   + LFN+ +++ E+L    +  F + S+VW+ F         HD +         S  Y +  +   + S S+         +D  SLS+ S  AP +    +++     ++    R +++ SKL +CG+ YR LP  F + +   + K  I KEVLN SFI   SL++ED+ FV SKK  +EE+++++EDERYE+DMV E+N+ AM  L  ++ ++  M  +++  F  ++NL  +S+IL  KAI R+YGDKA D+I GLK  P  VVP+V++R+++KD EW+E I+ ++R W +QD    L+SLD+Q   F+ +DA + R KT++ Q++ I K  K    I     + ++  +     T RT     P   G+       +I  N+        H+ L++P                       +    LL DAASL+IHH+KRQSN SK+DK  MK L+R  +QDIF+ +RF +S
Sbjct:    5 LKVEDALSYLDQVKARFAGQGAIYTDFLDVMREFKTQTIGTEAVIRRVRELFEGHPDLIVGFNTFIPQGYRMEAPVSRLNNTTSGRSNLAVSALDHVSPVKTYSTNVKSSEGASDWCGSTTLPSSISGQHENRVGGYGASASVPPLTGSPPSKTQISD----GASYGPATQQPLLGSNYQENYPNTVRGPYSVTTSVGTPQP-IPSHVYQQQQQAQSFNHALLYVNKIKNRFQGNPDAYRRFLDILQWYQKEQRHSDPLRRKQAELQVYQDVSKLFDGQEDLLQEFSQFLPESTGVTSAVTESII--GRKFSGHVQPTCPDPNPNEASLPA-LQPVSRISEGPNVTPPAIRQRLESPNASVLSSTVTHVVNSDTKKLKRLAPAPSVPLSMSSNLNTPGGAAKKSRSNIRDVSISD---------VNQLVTSVDAVLL-----HKIRVALDADGPSG----------DRAYQTFQQILKLFNRNMLSVEELLEATRSLFPRHSDVWKRF---------HDMIML-------STPYSSPELGGILGSQSSDVRDKDKPDRDRCSLSDDSHEAPGLGHLSLNAFAEDAAQK---RLDLDFSKLRLCGTSYRALPSNFPQSKCSGRQKCPIAKEVLNDSFISFSSLTSEDSQFVSSKKNQYEENMYRVEDERYEVDMVTELNRMAMHNLVVVKRKMDNMKREELAQFQLDDNLSGTSAILMRKAIHRVYGDKAGDVILGLKTCPETVVPLVIQRMRQKDTEWREAIRGYQRSWAEQDARNYLRSLDHQGATFKQRDAPLIRSKTMVSQIEAIAKDDKSCHGITDPVGTMISASLTQHCLTART-DFNSPGTIGS------ALINVNEGYKEPGTPHLALVYP---------------------PTVVRNTLLEDAASLIIHHVKRQSNTSKEDKRTMKFLVRTVVQDIFMADRFPMS 878          

HSP 2 Score: 115.161 bits (287), Expect = 8.923e-22
Identity = 58/137 (42.34%), Postives = 91/137 (66.42%), Query Frame = 1
Query: 2881 ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFK 3291
            E +Y L  GN  WY  IRL+HLL+ RL   + ++ ++ S+  +++   I + A+LL  ++     P DYY  A+NLVKDLLD  ED + +ED++R+MFGI+ Y WF+MD+LI  +V+QLQ ++  D  SR+L+ L++
Sbjct: 1013 EEYYSLLYGNNHWYAIIRLHHLLLCRLHLFRSRSVEVSSRIVDKQDPPI-QAAELLRLRRFGGTEPSDYYHRALNLVKDLLDGGEDISTYEDRLRDMFGIYAYPWFTMDRLIINIVRQLQALASGDELSRRLTNLYR 1148          
BLAST of Paired amphipathic helix protein vs. TrEMBL
Match: A0A4S2MG10 (HDAC_interact domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001663 PE=4 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 3.700e-126
Identity = 305/956 (31.90%), Postives = 472/956 (49.37%), Query Frame = 1
Query:  154 LKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIIN--TPSIVNSQPY----------------------------AIYSNSIVNPPIEVSIDSDLSH-----ENVSIVESERADVNQIPI-----------IQSGNSIISLKSISPGIPQSQT--------PSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSDNDLCSGRRSSSGYKTIPNSTQNCYINPSNIIPVNEKSKIQCVNVPKIDSIDES-------IEKNQIDYFRPASTSVPPVSIASVSQTPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNV----------FWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLY-LLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVK-IKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVS 2796
            LKVEDAL Y+D VK RF  +  IY  FL+VM++FK Q I TE VI+ V  LF GH DLI GFN F+P  Y+M A    P+   P     T+I + N  TP+I N  P                             A+   S  +P +   I S L +      N +  +   A  +Q+ +            +   S+       P +P +             FNHA+ YVNKIKNRFQ  P+ Y+RFL+IL WYQ+EQ++ D  +RK  E +V Q+VAKLFD ++DLLQEF  FLP+S    N +++N +  GR+S+   ++   ++      P  I  ++E   +   +  + DS   +       ++  ++    PA  S P VS  ++S  PK+                            AI +     +N L+      + H  + S +C    +  S+ AY +F+  ++LFN+  ++A++L  +V+P F +  +VW+     +   +   + YT     DSS +  T   +         K       +S N P+       ++                    R +++  KL  CG+ YR LP  F + +   + K  I +EVLN S+I   SL++ED+ FV SKK  +EE ++++EDERYE+DMV E+N+AAM  L  ++ R+  M+ D++N F  ++NL  +S+IL  KAI R+YGDKA D+I GLKN P+  VP+V++R+++KD EW++ I+ ++R W +QD    L+SLD+Q   F+ +DA + R KT++ Q++ I    K  R       S ++  +     T RT  L+ P  +G+       +I  N+    +   H+ L++P            P  + +          LL DAASL+IHH+KRQSN SK+DK  MK LMR  +QD+F+ ERF +S
Sbjct:    5 LKVEDALSYLDEVKERFAGQGAIYTDFLDVMREFKMQTIGTEVVIRRVRELFEGHTDLIVGFNNFIPQAYRMDA----PVSRCPS----TNIGVRNSGTPAIENISPPKKSSTKSADNSADWEASAFLSSVPIPHDAVGRQSAYSPSV-TCISSGLDNLPPRSNNAASSDQSVAATSQVLLTTYNEGLQTQSFRGAYSVACGAGAHPTVPSTNVYHHQQQQQVQSFNHALHYVNKIKNRFQGVPNAYQRFLDILQWYQREQRHADPSRRKLAEKQVYQDVAKLFDGQEDLLQEFGQFLPESTGVTNAVTENLI--GRKSTGQSQSNSENSPEGVPLPQTISRISEGLTLTLSSRQRQDSSVSNATAPLLNVDLKKLKRLAPAPQSTPCVSNNALSTAPKK-------------------------CRPAIRDVSVTDVNQLAGGVDVSLLH-KIRSVLC---TDNGSDRAYQTFLQALNLFNRNELSADELLQSVRPLFPRHPDVWRRLCDTVSSASP--RPYT-----DSSGVNPTGHGSVIASERDREKHDREFRLLSSNVPSAFDIQPDANPGPPLTGGGSGIPLLDVGHKRLDLDFMKLRTCGTSYRALPSNFPQSKCSGRLKCPIAREVLNDSYISFSSLTSEDSQFVSSKKNQYEEHMYRVEDERYEVDMVTELNRAAMQNLVVVKRRMDRMSQDELNRFTLDDNLSGTSAILMRKAIHRVYGDKAGDVIYGLKNRPSTAVPLVIQRMRQKDSEWRDAIRTYQRSWAEQDARNYLRSLDHQGATFKQRDAPLIRSKTMVSQIEAIAGDDKSCRTPPDPIGSMISASLTQRCLTVRT-DLKTPGTFGS------ALINVNEGYKENGAPHLALVYP-----------PPPTRNL----------LLEDAASLIIHHVKRQSNTSKEDKRTMKYLMRTVVQDVFMAERFPMS 885          

HSP 2 Score: 104.375 bits (259), Expect = 1.665e-18
Identity = 56/150 (37.33%), Postives = 90/150 (60.00%), Query Frame = 1
Query: 2878 KENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQ------CSKHF 3309
            KE HY L  G+  WY F+RL+HLL+ RL   + ++ +L  +   E    + + A++L  K+   ++P DYY  A+ LVKD LD  ED   +ED++R+MFGI+ Y WF++D+L+  +V+QL  ++  D  S +L++L +       CS  F
Sbjct: 1020 KEEHYSLLYGSNHWYAFLRLHHLLLCRLHLFRSRSLELSMQAASENNAPV-QAAEVLRLKRCGGVDPSDYYSRALKLVKDFLDGGEDVTVYEDRLRDMFGIYAYPWFTLDRLVNNIVRQLHALASGDELSHRLTSLHRSWVSGSTCSSPF 1168          
BLAST of Paired amphipathic helix protein vs. TrEMBL
Match: A0A095C6L2 (Paired amphipathic helix protein Sin3a OS=Schistosoma haematobium OX=6185 GN=MS3_06033 PE=4 SV=1)

HSP 1 Score: 437.573 bits (1124), Expect = 1.665e-125
Identity = 323/954 (33.86%), Postives = 502/954 (52.62%), Query Frame = 1
Query:  154 LKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQM------SAYQTPPI-----------INYPDNIHPTS-----INIINTPS----------IVNS--QPYA-------IYSNSI---VNPPIEVSIDSDLSHENVSIVESER-----ADVNQ-IP--IIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSDNDLCSGRRSSSGYKTIPNSTQNCYINPSNIIP--VNEKSKIQCVNVPKIDSIDESIEKNQIDYFRPASTSVPPVSIASVSQTPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAISNRDA------IKINLLSNHELSKIRHFDVISAMCQELLELP-SETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLL-------EKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDC--NSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLY-LLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVS 2796
            LKVEDAL Y+D+VK RF+ +  IY  FL+VM+DFKAQ I TE VI+ V  LF GH DLI GFNTF+P GY+M       ++   P            I+  DN+ P       + I   PS          +V+S  +P +       + SNS+      P+ V +  ++  +N +   S +     AD  + +P  +++S ++  +L        Q Q    F+HA++YVNKIKNRFQ  PDVYKRFL+IL WYQKEQ++ D + RKQ E +V Q+VAKLF  ++DLLQEFS FLP+S    + +++  +    R +S Y  +  S     ++PS  +P  +N  S+        I     S ++       PA+     +   + +Q+   N+V  LN           P K+ R++   +S  DA      I I+LL      KIR  D + A      + P    +Y +F+  + LFN+RI++A++L     P F +  EVW+ F   +       ++   H + +T    +D     D   + S +    T  D   NS++N     P   ++L+S ++         R +++ +KL  CG  YR LP  F + +   + K  + KEVLN S+I   SL++ED+ FV SKK  +EE+++++EDERYE+DMV E+N+AAM  L  ++  +  M+ +++N F+ ++ L  +S++L  KAI R+YGDKA D+I GLKN P  V+P+V++R+++KD EW+E I+ ++R W DQD    L+SLD+Q   F+ +DA   R KT++ Q++ I +    ++ +    S     + S L T+R          GT+  +   V+E N++   +   H+ L++P            P   +           LL DAASL+IHH+KRQSN SK+DK +MK L+R  +QDIF+  RF +S
Sbjct:    4 LKVEDALSYLDQVKARFSGQGAIYMDFLDVMRDFKAQTIGTEVVIRRVRELFEGHPDLITGFNTFIPQGYRMDTLTSHQSFNAKPTCTVIPSRTTLSISSADNVTPVKGICALLKITEAPSEWTPPGGLTSLVSSHHEPASRQNSYVPVVSNSLPLTSASPVHV-LTPNIQPDNPNFNSSSQQQLLPADCQENLPNVMLRSSHNASNLTHSPHVYQQHQQIQSFHHALQYVNKIKNRFQGIPDVYKRFLDILQWYQKEQRHSDPMCRKQAELQVYQDVAKLFGGQEDLLQEFSQFLPESFGVTSAVTETII---NRKNSSYSQLSGSDA---LDPSVPVPHLINRVSE-------GISLALSSCKQRPGQEGSPANPDAKKLKRLAPTQSIFPNVVPSLN-----------PPKKSRSSVRDVSVVDANQLTTGIGISLLQ-----KIR--DALDA------DSPVGNRSYQTFLQNVCLFNRRIISADELLEATHPLFLRHVEVWKRFSDFIMSSRNSSQEGFGHLQSHTHGFGRDKQDR-DKNNICSFLCDPHTCSDAPPNSMNN---QPPASLISLVSEASQK-------RLDLDFTKLRTCGVSYRALPSNFPQSKCSGRQKCPVAKEVLNDSYISFSSLTSEDSQFVSSKKNQYEENMYRVEDERYEVDMVTELNRAAMQNLVVVKRCMDRMSKEELNQFHLDDKLGGTSAVLMKKAIHRVYGDKAGDVIYGLKNCPNTVLPLVIQRMRQKDSEWRETIRNYQRSWADQDARNYLRSLDHQGATFKQRDAPFIRSKTMISQIETIARND--KIPSCHSTSDPVGKMISTLITQRNLISRDISNPGTMGSALANVLEGNNEDESA---HLTLVYP------------PPDVR---------NTLLEDAASLIIHHVKRQSNASKNDKRSMKCLIRTVLQDIFMANRFPMS 882          

HSP 2 Score: 103.99 bits (258), Expect = 2.337e-18
Identity = 56/138 (40.58%), Postives = 84/138 (60.87%), Query Frame = 1
Query: 2878 KENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFK 3291
            K   Y +  GN  WY F+RL+HLL+ RL  L+        ++  E+ +   + A++L  ++     P  YY  A+NLVKDLLD  ED   FED++R+MF I+ Y WF+MD+LI  +V+QLQ ++  D  SR+L+AL +
Sbjct: 1017 KNECYSVLYGNNHWYSFLRLHHLLLCRLHHLRSYCAVAAQQFTLERDEYHVQAAEVLRLRRHGGTEPSQYYSRALNLVKDLLDGGEDINTFEDRLRDMFSIYAYPWFTMDRLIINIVRQLQALASGDELSRRLTALHR 1154          
BLAST of Paired amphipathic helix protein vs. Ensembl Cavefish
Match: sin3aa (SIN3 transcription regulator family member Aa [Source:ZFIN;Acc:ZDB-GENE-070620-3])

HSP 1 Score: 189.119 bits (479), Expect = 5.405e-48
Identity = 128/299 (42.81%), Postives = 169/299 (56.52%), Query Frame = 1
Query:   67 HSHFPSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIH---PTSINIINTPSIVN-SQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLK----SISPGIP--QSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            H+H P+   +   G Q +          +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  IH   P  I++ N P   + SQ  A  S+    PP + S  S    ++ ++  S + + + IP   S  S         S +P  P  Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  134 HAHPPNPTAS-AQGQQQFQ---------RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQIHHITPHGISVQNIPPTPHQSQLPAPVSSGAAPPPTQPSQKSK-PLQSPALTPSSQPNPS-IPPYASPRSPPPQPHTPVSSTPNAPPLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 414          

HSP 2 Score: 183.726 bits (465), Expect = 2.246e-46
Identity = 95/214 (44.39%), Postives = 142/214 (66.36%), Query Frame = 1
Query: 1726 VELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI 2364
            ++ S  +  G  YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  M+ ++   F  +  L  +S I+  KAIQRIYGDKA+DII+GLK +PA+ VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R KTLL +++ I
Sbjct:  573 IDYSSCKRLGFSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLETVQKKLSRMSAEEQAKFRLDNTLGGTSEIIHRKAIQRIYGDKAMDIIDGLKKNPAVSVPIVLKRLKLKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGINFKQNDTKVLRSKTLLNEIESI 783          

HSP 3 Score: 114.775 bits (286), Expect = 3.640e-25
Identity = 79/231 (34.20%), Postives = 121/231 (52.38%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEE------------DSVNGNNCHLDTSSCSRIK------NNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADL-----------LLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQII 3246
            +L DAA+L+IHH+KRQ++  K+DK  +K ++   + D+   +R  +SD EE             S   N      S+ S  K      N+A +     +  Y LF  N  WY+F+RL+H L  RL  L  +AE+ + +   E+    +EV  L           L  K+   ++ EDYY   + +V++LLD   + + +ED +REMF IH YI F+MDKLI ++V+QLQ I
Sbjct:  813 ILEDAAALIIHHVKRQTSIQKEDKYKIKQIIYHFIPDMLFSQRGALSDAEEEEDEEDMELDEGGSKKHNGLAEAGSAGSPPKSKLLFSNSAAQKLRTCDEAYNLFFVNNNWYIFLRLHHTLCSRLLRLYAQAERQIEEDIRERDWE-REVLGLKRDKNDNPAIQLRLKEPMDIDVEDYYSAFLEMVRNLLDGNMEASQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI 1042          
BLAST of Paired amphipathic helix protein vs. Ensembl Cavefish
Match: sin3ab (SIN3 transcription regulator family member Ab [Source:ZFIN;Acc:ZDB-GENE-030131-2066])

HSP 1 Score: 186.808 bits (473), Expect = 1.917e-47
Identity = 126/286 (44.06%), Postives = 160/286 (55.94%), Query Frame = 1
Query:  100 TSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIH---PTSINIINTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSI-SPGIPQSQTPS----EFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            T+G Q +          +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  IH   P  I++ N P     Q       S   P   +++ S  +   +S      A     P  Q   SI S  S  SP + QS TP+    EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:  110 TAGQQQFQ---------RLKVEDALSYLDQVKLQFGNQPHVYNDFLDIMKEFKSQSIDTPGVINRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQIHHITPHGISVQNIPITPQHQNQPPAPTSTAAP---LTVPSQPTPAKISKPIQSPA---LTPTSQPNPSIPSYASPRSPSV-QSHTPNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 373          

HSP 2 Score: 137.887 bits (346), Expect = 2.821e-32
Identity = 73/169 (43.20%), Postives = 109/169 (64.50%), Query Frame = 1
Query: 1726 VELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLER-LKEKDVEWKEKI 2229
            ++ S  +  G  YR LP+ F +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q RL  M+ ++   F  +  +  SS ++  KAIQRIYG+KA DII+GLK +PA+ VPIVL+R L E+DV    +I
Sbjct:  533 IDYSSCKRLGFSYRALPKSFQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLETVQKRLSRMSAEEQAKFRLDNTMGGSSEVIHRKAIQRIYGEKAADIIDGLKRNPAVSVPIVLKRKLSERDVRVLTRI 698          

HSP 3 Score: 122.479 bits (306), Expect = 1.594e-27
Identity = 79/252 (31.35%), Postives = 134/252 (53.17%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSD------------DEEDSVNGNNCHLDTSSCSRI---------KNNADKENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF-KQCSKHFYG 3315
            +L DAASL+IHH+KRQS+  KDDK  +K ++   + D+   +R  +SD             E++    +N    T++ S++         +     +  Y LF  N  WY+F+RL+H+L  RL  +  +AE+ + +   E          K++     A  L  ++   ++ EDYY   + +V++LLD   +T+ +ED++REMF IH YI F+MDKLI ++V+QLQ I  +D    +++ L+  +C+    G
Sbjct:  760 ILEDAASLIIHHVKRQSSIHKDDKYKIKQVIYHFIPDMLFAKRGEMSDAEEEEEEDEEPEPEDEGAKKHNGTTPTTAKSKLLFSHTTPAQQKLGSCDEAYNLFCVNNNWYIFLRLHHILCSRLLRIYGQAEKQIEEETREPEWERNVLGLKREKNDSPAVQLRLREPMDIDVEDYYSAFLEMVRNLLDGNMETSQYEDQLREMFTIHAYIAFTMDKLIQSIVRQLQHI-VSDEICVQVTDLYLSECANKATG 1010          
BLAST of Paired amphipathic helix protein vs. Ensembl Cavefish
Match: sin3b (SIN3 transcription regulator family member B [Source:ZFIN;Acc:ZDB-GENE-030131-8264])

HSP 1 Score: 170.244 bits (430), Expect = 3.143e-42
Identity = 104/335 (31.04%), Postives = 172/335 (51.34%), Query Frame = 1
Query: 1363 SETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI 2364
            S+  Y +F+  I LFN+ +++  +L   V PF  K  E++  F S    + + +  +++    D  YM                                                   + V+ +  +  GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE + + EDER+E+D+V+E N A +  L  +Q +L  ++ +  + F  ++ L  +S ++  +A+ RIYGDKA +II GLK +PA  VP+VL+RLK K+ EW+E  + F + WR+Q +   LKSLD+Q +NF+  D    R K+LL +++ I
Sbjct:  372 SQEVYENFLRCIALFNQEVVSGAELLQLVTPFLGKFPELYTQFKSF---LGEKELTHSVSGLSDR-YMEGGG-----------------------------------------------REVDYASCKRLGSSYRALPKTYQQPK--CSGRTALCKEVLNDTWVSFPSWS-EDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRLSAEDQDRFRLDDCLGGTSEVIQRRAVYRIYGDKAPEIIEGLKKNPATAVPLVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQGVNFKQNDMKALRSKSLLNEIESI 652          

HSP 2 Score: 153.68 bits (387), Expect = 3.890e-37
Identity = 109/266 (40.98%), Postives = 142/266 (53.38%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQ-------------IPIIQSGNSIISLKSISPGIPQSQ-TPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQ----KNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDS 888
            KLKVEDAL Y+D+VK RF  E  IY KFL++MK+FK+Q I+T  VI  V  LFHGH DL+ GFN FLPPGY+         I  P N     +  + +P      P    S+S     +  S  S  +   VS  +SE     Q             + +     S  +  S+SP  P S+ +P EF+ A+ YVNKIK+RF   P++Y+ FLEILH YQKEQ    +N        TE EV  +VA LF  ++DLL EF  FLPD+
Sbjct:   40 KLKVEDALSYLDQVKIRFVNEPGIYNKFLDIMKEFKSQSIDTPGVINRVSQLFHGHPDLVLGFNAFLPPGYR---------IEIPKN----GMAFLQSPFTAQVSPGKGKSSSTCVGSVSSSSSSSAAVVEVSSAQSEPVASPQSASPTGPPEPSARLALPLPSQSQPATSSVSP--PTSEPSPVEFDSAISYVNKIKSRFLDHPEIYRSFLEILHTYQKEQLELKENRSRSNLGMTEDEVFSKVASLFKGQEDLLAEFGQFLPDA 290          

HSP 3 Score: 108.612 bits (270), Expect = 2.535e-23
Identity = 69/240 (28.75%), Postives = 117/240 (48.75%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDE------------------EDSVNGNNCHLDTSSCSRIKNNADK----------------ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE-----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQ 3240
            +L DAASL+I+H+KRQ    KDDK ++K +++  + D+F   R  +S+ E                  +  +NG         C+ +    D                 +  Y LF  N  WY F+RL+  L  RL  +  +AE+ + +++ E           ++    ++A  L  K+ +++  E+YY   +++V+ LLD   ++  +ED +REMF IH YI F++DKLI  +V+QLQ
Sbjct:  691 ILEDAASLIIYHVKRQPTIHKDDKDHIKRIIQHFVPDLFFSRRGELSETEDWTDEEVEGEEGGGSTGGQQQLNGEA---RRKRCNSVDGTRDPPPQEERSEEQEQQKELDGVYNLFFVNNNWYFFLRLHQTLCSRLLRVYRQAERQLLEHRAEQSAERLLVAEGRRDKATDLAMELRLKQPSEVELEEYYPAFLDMVRSLLDGNLESTQYEDTLREMFTIHAYIGFTVDKLIQNIVRQLQ 927          
BLAST of Paired amphipathic helix protein vs. Ensembl Sea Lamprey
Match: sin3ab (SIN3 transcription regulator family member Ab [Source:ZFIN;Acc:ZDB-GENE-030131-2066])

HSP 1 Score: 254.603 bits (649), Expect = 4.026e-69
Identity = 181/568 (31.87%), Postives = 280/568 (49.30%), Query Frame = 1
Query: 1726 VELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEE----------------DSVNGN-NCHLDTSSCSR--------------------IKNNADK----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYK-----EEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALF 3288
            ++ +  +  G  YR LP+ + +P+     +  +C+EVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D V+E N A +  L  +  +L  M+ +    F+ +  L  +S ++  KA+QRIYGDKA +II+GLK +PA+ VP+VL+RLK KD EW+E  + F + WR+Q + Y LKSLD+Q                                IN++   +     +SLL+   T   E  E+            E N  +SP+   H               LDY ++ K           +L DAASL+IHH+KRQ+    +DK  +K L+   + D+F   R  +SD EE                DS  G  N   D SS  +                       +A K    E+ Y L   N  WY+F+RL+ LL  RL  + ++AE+ + + +       KK   +  A  L  K+ ++L  +DYY   +++VK+LLD   +++++ED +REMF IH YI F+MDKLI  +V+QLQ I  TD    ++  L+
Sbjct:  541 IDYASCKRLGPSYRALPKSYQQPK--CSGRTPLCREVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDYVLETNLATIRVLESVHKKLSRMSEEDKARFHLDSCLGGTSEVVHRKAVQRIYGDKANEIIDGLKKNPAVAVPVVLKRLKAKDEEWREAQRGFNKIWREQNEKYYLKSLDHQG-------------------------------INFKQNDTKALRSKSLLNEIETIYDEHQEQ----------AAEGN--VSPASGPH---------------LDYEYEDKQ----------ILEDAASLIIHHVKRQTGIQTEDKHKIKQLIYHLVPDLFFGSRGELSDMEESAAGDEDAAPTVASSTDSAEGKANGPADGSSPGKGNKSEGSGGGSVTGKSKLLFATTHAHKLKGLEHVYNLMFVNNNWYIFLRLHQLLCSRLLRIYMQAERQMEEERMGSEPAAKKDKKESPAYQLRLKQPSELEVDDYYPAFLDMVKNLLDGNMESSHYEDTLREMFTIHAYIGFTMDKLIQNIVRQLQHI-VTDEVCVRVMELY 1036          

HSP 2 Score: 185.267 bits (469), Expect = 1.949e-47
Identity = 154/473 (32.56%), Postives = 219/473 (46.30%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQI----PIIQSGNSIISLKSI-------SPGIPQSQ----TPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKR----KQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSDNDLCSGRRSSSGYKTIPNSTQNCYINPSNIIPVNEKSKIQCVNVPKIDSIDESIEKNQIDYFRPASTSVPPVSIASVSQTPKRNLVQDLNTDRRIST-SNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLL 1503
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  +I+      PT             Q      +++   P+     S + H  +S  +     + +     P+  SG +  +L S        S G PQ Q     P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N          K TE EV  EVA+LF N++DLL EF  FLPD+   G++L                     T+ C                      K+DS+              A+   P +S+ S +    + L Q+ +  RR+S     PP K+    SS    +D    +   +  L +   FD +         L S   Y +F+  + LFN+ +++  +L   V PF  K  E++  F + +
Sbjct:  119 RLKVEDALSYLDQVKLQFGNQPQVYNDFLDIMKEFKSQSIDTPGVISRVSNLFKGHPDLIMGFNTFLPPGYKIEV-QTNDLISV---TTPTQSAQPVQQPPPPPQQQQQQHSNVQPHPL-----SSIPHPQLSPTQPPTPKLGKAVPSSPVTPSGPAAAALVSFPTQHAATSQGTPQPQLHSTQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNMKESGGNYLPKLTEQEVYAEVARLFKNQEDLLAEFGQFLPDAN--GSHL--------------------LTKTCE---------------------KVDSVHND---------HGATVKKPLLSMGSST----KRLSQNGSQIRRLSGPGTTPPAKKKLKPSSF---KDTSSADSSKHGSLGEFAFFDKVRKA------LKSHEVYENFLRCLVLFNQEVVSRSELVQLVFPFLGKFPELFSWFKTFV 517          
BLAST of Paired amphipathic helix protein vs. Ensembl Yeast
Match: SIN3 (Component of both the Rpd3S and Rpd3L histone deacetylase complexes; involved in transcriptional repression and activation of diverse processes, including mating-type switching and meiosis; involved in the maintenance of chromosomal integrity [Source:SGD;Acc:S000005364])

HSP 1 Score: 142.124 bits (357), Expect = 2.659e-34
Identity = 103/273 (37.73%), Postives = 151/273 (55.31%), Query Frame = 1
Query:  154 LKVEDALKYIDRVKGRFNE--EIYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTP--PI-INYPDNIHPTSINIINTPS---IVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSIS-PG---IPQSQT--PS---------EFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGN 903
            L V+DAL Y+++VK +F+   +IY  FL++MKDFK+Q I+T  VI+ V TLF G+  LI+GFNTFLP GY++     P  PI +  P  +  T++N   +PS     ++Q    +  S  N  ++   +  +   +V   E  +     +P++ + + + S++    P    IPQSQ+  P          EF+ A+ YVNKIK RF  QPD+YK FLEIL  YQ+EQK  +         EV  +V  LF N  DLL++F  FLPDS +  N
Sbjct:  219 LNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPIRVTTP--MGTTTVNNNISPSGRGTTDAQELGSFPESDGN-GVQQPSNVPMVPSSVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN---------EVYAQVTHLFQNAPDLLEDFKKFLPDSSASAN 479          

HSP 2 Score: 125.561 bits (314), Expect = 3.073e-29
Identity = 66/221 (29.86%), Postives = 123/221 (55.66%), Query Frame = 1
Query: 1708 VFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYG-DKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRD-QDLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI 2364
            V  +  ++L   E  G  Y+ LP+  T        ++ +C EVLN  ++ H   ++ED+ F+  +K  +EE++FKIE+ER+E D  +E N   +  L  +  +++ MT ++  +F     L  +S  ++ K I+++Y  ++  +II+ L  HPA+  P+VL+RLK+KD EW+   +++ + WR+ +     KSLD+  + F+  D  +   K L+ ++  I
Sbjct:  737 VHEKHRLDLDLCEAFGPSYKRLPKSDT--FMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSI 955          
BLAST of Paired amphipathic helix protein vs. Ensembl Nematostella
Match: EDO41458 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4D8])

HSP 1 Score: 293.123 bits (749), Expect = 1.046e-81
Identity = 189/555 (34.05%), Postives = 292/555 (52.61%), Query Frame = 1
Query: 1717 RKNVELSKLEI----C---GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGG---VIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNN-----------------CHLDTSS-CSRIKNNADKENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQ 3294
            R + EL+ LEI    C   G+ YR LP+ +T+P+   +S   +CKEVLN +++   S S EDTPF  ++KT +EE +F+ EDER+E+D+V+E N + +  L  +Q +L+ M++++   F  +  L  +S I+  KAIQRIYGDKA DII+G+K  PA+ VP+VL+R + K+ EW+E  +QF + WRDQ + Y LKSLD+Q I F+  D    R K+L+ +++ I                                 E+ E+    +  +GG   V  Y D                     KSILD                    DAA L++HH+KRQ++  K+DK  +K+L+   + D+F   R  +SDD EDSV   N                   LD +  C R  ++A     Y LF  N  WY+F+RL+ +L +RL  +  ++  +      +K+Q  +  A  L  K  ++++ E+YY   +++V++LLD   D+ NFED  REMFG+H YI F+MDKL+  +V+QL  I  TD    +++ L++Q
Sbjct:  438 RTSGELAHLEIDYASCKRYGTSYRALPKSYTQPKCSGRSD--MCKEVLNDTWVSFPSWS-EDTPFPGTRKTQYEEYIFRCEDERFELDVVLESNLSTIRVLEAVQKKLQRMSSEEQQKFRLDSCLGGTSEIVHKKAIQRIYGDKAPDIIDGIKKTPAVAVPLVLKR-QAKEEEWRESQRQFNKIWRDQNEKYYLKSLDHQGITFKQNDLKAMRSKSLMNEIESIFD-------------------------------ERQEQAAEGNADAGGPHIVFTYQD---------------------KSILD--------------------DAAGLIVHHMKRQTSIHKEDKAKIKLLLHCFVPDLFFAPRGELSDD-EDSVKEMNGISKPEMPNGVAEAEAVSVLDQAKRCHRYSDDA-----YNLFFINHNWYIFLRLHQILCERLQKMYQRSVAIAEAEASDKQQRKEATAIALRLKAPSEIDLEEYYPAFLDMVRNLLDGNMDSTNFEDTCREMFGVHAYIAFTMDKLVQNIVRQLHTI-VTDETGIQITELYQQ 909          

HSP 2 Score: 182.185 bits (461), Expect = 2.269e-46
Identity = 124/319 (38.87%), Postives = 169/319 (52.98%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPP---IINYPDNIHPTSINIINTP--SIVNSQPYAIYSNSIVNPPIEVSID-----SDLSH-ENVSIVES--------ERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQT---ETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSDNDLCSGRRSSSGYKTIPNSTQNCYINPSNIIPVNEKSKIQ 1035
            +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V +LF GH +LI GFNTFLPPGY++  +   P    +  P   H      +N P  + V  Q YA   N ++ P +   +      +  SH + +S + S                PI +   +   +         +Q P EFNHA+ YVNKIKNRFQ QP++YK FLEILH YQKEQKN      + T   E EV ++VAKLF N++DLL+EFS FLPD+   G N +     S  R S     +  S +N Y  P     +N K   Q
Sbjct:   22 RLKVEDALSYLDQVKLQFGNQPQVYNHFLDIMKEFKSQSIDTPGVISRVSSLFKGHPELIVGFNTFLPPGYKIEVHAHDPGSVSVTAPTGHHTQICTSLNHPPQTSVRGQTYASL-NKLIVPVLNAQLILYFLLTFFSHCQAISPLHSLLHRNSSNNNNSNRHTPITRISQARYKI---------NQQPVEFNHAINYVNKIKNRFQGQPEIYKAFLEILHTYQKEQKNIKEAAMQGTPLSEQEVYKQVAKLFQNQEDLLKEFSQFLPDAN--GGNSAGLIAASASRMSH----VTGSGRNEYSQPHKKQGMNSKRAAQ 324          
BLAST of Paired amphipathic helix protein vs. Ensembl Medaka
Match: ENSORLT00000042315.1 (paired amphipathic helix protein Sin3a [Source:NCBI gene;Acc:101163723])

HSP 1 Score: 190.274 bits (482), Expect = 2.392e-48
Identity = 131/319 (41.07%), Postives = 170/319 (53.29%), Query Frame = 1
Query:   67 HSHFPSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIH---PTSINIINTPSI---------------------------VNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDS 888
            H H PS   T T G Q        +   +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  IH   P  I++ N P+                            V +QP A    + ++ P++    +  S  N SI    S R+     P +QS   + S  S  P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+
Sbjct:  105 HVH-PSAPITSTPGQQ--------QQFQRLKVEDALSYLDQVKLQFGNQPQVYNDFLDIMKEFKSQSIDTPGVINRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQIHYITPHGISVQNIPATGASSQPSTQPQQQSLPQAGLHTTTIPPVAAQPTA----TKISKPVQSPAHTPTSQPNPSIPSYASPRS-----PSVQSHTPVSSTPSSGPPL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYTQVARLFKNQEDLLSEFGQFLPDA 398          

HSP 2 Score: 184.496 bits (467), Expect = 1.255e-46
Identity = 131/409 (32.03%), Postives = 208/409 (50.86%), Query Frame = 1
Query: 1153 TPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELL------ELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLD 2358
            T KR L   LN  +R+S  N  P KR    S+    +   K+ +  +H L+++     IS   + +        L S   Y +F+  + +FN+ +++  +L   V PF  K  E++  F + L               ++SSY        S   S+   +    ++                              ++ +  +  GS YR LP+ + +P+     +  +C+EVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q ++  M+ ++   F  +  L  SS ++  KAIQRIYGDKA DII+GLK +PA+ VPIVL+RLK KD EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  M R KTLL +++
Sbjct:  422 TVKRPL---LNNKQRLS-QNGLPIKRPAGMSATPPIKKKPKM-MGKDHSLTEL---GKISTSTETMFFEKVKKALRSAEGYENFLRCLYIFNQEVISRTELVQLVIPFLGKFPELFTWFKNFL-------------GYRESSY-----GETSHAESLPKERSTEGIA----------------------------MEIDYASCKRLGSSYRALPKSYQQPKCTG--RTPLCREVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDIVLETNLATIRVLETVQRKISRMSAEEQLRFRLDNTLGGSSEVIHRKAIQRIYGDKAHDIIDGLKRNPAVSVPIVLKRLKMKDEEWREAQRGFNKIWREQNEKYYLKSLDHQGINFKQNDTKMLRSKTLLNEIE 773          

HSP 3 Score: 118.627 bits (296), Expect = 2.489e-26
Identity = 83/252 (32.94%), Postives = 124/252 (49.21%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSV-----------NGNNCHLDTSSCSRIKN-------NADK----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQCSKHFYG 3315
            +L DAA+L+IHH+KRQ    K+DK  +K ++   + D+    R  +SD EE+              G   H   S  S +K+        A K    ++ Y LF  N  WYVF RL+H+L  RL  +  +AE+ + +   E          KK   +  A  L  K+   +  EDYY   + +V++LLD   + A +ED +REMF IH Y+ F+MDKLI  +V+QLQ +   D  SR +     +C+    G
Sbjct:  806 ILEDAAALIIHHVKRQVGIQKEDKFKIKQIINHFIPDLLFARRGELSDVEEEEEEEEEEDAEVDEGGPKKHNGLSGRSPVKSKLLFSNTTAQKLRGADDAYNLFFVNNYWYVFFRLHHILCSRLLRIYGQAEKQIEEEAREREWEKEVLGLKKDKNEHPAIQLKMKEPVDVEVEDYYSVFLEMVRNLLDGNMEPAQYEDSLREMFTIHAYVAFTMDKLIQNIVRQLQHLVTDDACSRVMDMYLNECANKGTG 1057          
BLAST of Paired amphipathic helix protein vs. Ensembl Medaka
Match: sin3b (SIN3 transcription regulator family member B [Source:NCBI gene;Acc:101165470])

HSP 1 Score: 189.504 bits (480), Expect = 3.800e-48
Identity = 139/484 (28.72%), Postives = 224/484 (46.28%), Query Frame = 1
Query: 1363 SETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPS-PDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEE 2808
            S+  Y +F+  I LFN+ +++  +L   V PF  K  E++  F S L    D +  + +    D  YM                                                   + V+ +  +  GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE + + EDER+E+D+V+E N A +  L  +Q +L  ++ +  + F  ++ L  +S ++  +++ RIYGDKA +II GLK  PA  VP+VL+RLK K+ EW+E  + F + WR+Q +   LKSLD+Q +NF+  D    R K+LL +++ I                                 E+ E+    S   GGV + +   S S  + HM+  +       K IL+                    DAA+L+I+H+KRQ    KDDK ++K +++  + D+F   R  +SD EE
Sbjct:  373 SQEVYENFLRCIALFNQEVVSGAELLQLVTPFLGKFPELYSQFKSFL---GDKELCHGVSGLSDR-YMEGGGG----------------------------------------------REVDYASCKRLGSSYRALPKTYQQPK--CSGRTALCKEVLNDTWVSFPSWS-EDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLARLSPEDQDRFRLDDCLGGTSEVIQRRSVYRIYGDKAPEIIEGLKRSPATAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQGVNFKQNDMKALRSKSLLNEIESIYD-------------------------------ERQEQ----STEEGGVGQQSRNGSASTSEPHMVFTYE-----DKQILE--------------------DAAALIIYHVKRQPTIHKDDKDHIKRIVQHFVPDLFFSRRGELSDTEE 743          

HSP 2 Score: 172.555 bits (436), Expect = 7.486e-43
Identity = 110/261 (42.15%), Postives = 147/261 (56.32%), Query Frame = 1
Query:  151 KLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQ-------MSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPI---EVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQT-PSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVK--RKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDS 888
            KLKVEDAL Y+D+VK RF  +  IY KFL++MK+FK+Q I+T  VI  V  LFHGH DL+ GFN FLPPGY+       M+  Q+P    +   + P       TP  V S      +      P+   EV   S  S  + S   +E      +P+ +  ++  ++ S+SP  P S+T P EF+ A+ YVNKIKNRF   P++Y+ FLEILH YQKEQ      +     TE EV  +VA LF  ++DLL EF  FLPD+
Sbjct:   35 KLKVEDALSYLDQVKIRFANDPGIYNKFLDIMKEFKSQSIDTPGVINRVSQLFHGHPDLVLGFNAFLPPGYRIEIPKNGMAFLQSP----FSAQVSPGQHTKNLTPPAVGSSSGPASTVHAEAGPVQTSEVKAPSSDSLSSSSTGPAEPPSRLSLPLTKESHNPAAVSSVSP--PASETSPVEFDSAISYVNKIKNRFLDHPEIYRAFLEILHTYQKEQLEAKESRGSSGMTEDEVFSKVASLFKGQEDLLAEFGQFLPDA 289          

HSP 3 Score: 87.4261 bits (215), Expect = 8.125e-17
Identity = 43/128 (33.59%), Postives = 76/128 (59.38%), Query Frame = 1
Query: 2890 YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE-----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQ 3240
            Y LF+ N  WY F+RL+  L  RL  +  +AE+ + +++ E           +++   ++A  L  K+ +++  E+YY   +++V+ LLD   D+  +ED +REMF IH YI F++DK+I  +++QLQ
Sbjct:  874 YNLFLVNNNWYFFLRLHQTLCSRLLRVYRQAERQLLEHRAEQSRERLLVAEGRREKTCDLAMELRLKQPSEVELEEYYPAFLDMVRSLLDGNLDSTQYEDTLREMFTIHAYIGFTLDKVIHNIIRQLQ 1001          
BLAST of Paired amphipathic helix protein vs. Ensembl Medaka
Match: sin3aa (SIN3 transcription regulator family member A [Source:NCBI gene;Acc:101171907])

HSP 1 Score: 186.422 bits (472), Expect = 3.469e-47
Identity = 104/261 (39.85%), Postives = 156/261 (59.77%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            GS YR LP+ + +P+     +  +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  M+ ++   F  +  L  SS ++  KAIQRIYGDKA DII+GLK +PA+ VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I                  P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  559 GSSYRALPKSYQQPKCTG--RTPLCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLETVQWKLSRMSAEEQAKFRLDNTLGGSSEVIHRKAIQRIYGDKAADIIDGLKKNPAVSVPIVLKRLKTKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENATAPTGPHLTLTYEDSQILEDAAALI--IHHVKRQTSIQKEDKY 814          

HSP 2 Score: 178.333 bits (451), Expect = 1.248e-44
Identity = 122/311 (39.23%), Postives = 166/311 (53.38%), Query Frame = 1
Query:   43 PMSNPGTDHSHFPSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIH---PTSINIINTP---SIVNSQPYAIYSNSIV-------------NPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQ----TETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            P   PG  H+  P   G+   G+Q +          +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  IH   P  I++ N P   +    QP    + +               + P++  +   L+  + S          + P +Q  +  +S     P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N            TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:   97 PSVMPGHGHTGAP--QGS-AQGHQQFQ---------RLKVEDALSYLDQVKLQFGNQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQIHHITPHGISVQNIPITGAATQQQPPLPSAPTTAAPPPLTQPTPPKPSKPLQSQV---LTPSSQSSPSIPAYTSPRSPPVQL-HPPLSGTPTGPPL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 389          

HSP 3 Score: 111.309 bits (277), Expect = 4.995e-24
Identity = 77/228 (33.77%), Postives = 117/228 (51.32%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDER------------FNVSDDEEDSVNGNNCHLDTSSCSRIK----NNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQII 3246
            +L DAA+L+IHH+KRQ++  K+DK  +K ++   + D+   +R                D EE +   +N      S S+ K    N A +     ++ Y LF  N  WY+F+RL+  L  RL  L  +AE+ + +   E          KK+     A  L  K+   +  EDYY   + +VK+LLD   + + +ED +REMF IH YI F+MDKLI ++V+QLQ I
Sbjct:  790 ILEDAAALIIHHVKRQTSIQKEDKYKIKQIIYHFLPDMLFSQRGELSDLEEEEEEEEEMDLEEGAGKKHNGVAAGGSPSKSKLLFSNTAAQKLRGCDDAYNLFFVNNNWYIFMRLHQTLCSRLLRLYGQAERQIEEEVRERDWEREVLGLKKEKNDNPAIQLRLKEPMDIEVEDYYSAFLEMVKNLLDGNMEASQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI 1017          
BLAST of Paired amphipathic helix protein vs. Ensembl Medaka
Match: sin3aa (SIN3 transcription regulator family member A [Source:NCBI gene;Acc:101171907])

HSP 1 Score: 185.267 bits (469), Expect = 5.345e-47
Identity = 104/261 (39.85%), Postives = 157/261 (60.15%), Query Frame = 1
Query: 1753 GSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI--------------VKIKPLRLINYQD---ISSVTCLIESLLHTKRTWKLEKPEKW 2481
            GS YR LP+ + +P+   ++   +CKEVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q +L  M+ ++   F  +  L  SS ++  KAIQRIYGDKA DII+GLK +PA+ VPIVL+RLK K+ EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  + R K+LL +++ I                  P   + Y+D   +     LI  + H KR   ++K +K+
Sbjct:  384 GSSYRALPKSYQQPKCTGRTP--LCKEVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLETVQWKLSRMSAEEQAKFRLDNTLGGSSEVIHRKAIQRIYGDKAADIIDGLKKNPAVSVPIVLKRLKTKEEEWREAQRGFNKIWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENATAPTGPHLTLTYEDSQILEDAAALI--IHHVKRQTSIQKEDKY 639          

HSP 2 Score: 134.035 bits (336), Expect = 4.457e-31
Identity = 95/238 (39.92%), Postives = 122/238 (51.26%), Query Frame = 1
Query:  277 VIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINY--PDNIH---PTSINIINTP---SIVNSQP-------------YAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIP--QSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVS 894
            VI  V  LF GH DLI GFNTFLPPGY++   QT  ++N   P  IH   P  I++ N P   +    QP                 +    + P++  +   L+  + S          + P +Q    +    S +P  P  Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+ S
Sbjct:    1 VISRVSQLFKGHPDLIMGFNTFLPPGYKIEV-QTNDLVNVTTPGQIHHITPHGISVQNIPITGAATQQQPPLPSAPTTAAPPPLTQPTPPKPSKPLQSQV---LTPSSQSSPSIPAYTSPRSPPVQLHPPL----SGTPTGPPLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYAQVARLFKNQEDLLSEFGQFLPDANS 225          

HSP 3 Score: 110.153 bits (274), Expect = 9.763e-24
Identity = 77/228 (33.77%), Postives = 117/228 (51.32%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDER------------FNVSDDEEDSVNGNNCHLDTSSCSRIK----NNADK-----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQII 3246
            +L DAA+L+IHH+KRQ++  K+DK  +K ++   + D+   +R                D EE +   +N      S S+ K    N A +     ++ Y LF  N  WY+F+RL+  L  RL  L  +AE+ + +   E          KK+     A  L  K+   +  EDYY   + +VK+LLD   + + +ED +REMF IH YI F+MDKLI ++V+QLQ I
Sbjct:  615 ILEDAAALIIHHVKRQTSIQKEDKYKIKQIIYHFLPDMLFSQRGELSDLEEEEEEEEEMDLEEGAGKKHNGVAAGGSPSKSKLLFSNTAAQKLRGCDDAYNLFFVNNNWYIFMRLHQTLCSRLLRLYGQAERQIEEEVRERDWEREVLGLKKEKNDNPAIQLRLKEPMDIEVEDYYSAFLEMVKNLLDGNMEASQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHI 842          
BLAST of Paired amphipathic helix protein vs. Ensembl Medaka
Match: ENSORLT00000001808.2 (paired amphipathic helix protein Sin3a [Source:NCBI gene;Acc:101163723])

HSP 1 Score: 185.267 bits (469), Expect = 8.012e-47
Identity = 123/293 (41.98%), Postives = 162/293 (55.29%), Query Frame = 1
Query:   67 HSHFPSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEE--IYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQM------SAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSI--VESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKN---------PDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDS 888
            H H PS   T T G Q        +   +LKVEDAL Y+D+VK +F  +  +Y  FL++MK+FK+Q I+T  VI  V  LF GH DLI GFNTFLPPGY++       A   P       ++    ++    P +  +QP A    + ++ P++    +  S  N SI    S R+     P +QS   + S  S  P + Q+  P EFNHA+ YVNKIKNRFQ QPD+YK FLEILH YQKEQ+N         P L     TE EV  +VA+LF N++DLL EF  FLPD+
Sbjct:  105 HVH-PSAPITSTPGQQ--------QQFQRLKVEDALSYLDQVKLQFGNQPQVYNDFLDIMKEFKSQSIDTPGVINRVSQLFKGHPDLIMGFNTFLPPGYKIENIPATGASSQPSTQPQQQSLPQAGLHTTTIPPVA-AQPTA----TKISKPVQSPAHTPTSQPNPSIPSYASPRS-----PSVQSHTPVSSTPSSGPPL-QNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPAL-----TEQEVYTQVARLFKNQEDLLSEFGQFLPDA 372          

HSP 2 Score: 184.496 bits (467), Expect = 1.460e-46
Identity = 131/409 (32.03%), Postives = 208/409 (50.86%), Query Frame = 1
Query: 1153 TPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELL------ELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLD 2358
            T KR L   LN  +R+S  N  P KR    S+    +   K+ +  +H L+++     IS   + +        L S   Y +F+  + +FN+ +++  +L   V PF  K  E++  F + L               ++SSY        S   S+   +    ++                              ++ +  +  GS YR LP+ + +P+     +  +C+EVLN +++   S S ED+ FV SKKT +EE +++ EDER+E+D+V+E N A +  L  +Q ++  M+ ++   F  +  L  SS ++  KAIQRIYGDKA DII+GLK +PA+ VPIVL+RLK KD EW+E  + F + WR+Q + Y LKSLD+Q INF+  D  M R KTLL +++
Sbjct:  396 TVKRPL---LNNKQRLS-QNGLPIKRPAGMSATPPIKKKPKM-MGKDHSLTEL---GKISTSTETMFFEKVKKALRSAEGYENFLRCLYIFNQEVISRTELVQLVIPFLGKFPELFTWFKNFL-------------GYRESSY-----GETSHAESLPKERSTEGIA----------------------------MEIDYASCKRLGSSYRALPKSYQQPKCTG--RTPLCREVLNDTWVSFPSWS-EDSTFVSSKKTQYEEHIYRCEDERFELDIVLETNLATIRVLETVQRKISRMSAEEQLRFRLDNTLGGSSEVIHRKAIQRIYGDKAHDIIDGLKRNPAVSVPIVLKRLKMKDEEWREAQRGFNKIWREQNEKYYLKSLDHQGINFKQNDTKMLRSKTLLNEIE 747          

HSP 3 Score: 118.627 bits (296), Expect = 2.717e-26
Identity = 83/252 (32.94%), Postives = 124/252 (49.21%), Query Frame = 1
Query: 2656 LLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSV-----------NGNNCHLDTSSCSRIKN-------NADK----ENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEE----------KKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQCSKHFYG 3315
            +L DAA+L+IHH+KRQ    K+DK  +K ++   + D+    R  +SD EE+              G   H   S  S +K+        A K    ++ Y LF  N  WYVF RL+H+L  RL  +  +AE+ + +   E          KK   +  A  L  K+   +  EDYY   + +V++LLD   + A +ED +REMF IH Y+ F+MDKLI  +V+QLQ +   D  SR +     +C+    G
Sbjct:  780 ILEDAAALIIHHVKRQVGIQKEDKFKIKQIINHFIPDLLFARRGELSDVEEEEEEEEEEDAEVDEGGPKKHNGLSGRSPVKSKLLFSNTTAQKLRGADDAYNLFFVNNYWYVFFRLHHILCSRLLRIYGQAEKQIEEEAREREWEKEVLGLKKDKNEHPAIQLKMKEPVDVEVEDYYSVFLEMVRNLLDGNMEPAQYEDSLREMFTIHAYVAFTMDKLIQNIVRQLQHLVTDDACSRVMDMYLNECANKGTG 1031          
BLAST of Paired amphipathic helix protein vs. Planmine SMEST
Match: SMESG000034807.1 (SMESG000034807.1)

HSP 1 Score: 2823.88 bits (7319), Expect = 0.000e+0
Identity = 1380/1383 (99.78%), Postives = 1381/1383 (99.86%), Query Frame = 1
Query:   46 MSNPGTDHSHFPSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEEIYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSDNDLCSGRRSSSGYKTIPNSTQNCYINPSNIIPVNEKSKIQCVNVPKIDSIDESIEKNQIDYFRPASTSVPPVSIASVSQTPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPXXXXXXXXXXXXXXXKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSRIKNNADKENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQCSKHFYGQDERENKLKINITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTKCSGHMCITLLDVSPGNSSGSESQEDASKIKEEPSSSTPAIPHVSKSVISESNLPPVMSWKHYIERYVTCSEKLGFSDGLHNIGLNKRISVPVFLLRSLRKSINNISFIKGRNDESLNEEQTDSLIKRSAQATDWHSSIVQLICYVFDGADENFLYRFLTGTVMTGHMCPVAEEGHNLLVQYETTKLTWSVGSCGVFYRINKQNNRQKVKSEYVSKVRRNRFLKFQNLWLSQQS 4194
            MSNPGTDHSHFPSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEEIYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSN+IVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSDNDLCSGRRSSSGYKTIPNSTQNCYINPSNIIPVNEKSKIQCVNVPKIDSIDESIEKNQIDYFRPASTSVPPVSIASVSQTPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPNINMNLISSSNSMLSKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVT LIESLLHTKRTWKLEKPEKWGTLSYSS GVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSRIKNNADKENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQCSKHFYGQDERENKLKINITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTKCSGHMCITLLDVSPGNSSGSESQEDASKIKEEPSSSTPAIPHVSKSVISESNLPPVMSWKHYIERYVTCSEKLGFSDGLHNIGLNKRISVPVFLLRSLRKSINNISFIKGRNDESLNEEQTDSLIKRSAQATDWHSSIVQLICYVFDGADENFLYRFLTGTVMTGHMCPVAEEGHNLLVQYETTKLTWSVGSCGVFYRINKQNNRQKVKSEYVSKVRRNRFLKFQNLWLSQQS
Sbjct:    1 MSNPGTDHSHFPSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVKGRFNEEIYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFLPPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNTIVNPPIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQSQTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRKQTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSDNDLCSGRRSSSGYKTIPNSTQNCYINPSNIIPVNEKSKIQCVNVPKIDSIDESIEKNQIDYFRPASTSVPPVSIASVSQTPKRNLVQDLNTDRRISTSNHPPTKRLRTASSAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNTIDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDSSKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPNINMNLISSSNSMLSKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNYSFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTYLIESLLHTKRTWKLEKPEKWGTLSYSSAGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSRIKNNADKENHYKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISCTDNFSRKLSALFKQCSKHFYGQDERENKLKINITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTKCSGHMCITLLDVSPGNSSGSESQEDASKIKEEPSSSTPAIPHVSKSVISESNLPPVMSWKHYIERYVTCSEKLGFSDGLHNIGLNKRISVPVFLLRSLRKSINNISFIKGRNDESLNEEQTDSLIKRSAQATDWHSSIVQLICYVFDGADENFLYRFLTGTVMTGHMCPVAEEGHNLLVQYETTKLTWSVGSCGVFYRINKQNNRQKVKSEYVSKVRRNRFLKFQNLWLSQQS 1383          
BLAST of Paired amphipathic helix protein vs. Planmine SMEST
Match: SMESG000036802.1 (SMESG000036802.1)

HSP 1 Score: 165.236 bits (417), Expect = 1.593e-41
Identity = 130/508 (25.59%), Postives = 241/508 (47.44%), Query Frame = 1
Query: 1873 AEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI-----------VKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSV----NGNNCHLDTSS----CSRIKNNADKENH---------------------------YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTA-NFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISC 3252
            +EDT  V SKK + EE + K+EDERYE+DM  E+NK A+  L ++  +++ M+ ++   F  ++N+  SS+IL  KAI RIYGD   ++I GLK  P + +P+V+ R++EK  EW +   +F+  W D+ + +  +SLDYQ  ++  +D+   +  T   Q+D +           +K   +R+++   ISS+    E  +HT+ + +      +G LS +    +    ++ P    H+ LL P DS    + +    +            D+++D  SL+ +H+   SN SK+D+  +   +   +   F      +S+    SV      +   +  +     C R   N +++ +                           Y L +GN   Y  +RL H+LIDRL++LK+ + ++  +  +          D   Y +++     D Y + +NL+ D  +   D + + ++K+R ++    ++WF++ +LI  + K  Q I C
Sbjct:    3 SEDTSAVSSKKNIHEEQITKLEDERYEVDMFQEINKYALKHLCEVNKKMESMSKEEKMKFQLDDNIGGSSAILMRKAIYRIYGDATDNMIEGLKVRPKMAIPLVISRMQEKTKEWNQIHSKFKMVWEDRANKHYWQSLDYQG-DWTKRDSIFLKRSTFFSQIDSLSKGFSSINQDFLKSDFIRILSRNKISSI---YEHSIHTQNSPR----GIYGNLSETP---LTNGTEVGP----HLTLLLPTDSDLFIANVGISIE------------DIINDTNSLITNHITMLSNLSKEDRQLLIDYISQVLGYFFGTPGIEISEFPSGSVKEQKKSDRAAMTATDRKLKCKRTHTNNEEQVYEKSSKVPKRFSSKKFTFNEDLQSRHVKYNLMIGNSYMYTLLRLVHVLIDRLSALKIHSIKMSQEDSD---------FDNSCYNENSSSEEIDRYNKVLNLLIDSNELNSDASLSIDNKIRNLYHTKAFLWFTIPRLIQQIAKTSQQIIC 474          
BLAST of Paired amphipathic helix protein vs. Planmine SMEST
Match: SMESG000036802.1 (SMESG000036802.1)

HSP 1 Score: 164.466 bits (415), Expect = 1.074e-40
Identity = 130/508 (25.59%), Postives = 241/508 (47.44%), Query Frame = 1
Query: 1873 AEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIRLADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI-----------VKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSV----NGNNCHLDTS----SCSRIKNNADKENH---------------------------YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTA-NFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISC 3252
            +EDT  V SKK + EE + K+EDERYE+DM  E+NK A+  L ++  +++ M+ ++   F  ++N+  SS+IL  KAI RIYGD   ++I GLK  P + +P+V+ R++EK  EW +   +F+  W D+ + +  +SLDYQ  ++  +D+   +  T   Q+D +           +K   +R+++   ISS+    E  +HT+ + +      +G LS +    +    ++ P    H+ LL P DS    + +    +            D+++D  SL+ +H+   SN SK+D+  +   +   +   F      +S+    SV      +   +  +     C R   N +++ +                           Y L +GN   Y  +RL H+LIDRL++LK+ + ++  +  +          D   Y +++     D Y + +NL+ D  +   D + + ++K+R ++    ++WF++ +LI  + K  Q I C
Sbjct:    3 SEDTSAVSSKKNIHEEQITKLEDERYEVDMFQEINKYALKHLCEVNKKMESMSKEEKMKFQLDDNIGGSSAILMRKAIYRIYGDATDNMIEGLKVRPKMAIPLVISRMQEKTKEWNQIHSKFKMVWEDRANKHYWQSLDYQG-DWTKRDSIFLKRSTFFSQIDSLSKGFSSINQDFLKSDFIRILSRNKISSI---YEHSIHTQNSPR----GIYGNLSETP---LTNGTEVGP----HLTLLLPTDSDLFIANVGISIE------------DIINDTNSLITNHITMLSNLSKEDRQLLIDYISQVLGYFFGTPGIEISEFPSGSVKEQKKSDRAAMTATDRKLKCKRTHTNNEEQVYEKSSKVPKRFSSKKFTFNEDLQSRHVKYNLMIGNSYMYTLLRLVHVLIDRLSALKIHSIKMSQEDSD---------FDNSCYNENSSSEEIDRYNKVLNLLIDSNELNSDASLSIDNKIRNLYHTKAFLWFTIPRLIQQIAKTSQQIIC 474          
BLAST of Paired amphipathic helix protein vs. Planmine SMEST
Match: SMESG000036802.1 (SMESG000036802.1)

HSP 1 Score: 120.553 bits (301), Expect = 2.034e-27
Identity = 107/460 (23.26%), Postives = 208/460 (45.22%), Query Frame = 1
Query: 2017 LKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI-----------VKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSV----NGNNCHLDTSS----CSRIKNNADKENH---------------------------YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTA-NFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISC 3252
            ++ M+ ++   F  ++N+  SS+IL  KAI RIYGD   ++I GLK  P + +P+V+ R++EK  EW +   +F+  W D+ + +  +SLDYQ  ++  +D+   +  T   Q+D +           +K   +R+++   ISS+    E  +HT+ + +      +G LS +    +    ++ P    H+ LL P DS    + +    +            D+++D  SL+ +H+   SN SK+D+  +   +   +   F      +S+    SV      +   +  +     C R   N +++ +                           Y L +GN   Y  +RL H+LIDRL++LK+ + ++  +  +          D   Y +++     D Y + +NL+ D  +   D + + ++K+R ++    ++WF++ +LI  + K  Q I C
Sbjct:    1 MESMSKEEKMKFQLDDNIGGSSAILMRKAIYRIYGDATDNMIEGLKVRPKMAIPLVISRMQEKTKEWNQIHSKFKMVWEDRANKHYWQSLDYQG-DWTKRDSIFLKRSTFFSQIDSLSKGFSSINQDFLKSDFIRILSRNKISSI---YEHSIHTQNSPR----GIYGNLSETP---LTNGTEVGP----HLTLLLPTDSDLFIANVGISIE------------DIINDTNSLITNHITMLSNLSKEDRQLLIDYISQVLGYFFGTPGIEISEFPSGSVKEQKKSDRAAMTATDRKLKCKRTHTNNEEQVYEKSSKVPKRFSSKKFTFNEDLQSRHVKYNLMIGNSYMYTLLRLVHVLIDRLSALKIHSIKMSQEDSD---------FDNSCYNENSSSEEIDRYNKVLNLLIDSNELNSDASLSIDNKIRNLYHTKAFLWFTIPRLIQQIAKTSQQIIC 424          
BLAST of Paired amphipathic helix protein vs. Planmine SMEST
Match: SMESG000036802.1 (SMESG000036802.1)

HSP 1 Score: 119.783 bits (299), Expect = 3.053e-27
Identity = 107/457 (23.41%), Postives = 206/457 (45.08%), Query Frame = 1
Query: 2026 MTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIINGLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQ-DLYLLKSLDYQAINFRAKDAGMTRPKTLLGQLDGI-----------VKIKPLRLINYQDISSVTCLIESLLHTKRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKSILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKILMRITMQDIFIDERFNVSDDEEDSV----NGNNCHLDTSS----CSRIKNNADKENH---------------------------YKLFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADLLLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTA-NFEDKMREMFGIHGYIWFSMDKLITTLVKQLQIISC 3252
            M+ ++   F  ++N+  SS+IL  KAI RIYGD   ++I GLK  P + +P+V+ R++EK  EW +   +F+  W D+ + +  +SLDYQ  ++  +D+   +  T   Q+D +           +K   +R+++   ISS+    E  +HT+ + +      +G LS +    +    ++ P    H+ LL P DS    + +    +            D+++D  SL+ +H+   SN SK+D+  +   +   +   F      +S+    SV      +   +  +     C R   N +++ +                           Y L +GN   Y  +RL H+LIDRL++LK+ + ++  +  +          D   Y +++     D Y + +NL+ D  +   D + + ++K+R ++    ++WF++ +LI  + K  Q I C
Sbjct:    1 MSKEEKMKFQLDDNIGGSSAILMRKAIYRIYGDATDNMIEGLKVRPKMAIPLVISRMQEKTKEWNQIHSKFKMVWEDRANKHYWQSLDYQG-DWTKRDSIFLKRSTFFSQIDSLSKGFSSINQDFLKSDFIRILSRNKISSI---YEHSIHTQNSPR----GIYGNLSETP---LTNGTEVGP----HLTLLLPTDSDLFIANVGISIE------------DIINDTNSLITNHITMLSNLSKEDRQLLIDYISQVLGYFFGTPGIEISEFPSGSVKEQKKSDRAAMTATDRKLKCKRTHTNNEEQVYEKSSKVPKRFSSKKFTFNEDLQSRHVKYNLMIGNSYMYTLLRLVHVLIDRLSALKIHSIKMSQEDSD---------FDNSCYNENSSSEEIDRYNKVLNLLIDSNELNSDASLSIDNKIRNLYHTKAFLWFTIPRLIQQIAKTSQQIIC 421          
The following BLAST results are available for this feature:
BLAST of Paired amphipathic helix protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIN3B1.237e-4724.71SIN3 transcription regulator family member B [Sour... [more]
SIN3A1.132e-4530.05SIN3 transcription regulator family member A [Sour... [more]
SIN3A1.132e-4530.05SIN3 transcription regulator family member A [Sour... [more]
SIN3A1.132e-4530.05SIN3 transcription regulator family member A [Sour... [more]
SIN3B1.743e-4223.62SIN3 transcription regulator family member B [Sour... [more]
back to top
BLAST of Paired amphipathic helix protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sin-31.302e-1329.61Paired amphipathic helix protein sin-3 [Source:Un... [more]
sin-31.314e-1329.61Paired amphipathic helix protein sin-3 [Source:Un... [more]
back to top
BLAST of Paired amphipathic helix protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sin3A2.453e-5026.94gene:FBgn0022764 transcript:FBtr0339651[more]
Sin3A3.094e-5026.94gene:FBgn0022764 transcript:FBtr0087889[more]
Sin3A1.273e-4826.94gene:FBgn0022764 transcript:FBtr0347014[more]
Sin3A3.315e-4828.89gene:FBgn0022764 transcript:FBtr0087888[more]
Sin3A3.315e-4828.89gene:FBgn0022764 transcript:FBtr0303566[more]
back to top
BLAST of Paired amphipathic helix protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sin3ab1.285e-7530.01SIN3 transcription regulator family member Ab [Sou... [more]
sin3ab1.285e-7530.01SIN3 transcription regulator family member Ab [Sou... [more]
sin3aa8.345e-4740.58SIN3 transcription regulator family member Aa [Sou... [more]
sin3b1.047e-4231.75SIN3 transcription regulator family member B [Sour... [more]
sin3ab5.178e-1428.82SIN3 transcription regulator family member Ab [Sou... [more]
back to top
BLAST of Paired amphipathic helix protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gas2l19.917e-6829.83growth arrest specific 2 like 1 [Source:Xenbase;Ac... [more]
gas2l11.432e-6731.77growth arrest specific 2 like 1 [Source:Xenbase;Ac... [more]
gas2l11.702e-6729.83growth arrest specific 2 like 1 [Source:Xenbase;Ac... [more]
gas2l12.305e-6729.83growth arrest specific 2 like 1 [Source:Xenbase;Ac... [more]
gas2l11.034e-6629.83growth arrest specific 2 like 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Paired amphipathic helix protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sin3a2.310e-4538.31transcriptional regulator, SIN3A (yeast) [Source:M... [more]
Sin3a2.310e-4538.31transcriptional regulator, SIN3A (yeast) [Source:M... [more]
Sin3a2.310e-4538.31transcriptional regulator, SIN3A (yeast) [Source:M... [more]
Sin3a2.463e-4538.31transcriptional regulator, SIN3A (yeast) [Source:M... [more]
Sin3a2.463e-4538.31transcriptional regulator, SIN3A (yeast) [Source:M... [more]
back to top
BLAST of Paired amphipathic helix protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09750|PST1_SCHPO2.869e-5426.04Paired amphipathic helix protein pst1 OS=Schizosac... [more]
sp|Q96ST3|SIN3A_HUMAN5.437e-4530.05Paired amphipathic helix protein Sin3a OS=Homo sap... [more]
sp|Q60520|SIN3A_MOUSE1.616e-4438.31Paired amphipathic helix protein Sin3a OS=Mus musc... [more]
sp|O75182|SIN3B_HUMAN8.372e-4223.62Paired amphipathic helix protein Sin3b OS=Homo sap... [more]
sp|Q62141|SIN3B_MOUSE5.460e-4131.75Paired amphipathic helix protein Sin3b OS=Mus musc... [more]
back to top
BLAST of Paired amphipathic helix protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NYC31.019e-13233.95Paired amphipathic helix protein Sin3a OS=Paragoni... [more]
A0A183R0W21.095e-12633.61HDAC_interact domain-containing protein OS=Schisto... [more]
A0A504Z3182.022e-12632.84Paired amphipathic helix protein Sin3a OS=Fasciola... [more]
A0A4S2MG103.700e-12631.90HDAC_interact domain-containing protein OS=Opistho... [more]
A0A095C6L21.665e-12533.86Paired amphipathic helix protein Sin3a OS=Schistos... [more]
back to top
BLAST of Paired amphipathic helix protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sin3aa5.405e-4842.81SIN3 transcription regulator family member Aa [Sou... [more]
sin3ab1.917e-4744.06SIN3 transcription regulator family member Ab [Sou... [more]
sin3b3.143e-4231.04SIN3 transcription regulator family member B [Sour... [more]
back to top
BLAST of Paired amphipathic helix protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sin3ab4.026e-6931.87SIN3 transcription regulator family member Ab [Sou... [more]
back to top
BLAST of Paired amphipathic helix protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SIN32.659e-3437.73Component of both the Rpd3S and Rpd3L histone deac... [more]
back to top
BLAST of Paired amphipathic helix protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO414581.046e-8134.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Paired amphipathic helix protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042315.12.392e-4841.07paired amphipathic helix protein Sin3a [Source:NCB... [more]
sin3b3.800e-4828.72SIN3 transcription regulator family member B [Sour... [more]
sin3aa3.469e-4739.85SIN3 transcription regulator family member A [Sour... [more]
sin3aa5.345e-4739.85SIN3 transcription regulator family member A [Sour... [more]
ENSORLT00000001808.28.012e-4741.98paired amphipathic helix protein Sin3a [Source:NCB... [more]
back to top
BLAST of Paired amphipathic helix protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034807.10.000e+099.78SMESG000034807.1[more]
SMESG000036802.11.593e-4125.59SMESG000036802.1[more]
SMESG000036802.11.074e-4025.59SMESG000036802.1[more]
SMESG000036802.12.034e-2723.26SMESG000036802.1[more]
SMESG000036802.13.053e-2723.41SMESG000036802.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027169 ID=SMED30027169|Name=Paired amphipathic helix protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4215bp
ATCTATATAAATCTTATATGAATTATTTTTATGTAGTTACAACCCATGTC
TAATCCAGGTACTGATCATTCCCATTTTCCAAGTTATCATGGCACTATGA
CAAGTGGAAATCAAAATTATAATATTCAAACTACAACAGAAAACTCTGGG
AAGTTAAAAGTCGAAGATGCCTTGAAATATATCGATAGAGTTAAAGGAAG
ATTTAATGAAGAAATTTATAAAAAATTTCTTGAAGTCATGAAAGATTTCA
AAGCTCAAAAAATAAATACAGAAACCGTAATTCAAAATGTCCTTACTTTA
TTTCATGGACACCAGGATTTGATTGAAGGATTTAATACTTTTCTTCCGCC
TGGTTATCAAATGAGTGCTTATCAAACTCCTCCCATTATCAATTATCCAG
ACAATATTCATCCCACGTCAATTAATATCATTAATACTCCTTCTATTGTA
AATAGTCAACCTTATGCAATTTATTCAAATTCCATTGTAAATCCTCCTAT
CGAAGTTTCCATCGATAGTGATTTGTCACATGAAAATGTCAGTATAGTAG
AATCAGAAAGAGCTGATGTTAATCAAATTCCAATTATTCAAAGTGGAAAC
TCGATTATTAGTTTGAAATCAATTTCTCCCGGTATTCCTCAATCTCAAAC
CCCCAGTGAATTCAATCATGCAGTTGAATATGTTAACAAAATAAAAAATC
GATTTCAAAAGCAGCCAGATGTCTACAAAAGATTTCTGGAGATTTTACAT
TGGTACCAAAAAGAACAGAAAAATCCCGATTTAGTAAAACGAAAACAAAC
CGAAACGGAAGTTTCGCAGGAAGTCGCAAAATTGTTTGATAATGAACAAG
ATTTATTGCAGGAATTCAGTACTTTTTTACCAGATTCGGTCAGTTTTGGA
AATAATCTGAGTGACAATGACTTGTGTTCCGGTCGACGTTCTTCTTCTGG
TTATAAAACTATTCCGAATTCCACTCAAAATTGCTATATCAATCCATCGA
ATATTATTCCCGTCAACGAAAAATCGAAAATTCAATGTGTTAATGTTCCC
AAAATCGATAGTATTGATGAATCAATCGAAAAGAACCAGATCGATTATTT
TCGGCCGGCTTCAACTTCTGTTCCACCCGTTTCTATTGCGTCTGTATCTC
AAACACCGAAACGTAATTTGGTTCAAGATCTGAATACTGATCGAAGAATT
AGTACGAGCAATCATCCACCTACCAAGAGGTTAAGAACCGCCAGTTCAGC
GATATCCAATCGAGATGCCATAAAGATAAATCTGCTAAGCAATCACGAAT
TATCAAAAATTCGTCATTTTGATGTCATCAGTGCCATGTGTCAGGAGCTG
TTGGAATTGCCATCTGAAACTGCCTATTACAGTTTCGTGAACACAATAGA
TCTGTTCAATAAGCGCATTATGAACGCTGAGCAACTGAAATCGACAGTGA
AACCGTTCTTTTCCAAGAGATCAGAAGTCTGGCAGAATTTCGTTAGTCTA
TTAGAGAAAATCAATGATCATGACAAAGTGTACACACTTGATTCCAGTAA
GGATTCAAGTTATATGTATGACACTGCCACAGTTAATTCTCCTGTAGTAT
CGATTTCCACCGCTAAAGATTGCAATTCCCTATCGAACGTAAGCATCAAT
GCACCGAACATTAACATGAATTTGATATCAAGCTCCAACTCTATGTTATC
GAAAAACGTGTTCTGGCGAAAAAATGTCGAACTAAGCAAATTGGAAATCT
GTGGCTCACATTATCGCATCCTACCAGAAGAATTTACTGAGCCTCGATCA
ATGGCTCAGTCTAAAAATAAAATTTGTAAAGAGGTATTGAATTATAGTTT
CATTTGCCATCGATCATTGTCAGCTGAAGATACTCCGTTTGTGTTCTCTA
AGAAAACGGTTTTCGAGGAGTCTGTATTTAAAATTGAAGATGAACGATAC
GAAATCGATATGGTAATGGAAATGAACAAAGCAGCAATGATTAGATTGGC
TGATATGCAAATACGACTGAAAGAAATGACAACTGATCAAATTAATGATT
TTAATTTCGAAGAAAATCTGTACCGAAGTTCTTCAATTTTATTTAATAAG
GCTATTCAAAGGATTTACGGCGACAAAGCTGTCGATATAATAAACGGATT
GAAAAACCACCCTGCTATCGTCGTTCCGATAGTTCTGGAGCGGTTGAAGG
AGAAAGATGTCGAATGGAAAGAGAAAATTAAACAGTTTCGAAGACATTGG
CGAGATCAAGATTTATATCTATTGAAGTCTTTAGATTATCAGGCAATCAA
TTTCCGAGCCAAAGATGCGGGAATGACGCGACCAAAGACGTTATTGGGCC
AATTAGATGGTATAGTAAAGATTAAACCGCTACGTCTTATTAACTATCAA
GACATAAGCTCGGTTACTTGTTTGATAGAATCACTATTACATACTAAACG
TACCTGGAAATTAGAAAAGCCTGAAAAATGGGGAACTCTTTCTTACAGTT
CAGGCGGCGTAATCGAGTATAATGATAAAATTTCTCCTTCTCCCGATTAC
CACATGTTATTGTTGTTTCCATGTGATTCGCAATATGCAAAATCCATTCT
AGATTATCCATTTCAGCAAAAAATGTATTTATTCGATAAGCTAGATTGGT
ATGATCTGTTATCGGATGCCGCTTCATTAGTGATACATCACCTGAAACGC
CAGAGTAATTTCAGCAAAGATGATAAGACAAATATGAAAATATTGATGCG
AATTACGATGCAGGATATTTTCATCGATGAAAGGTTTAATGTTTCCGATG
ATGAAGAAGACTCTGTAAATGGTAATAATTGCCATTTGGATACTTCTTCG
TGTTCCCGCATTAAAAATAATGCCGATAAAGAAAACCACTATAAATTATT
TGTTGGCAACAAGCAATGGTATGTCTTCATTCGGCTTTATCATCTCCTCA
TCGATAGGCTGGCCTCCTTGAAAGTAAAGGCGGAACAGTTAGTTTCCAAA
TACAAAGAAGAAAAGAAACAGAATATAAAAGAAGTCGCTGATTTGTTACT
TTACAAAAAATCCAATCAATTAAATCCCGAAGATTATTATCAAGAGGCAA
TTAATCTGGTAAAAGATTTACTCGACAGCTGCGAAGACACAGCAAATTTC
GAGGATAAAATGCGTGAAATGTTCGGCATTCACGGATATATTTGGTTCAG
TATGGATAAACTAATCACTACTCTAGTGAAACAGTTGCAAATAATCAGTT
GTACTGACAATTTCAGTAGGAAATTGTCAGCCCTGTTTAAACAGTGTAGT
AAACATTTCTATGGCCAAGACGAACGTGAGAACAAATTGAAAATAAATAT
CACTGGCACAGGAGCACTTTTTGAAACGAGAAATGAGGAAACTATCAAAG
ATGAATTTGCATATTTACAAGCTGCGTCGCGATTGGCAATGCACTACAAT
GAACCTTTGGTGTTGATTTTATTCCATCGTAACCCACCTACAAAATGTTC
CGGTCACATGTGTATAACGTTGTTAGATGTATCTCCTGGCAACAGTTCCG
GATCAGAATCTCAAGAAGACGCATCTAAAATCAAAGAAGAACCTTCAAGT
AGTACTCCAGCTATACCGCATGTTTCAAAATCTGTTATTTCCGAAAGTAA
TTTGCCACCGGTTATGAGTTGGAAGCATTATATTGAGCGTTATGTTACCT
GTTCGGAGAAGCTGGGGTTCAGTGATGGACTTCATAATATTGGATTAAAT
AAAAGAATATCCGTTCCTGTTTTTTTGCTTAGATCTCTTCGAAAAAGCAT
AAATAATATTTCATTTATTAAGGGACGCAATGACGAAAGTTTGAACGAAG
AGCAGACAGATTCGCTTATCAAAAGGAGTGCACAGGCAACTGATTGGCAC
AGTTCTATTGTGCAGTTAATTTGTTATGTTTTTGATGGGGCTGATGAAAA
TTTTCTTTATAGATTTCTTACGGGTACTGTTATGACTGGTCACATGTGTC
CTGTGGCAGAGGAAGGCCATAATTTATTAGTTCAATATGAAACTACAAAG
TTAACTTGGTCAGTTGGATCTTGTGGTGTATTTTATAGAATCAACAAACA
AAATAATCGTCAAAAAGTGAAATCAGAATATGTTTCTAAAGTTAGAAGAA
ATAGATTTTTAAAATTTCAAAACTTGTGGTTAAGTCAACAGAGTTAAGAG
TATTCAATATTTATC
back to top

protein sequence of SMED30027169-orf-1

>SMED30027169-orf-1 ID=SMED30027169-orf-1|Name=SMED30027169-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1384bp
MSNPGTDHSHFPSYHGTMTSGNQNYNIQTTTENSGKLKVEDALKYIDRVK
GRFNEEIYKKFLEVMKDFKAQKINTETVIQNVLTLFHGHQDLIEGFNTFL
PPGYQMSAYQTPPIINYPDNIHPTSINIINTPSIVNSQPYAIYSNSIVNP
PIEVSIDSDLSHENVSIVESERADVNQIPIIQSGNSIISLKSISPGIPQS
QTPSEFNHAVEYVNKIKNRFQKQPDVYKRFLEILHWYQKEQKNPDLVKRK
QTETEVSQEVAKLFDNEQDLLQEFSTFLPDSVSFGNNLSDNDLCSGRRSS
SGYKTIPNSTQNCYINPSNIIPVNEKSKIQCVNVPKIDSIDESIEKNQID
YFRPASTSVPPVSIASVSQTPKRNLVQDLNTDRRISTSNHPPTKRLRTAS
SAISNRDAIKINLLSNHELSKIRHFDVISAMCQELLELPSETAYYSFVNT
IDLFNKRIMNAEQLKSTVKPFFSKRSEVWQNFVSLLEKINDHDKVYTLDS
SKDSSYMYDTATVNSPVVSISTAKDCNSLSNVSINAPNINMNLISSSNSM
LSKNVFWRKNVELSKLEICGSHYRILPEEFTEPRSMAQSKNKICKEVLNY
SFICHRSLSAEDTPFVFSKKTVFEESVFKIEDERYEIDMVMEMNKAAMIR
LADMQIRLKEMTTDQINDFNFEENLYRSSSILFNKAIQRIYGDKAVDIIN
GLKNHPAIVVPIVLERLKEKDVEWKEKIKQFRRHWRDQDLYLLKSLDYQA
INFRAKDAGMTRPKTLLGQLDGIVKIKPLRLINYQDISSVTCLIESLLHT
KRTWKLEKPEKWGTLSYSSGGVIEYNDKISPSPDYHMLLLFPCDSQYAKS
ILDYPFQQKMYLFDKLDWYDLLSDAASLVIHHLKRQSNFSKDDKTNMKIL
MRITMQDIFIDERFNVSDDEEDSVNGNNCHLDTSSCSRIKNNADKENHYK
LFVGNKQWYVFIRLYHLLIDRLASLKVKAEQLVSKYKEEKKQNIKEVADL
LLYKKSNQLNPEDYYQEAINLVKDLLDSCEDTANFEDKMREMFGIHGYIW
FSMDKLITTLVKQLQIISCTDNFSRKLSALFKQCSKHFYGQDERENKLKI
NITGTGALFETRNEETIKDEFAYLQAASRLAMHYNEPLVLILFHRNPPTK
CSGHMCITLLDVSPGNSSGSESQEDASKIKEEPSSSTPAIPHVSKSVISE
SNLPPVMSWKHYIERYVTCSEKLGFSDGLHNIGLNKRISVPVFLLRSLRK
SINNISFIKGRNDESLNEEQTDSLIKRSAQATDWHSSIVQLICYVFDGAD
ENFLYRFLTGTVMTGHMCPVAEEGHNLLVQYETTKLTWSVGSCGVFYRIN
KQNNRQKVKSEYVSKVRRNRFLKFQNLWLSQQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003714transcription corepressor activity
Vocabulary: cellular component
TermDefinition
GO:0016580Sin3 complex
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:1903507negative regulation of nucleic acid-templated transcription
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036600PAH_sf
IPR039774Sin3-like
IPR013194HDAC_interact_dom
IPR003822PAH
IPR031693Sin3_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 969..996
NoneNo IPR availableCOILSCoilCoilcoord: 714..734
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1167..1193
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR12346:SF0SIN3A, ISOFORM Gcoord: 38..1212
IPR013194Histone deacetylase interacting domainSMARTSM00761hdac_interact2seq4bcoord: 565..668
e-value: 4.8E-20
score: 82.6
IPR013194Histone deacetylase interacting domainPFAMPF08295Sin3_corepresscoord: 569..664
e-value: 2.1E-22
score: 79.0
IPR036600Paired amphipathic helix superfamilyGENE3DG3DSA:1.20.1160.11coord: 200..282
e-value: 4.3E-31
score: 108.9
IPR036600Paired amphipathic helix superfamilyGENE3DG3DSA:1.20.1160.11coord: 41..101
e-value: 1.2E-19
score: 72.4
IPR036600Paired amphipathic helix superfamilySUPERFAMILYSSF47762PAH2 domaincoord: 33..102
IPR036600Paired amphipathic helix superfamilySUPERFAMILYSSF47762PAH2 domaincoord: 201..280
IPR003822Paired amphipathic helixPFAMPF02671PAHcoord: 56..100
e-value: 1.5E-16
score: 60.2
coord: 225..278
e-value: 1.1E-14
score: 54.3
IPR003822Paired amphipathic helixPROSITEPS51477PAHcoord: 35..103
score: 17.104
IPR003822Paired amphipathic helixPROSITEPS51477PAHcoord: 202..281
score: 16.076
IPR031693Sin3, C-terminalPFAMPF16879Sin3a_Ccoord: 952..1262
e-value: 5.2E-34
score: 118.3
IPR039774Transcriptional regulatory protein Sin3-likePANTHERPTHR12346SIN3B-RELATEDcoord: 38..1212