Ral guanine nucleotide dissociation stimulator like 1

Overview
NameRal guanine nucleotide dissociation stimulator like 1
Smed IDSMED30027168
Length (bp)2491
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ral guanine nucleotide dissociation stimulator like 1 (SMED30027168) t-SNE clustered cells

Violin plots show distribution of expression levels for Ral guanine nucleotide dissociation stimulator like 1 (SMED30027168) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ral guanine nucleotide dissociation stimulator like 1 (SMED30027168) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ral guanine nucleotide dissociation stimulator like 1 (SMED30027168) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027168

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027168h1SMcG0007247 PL08007B1H04smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30027168h1SMcG0007247 dd_Smed_v4_8642_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027168h1SMcG0007247 dd_Smed_v4_8642_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Human
Match: RGL1 (ral guanine nucleotide dissociation stimulator like 1 [Source:HGNC Symbol;Acc:HGNC:30281])

HSP 1 Score: 107.842 bits (268), Expect = 2.715e-23
Identity = 121/481 (25.16%), Postives = 207/481 (43.04%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSN---EVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLS--YTR------KKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK----VNEPHINH-------NKELKRSISN-NSSSAPTKTRNKSKM-----LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQ 1470
            + K  TLE++++       + D   ++I L TYR +    ++++L+  R+  L++   E   S+ +S+       A+  +L +WL    A DF E P +  +  LL  +         +  S+         E R  ++L +F K +   D+    LP   SF      +    +   +  F   S DL+A  LT++D ++ + +     L   ++R      K  AP++ A I ++N L   V  TI                               L G   +T Q  ++I+KWI IA +   ++NFSSL AI +AL ++S   + K  + +     L+ +    +   H NH        KE     +N +SS    + R + ++     + ++   VPYLGT+L +LT ++    D++          E  LIN EK RR+F+V+ Q+KL  SA     M  D  F+ W+   QRQ
Sbjct:  103 TIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTSPNCEEDGSQSSSESKMVIRNAIASILRAWL-DQCAEDFREPPHFPCLQKLLDYL------TRMMPGSDP--------ERRAQNLLEQFQKQEVETDNG---LPNTISFSLEEEEE---LEGGESAEFTCFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSRRDKKENKHLAPTIRATISQFNTLTKCVVSTI-------------------------------LGGKELKTQQRAKIIEKWINIAHECRLLKNFSSLRAIVSALQSNSIYRLKKTWAAVPRDRMLMFEELSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYI----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCMTPDQKFIQWF---QRQ 518          

HSP 2 Score: 51.2174 bits (121), Expect = 7.976e-6
Identity = 22/61 (36.07%), Postives = 39/61 (63.93%), Query Frame = 1
Query: 1957 LYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALAKQ 2139
            +YK I +  ++ T   I+R  +K  L +     +E++QV+  +KE++IP++ANVFYA+  Q
Sbjct:  698 MYKSIMLTSQDKTPAVIQRAMLKHNLDSDPAEEYELVQVISEDKELVIPDSANVFYAMNSQ 758          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Human
Match: RGL1 (ral guanine nucleotide dissociation stimulator like 1 [Source:HGNC Symbol;Acc:HGNC:30281])

HSP 1 Score: 107.457 bits (267), Expect = 3.260e-23
Identity = 121/481 (25.16%), Postives = 207/481 (43.04%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSN---EVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLS--YTR------KKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK----VNEPHINH-------NKELKRSISN-NSSSAPTKTRNKSKM-----LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQ 1470
            + K  TLE++++       + D   ++I L TYR +    ++++L+  R+  L++   E   S+ +S+       A+  +L +WL    A DF E P +  +  LL  +         +  S+         E R  ++L +F K +   D+    LP   SF      +    +   +  F   S DL+A  LT++D ++ + +     L   ++R      K  AP++ A I ++N L   V  TI                               L G   +T Q  ++I+KWI IA +   ++NFSSL AI +AL ++S   + K  + +     L+ +    +   H NH        KE     +N +SS    + R + ++     + ++   VPYLGT+L +LT ++    D++          E  LIN EK RR+F+V+ Q+KL  SA     M  D  F+ W+   QRQ
Sbjct:   68 TIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTSPNCEEDGSQSSSESKMVIRNAIASILRAWL-DQCAEDFREPPHFPCLQKLLDYL------TRMMPGSDP--------ERRAQNLLEQFQKQEVETDNG---LPNTISFSLEEEEE---LEGGESAEFTCFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSRRDKKENKHLAPTIRATISQFNTLTKCVVSTI-------------------------------LGGKELKTQQRAKIIEKWINIAHECRLLKNFSSLRAIVSALQSNSIYRLKKTWAAVPRDRMLMFEELSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYI----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCMTPDQKFIQWF---QRQ 483          

HSP 2 Score: 51.2174 bits (121), Expect = 7.466e-6
Identity = 22/61 (36.07%), Postives = 39/61 (63.93%), Query Frame = 1
Query: 1957 LYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALAKQ 2139
            +YK I +  ++ T   I+R  +K  L +     +E++QV+  +KE++IP++ANVFYA+  Q
Sbjct:  663 MYKSIMLTSQDKTPAVIQRAMLKHNLDSDPAEEYELVQVISEDKELVIPDSANVFYAMNSQ 723          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Human
Match: RALGDS (ral guanine nucleotide dissociation stimulator [Source:HGNC Symbol;Acc:HGNC:9842])

HSP 1 Score: 81.2629 bits (199), Expect = 4.485e-15
Identity = 61/212 (28.77%), Postives = 109/212 (51.42%), Query Frame = 1
Query:  904 ILSELVGN--NKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHNK-ELKRSISNNSSSA--------PTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEHRNSYN 1503
            +++  +GN   K  D+  +V++ WI++A++   ++NFSSL AI +AL ++S   + K    +  + +++  K++E   + N   L R +     ++        P + + + K   I+   VPYLGT+L +L  ++    D+L      Y     RLIN EK R++F+V+ Q+KL  SA     +  D+ F  W+  ++R SE      SYN
Sbjct:  443 VITTCLGNRSTKAPDRA-RVVEHWIEVARECRILKNFSSLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYL------YG----RLINFEKRRKEFEVIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSET----ESYN 639          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Human
Match: RALGDS (ral guanine nucleotide dissociation stimulator [Source:HGNC Symbol;Acc:HGNC:9842])

HSP 1 Score: 81.2629 bits (199), Expect = 4.973e-15
Identity = 61/212 (28.77%), Postives = 109/212 (51.42%), Query Frame = 1
Query:  904 ILSELVGN--NKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXL-YNQYQLLMKVNEPHINHNK-ELKRSISNNSSSA--------PTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEHRNSYN 1503
            +++  +GN   K  D+  +V++ WI++A++   ++NFSSL AI +AL ++S   + K    +  + +++  K++E   + N   L R +     ++        P + + + K   I+   VPYLGT+L +L  ++    D+L      Y     RLIN EK R++F+V+ Q+KL  SA     +  D+ F  W+  ++R SE      SYN
Sbjct:  444 VITTCLGNRSTKAPDRA-RVVEHWIEVARECRILKNFSSLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYL------YG----RLINFEKRRKEFEVIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSET----ESYN 640          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Human
Match: RALGDS (ral guanine nucleotide dissociation stimulator [Source:HGNC Symbol;Acc:HGNC:9842])

HSP 1 Score: 81.2629 bits (199), Expect = 5.006e-15
Identity = 61/212 (28.77%), Postives = 109/212 (51.42%), Query Frame = 1
Query:  904 ILSELVGN--NKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHNK-ELKRSISNNSSSA--------PTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEHRNSYN 1503
            +++  +GN   K  D+  +V++ WI++A++   ++NFSSL AI +AL ++S   + K    +  + +++  K++E   + N   L R +     ++        P + + + K   I+   VPYLGT+L +L  ++    D+L      Y     RLIN EK R++F+V+ Q+KL  SA     +  D+ F  W+  ++R SE      SYN
Sbjct:  415 VITTCLGNRSTKAPDRA-RVVEHWIEVARECRILKNFSSLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYL------YG----RLINFEKRRKEFEVIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSET----ESYN 611          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Celegans
Match: rgl-1 (Ral GDS-Like [Source:UniProtKB/TrEMBL;Acc:G4SFM6])

HSP 1 Score: 71.633 bits (174), Expect = 1.723e-12
Identity = 51/183 (27.87%), Postives = 90/183 (49.18%), Query Frame = 1
Query:  952 QVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYN----QYQLLMKVNEPHINHNKELKRSI---SNNSSSAPTKT--------RNKSKM-LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWY 1452
            ++I KWI IA++L  ++NFSSL A+ ++L +     +    + + N    Q++ L  + E   + ++   R I      + S+P +         R KS + L      VPYLG +L +L  +++  PD+            E LIN EK R++F+VL +++L  SA +   +  D +F  W+
Sbjct:  306 KIISKWIDIARELRALKNFSSLKAVLSSLQSEPVHRLKSAWNSVPNRSISQFRELSSIYETDEDGDQGNARKILEQEGTAKSSPLRRPQLIQNCRRTKSDVNLAECQGTVPYLGNFLTDLAMVDESTPDY----------TPENLINFEKRRKEFEVLAKLRLFQSAARAYNIPMDRMFCAWF 478          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Celegans
Match: rgl-1 (Ral GDS-Like [Source:UniProtKB/TrEMBL;Acc:G4SFM6])

HSP 1 Score: 71.633 bits (174), Expect = 1.819e-12
Identity = 51/183 (27.87%), Postives = 90/183 (49.18%), Query Frame = 1
Query:  952 QVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYN----QYQLLMKVNEPHINHNKELKRSI---SNNSSSAPTKT--------RNKSKM-LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWY 1452
            ++I KWI IA++L  ++NFSSL A+ ++L +     +    + + N    Q++ L  + E   + ++   R I      + S+P +         R KS + L      VPYLG +L +L  +++  PD+            E LIN EK R++F+VL +++L  SA +   +  D +F  W+
Sbjct:  326 KIISKWIDIARELRALKNFSSLKAVLSSLQSEPVHRLKSAWNSVPNRSISQFRELSSIYETDEDGDQGNARKILEQEGTAKSSPLRRPQLIQNCRRTKSDVNLAECQGTVPYLGNFLTDLAMVDESTPDY----------TPENLINFEKRRKEFEVLAKLRLFQSAARAYNIPMDRMFCAWF 498          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Fly
Match: Rgl (gene:FBgn0026376 transcript:FBtr0075793)

HSP 1 Score: 74.3294 bits (181), Expect = 2.905e-13
Identity = 54/182 (29.67%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  958 IDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK--VNEPHINHNKELKRSISNNSSSA----PTKTRNKSKMLKILYN--------EVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEI 1461
            I +WI IAQ+L  ++NFSSL AI +AL+++S   + K    L  +   +     N    ++N    R +     +A    P    +   + K++ N         +PYLGT+L +LT I    PD+L          E +LIN +K R++F+VL Q+KL   A     +++D +F +W++ +
Sbjct:  528 ISRWIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVLPKERMEVFTELANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSHGTIPYLGTFLTDLTMIHTANPDYL---------TENKLINFDKKRKEFEVLAQIKLLQGAANTYNLQADALFDHWFNSM 700          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Fly
Match: Rgl (gene:FBgn0026376 transcript:FBtr0330186)

HSP 1 Score: 74.3294 bits (181), Expect = 2.957e-13
Identity = 54/182 (29.67%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  958 IDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK--VNEPHINHNKELKRSISNNSSSA----PTKTRNKSKMLKILYN--------EVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEI 1461
            I +WI IAQ+L  ++NFSSL AI +AL+++S   + K    L  +   +     N    ++N    R +     +A    P    +   + K++ N         +PYLGT+L +LT I    PD+L          E +LIN +K R++F+VL Q+KL   A     +++D +F +W++ +
Sbjct:  528 ISRWIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVLPKERMEVFTELANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSHGTIPYLGTFLTDLTMIHTANPDYL---------TENKLINFDKKRKEFEVLAQIKLLQGAANTYNLQADALFDHWFNSM 700          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Fly
Match: Rgl (gene:FBgn0026376 transcript:FBtr0075794)

HSP 1 Score: 73.9442 bits (180), Expect = 3.555e-13
Identity = 54/182 (29.67%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  958 IDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK--VNEPHINHNKELKRSISNNSSSA----PTKTRNKSKMLKILYN--------EVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEI 1461
            I +WI IAQ+L  ++NFSSL AI +AL+++S   + K    L  +   +     N    ++N    R +     +A    P    +   + K++ N         +PYLGT+L +LT I    PD+L          E +LIN +K R++F+VL Q+KL   A     +++D +F +W++ +
Sbjct:  348 ISRWIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVLPKERMEVFTELANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSHGTIPYLGTFLTDLTMIHTANPDYL---------TENKLINFDKKRKEFEVLAQIKLLQGAANTYNLQADALFDHWFNSM 520          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Fly
Match: Rgl (gene:FBgn0026376 transcript:FBtr0075795)

HSP 1 Score: 73.9442 bits (180), Expect = 3.555e-13
Identity = 54/182 (29.67%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  958 IDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK--VNEPHINHNKELKRSISNNSSSA----PTKTRNKSKMLKILYN--------EVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEI 1461
            I +WI IAQ+L  ++NFSSL AI +AL+++S   + K    L  +   +     N    ++N    R +     +A    P    +   + K++ N         +PYLGT+L +LT I    PD+L          E +LIN +K R++F+VL Q+KL   A     +++D +F +W++ +
Sbjct:  348 ISRWIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVLPKERMEVFTELANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSHGTIPYLGTFLTDLTMIHTANPDYL---------TENKLINFDKKRKEFEVLAQIKLLQGAANTYNLQADALFDHWFNSM 520          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Fly
Match: Rgl (gene:FBgn0026376 transcript:FBtr0075796)

HSP 1 Score: 73.9442 bits (180), Expect = 3.555e-13
Identity = 54/182 (29.67%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  958 IDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK--VNEPHINHNKELKRSISNNSSSA----PTKTRNKSKMLKILYN--------EVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEI 1461
            I +WI IAQ+L  ++NFSSL AI +AL+++S   + K    L  +   +     N    ++N    R +     +A    P    +   + K++ N         +PYLGT+L +LT I    PD+L          E +LIN +K R++F+VL Q+KL   A     +++D +F +W++ +
Sbjct:  348 ISRWIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVLPKERMEVFTELANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSHGTIPYLGTFLTDLTMIHTANPDYL---------TENKLINFDKKRKEFEVLAQIKLLQGAANTYNLQADALFDHWFNSM 520          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Zebrafish
Match: rgl1 (ral guanine nucleotide dissociation stimulator-like 1 [Source:NCBI gene;Acc:402933])

HSP 1 Score: 99.3673 bits (246), Expect = 7.282e-21
Identity = 114/484 (23.55%), Postives = 205/484 (42.36%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSN-EVRPSEINSKEN-EGYTKAVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHID----QKVLRDLKLQEMLSYTRKK----PAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHN----------KELKRSISNNSSSAPTKTRNKSKMLKI------LYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEK 1479
            S +  TLE +++       + D    +I L TYR +     +++L+  R+    + E   S+  + E+ +   KA+  +L +WL   P   DF E P Y S++ +L           F++K+    E  RR +  +  + V+ + ++   +  ++ +   C   D      E  +    E F     DL+A  LT++D    +KV+    L  + S   KK     AP++ A I ++N +   V  TI    L  R    +  +                           ++I +WI IAQ+    +NFSSL AI +AL ++    + +  + +  +  Q+  ++++   + N          +E     ++  S A    +   K L++      +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+V+ Q+KL  SA     +  D  FL W+    + SE+
Sbjct:   74 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFASTQSVLELLLDRYGSFEDCEGERSQCQTGESRKAVRKALASILRAWLDQCP--EDFQEPPSYPSLHRVL----------GFLQKAMPGSEPMRRAQSLLEQLRVQAS-LENETEGGFQYINPFCLGED------EEVEIDLQEDFFSFEVDLVAEQLTYMDALLFKKVVPHHCLGSIWSQRDKKDGKQSAPTIRATITQFNAVTACVVSTI----LRQRQIRPHLRA---------------------------RIIQRWIDIAQECRIRKNFSSLRAIVSALQSNPLYRLKRTWASVAKDSMQMFEELSDIFSDQNNYLTSRELLMREGTSKFASLDSCAKDHQKRSQKRLQLQKDMGAMQGTIPYLGTFLTDLTMLDTALPDQV----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCLTPDPAFLRWFKSQPQYSEE 497          

HSP 2 Score: 53.5286 bits (127), Expect = 1.125e-6
Identity = 22/59 (37.29%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 1957 LYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALA 2133
            LYK I +  ++ T   I R   K  L     +++E++QV+   +E++IP+NANVFYA++
Sbjct:  669 LYKSIMLTSQDKTPAVISRAMTKHNLEGEQAADYELVQVISEERELVIPDNANVFYAMS 727          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Zebrafish
Match: rgl1 (ral guanine nucleotide dissociation stimulator-like 1 [Source:NCBI gene;Acc:402933])

HSP 1 Score: 98.9821 bits (245), Expect = 8.100e-21
Identity = 114/484 (23.55%), Postives = 205/484 (42.36%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSN-EVRPSEINSKEN-EGYTKAVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHID----QKVLRDLKLQEMLSYTRKK----PAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHN----------KELKRSISNNSSSAPTKTRNKSKMLKI------LYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEK 1479
            S +  TLE +++       + D    +I L TYR +     +++L+  R+    + E   S+  + E+ +   KA+  +L +WL   P   DF E P Y S++ +L           F++K+    E  RR +  +  + V+ + ++   +  ++ +   C   D      E  +    E F     DL+A  LT++D    +KV+    L  + S   KK     AP++ A I ++N +   V  TI    L  R    +  +                           ++I +WI IAQ+    +NFSSL AI +AL ++    + +  + +  +  Q+  ++++   + N          +E     ++  S A    +   K L++      +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+V+ Q+KL  SA     +  D  FL W+    + SE+
Sbjct:   94 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFASTQSVLELLLDRYGSFEDCEGERSQCQTGESRKAVRKALASILRAWLDQCP--EDFQEPPSYPSLHRVL----------GFLQKAMPGSEPMRRAQSLLEQLRVQAS-LENETEGGFQYINPFCLGED------EEVEIDLQEDFFSFEVDLVAEQLTYMDALLFKKVVPHHCLGSIWSQRDKKDGKQSAPTIRATITQFNAVTACVVSTI----LRQRQIRPHLRA---------------------------RIIQRWIDIAQECRIRKNFSSLRAIVSALQSNPLYRLKRTWASVAKDSMQMFEELSDIFSDQNNYLTSRELLMREGTSKFASLDSCAKDHQKRSQKRLQLQKDMGAMQGTIPYLGTFLTDLTMLDTALPDQV----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCLTPDPAFLRWFKSQPQYSEE 517          

HSP 2 Score: 53.1434 bits (126), Expect = 1.405e-6
Identity = 22/59 (37.29%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 1957 LYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALA 2133
            LYK I +  ++ T   I R   K  L     +++E++QV+   +E++IP+NANVFYA++
Sbjct:  689 LYKSIMLTSQDKTPAVISRAMTKHNLEGEQAADYELVQVISEERELVIPDNANVFYAMS 747          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Zebrafish
Match: rgl1 (ral guanine nucleotide dissociation stimulator-like 1 [Source:NCBI gene;Acc:402933])

HSP 1 Score: 98.9821 bits (245), Expect = 8.873e-21
Identity = 114/484 (23.55%), Postives = 205/484 (42.36%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSN-EVRPSEINSKEN-EGYTKAVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHID----QKVLRDLKLQEMLSYTRKK----PAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHN----------KELKRSISNNSSSAPTKTRNKSKMLKI------LYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEK 1479
            S +  TLE +++       + D    +I L TYR +     +++L+  R+    + E   S+  + E+ +   KA+  +L +WL   P   DF E P Y S++ +L           F++K+    E  RR +  +  + V+ + ++   +  ++ +   C   D      E  +    E F     DL+A  LT++D    +KV+    L  + S   KK     AP++ A I ++N +   V  TI    L  R    +  +                           ++I +WI IAQ+    +NFSSL AI +AL ++    + +  + +  +  Q+  ++++   + N          +E     ++  S A    +   K L++      +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+V+ Q+KL  SA     +  D  FL W+    + SE+
Sbjct:  104 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFASTQSVLELLLDRYGSFEDCEGERSQCQTGESRKAVRKALASILRAWLDQCP--EDFQEPPSYPSLHRVL----------GFLQKAMPGSEPMRRAQSLLEQLRVQAS-LENETEGGFQYINPFCLGED------EEVEIDLQEDFFSFEVDLVAEQLTYMDALLFKKVVPHHCLGSIWSQRDKKDGKQSAPTIRATITQFNAVTACVVSTI----LRQRQIRPHLRA---------------------------RIIQRWIDIAQECRIRKNFSSLRAIVSALQSNPLYRLKRTWASVAKDSMQMFEELSDIFSDQNNYLTSRELLMREGTSKFASLDSCAKDHQKRSQKRLQLQKDMGAMQGTIPYLGTFLTDLTMLDTALPDQV----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCLTPDPAFLRWFKSQPQYSEE 527          

HSP 2 Score: 53.5286 bits (127), Expect = 1.111e-6
Identity = 22/59 (37.29%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 1957 LYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALA 2133
            LYK I +  ++ T   I R   K  L     +++E++QV+   +E++IP+NANVFYA++
Sbjct:  699 LYKSIMLTSQDKTPAVISRAMTKHNLEGEQAADYELVQVISEERELVIPDNANVFYAMS 757          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Zebrafish
Match: RALGDS (si:ch211-251j10.3 [Source:ZFIN;Acc:ZDB-GENE-081105-110])

HSP 1 Score: 83.1889 bits (204), Expect = 7.002e-16
Identity = 101/478 (21.13%), Postives = 207/478 (43.31%), Query Frame = 1
Query:  118 KGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIK--QKKFNES-FLECSADLIANCLTHIDQKVLRDLK----LQEMLSYTRKKP----APSVTAIIDKYNQLYNVVCIT-INEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXL----YNQYQLLMKVNEPHINH--NKEL-------KRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSE 1476
            K  TLE++++         D   + I L TYR +     ++ L+  R+ KL    + ++++++++      V  +L +WL   ++ DF   PD++ +  L          +S+++ + S  +  RR            N ++  +     E+ ++       +  PE    + +F+ S F+  S  ++A  LT +D ++ + +     L  + S   KK     AP++ A + ++N + N V  T ++  SL  RPF                              Q  + I+ WI++A+K   +++FSSL AI +AL +++   + +    +    Y  +Q L ++     N+  ++EL       K +I   +     +   + + + ++   +PYLGT+L +L  ++    D L          E  LIN EK R++F+V+ Q+KL            +  F++W+  +++ +E
Sbjct:  121 KAGTLEKLVEYMVSAFKGKDYTYVTIFLCTYRAFATTKQVLDLLLNRYAKLPASGK-TKVSAEDHTELKNTVSSILGAWLD-QYSEDFWSPPDHECLQSL----------ISYLQLNFSGSDLERRA----------LNLLEHFQHRQQCEVEIEGDLCSCPFATPEESSLEDEFSPSHFMSFSPSIVAEQLTVMDAELFKRVVPYHCLGGIWSQRDKKGKEHLAPTIRATVSQFNSVTNCVIATCLDNRSL--RPF------------------------------QRAKRIEHWIEVARKCRILKSFSSLKAILSALQSNAIHRLRRAWDDVSRESYRTFQELSEIFSDDNNYSLSRELLIKEGTSKSAIVEINHKGAQRRHQQQRDMGVVQGTIPYLGTFLTDLVMLDTAMKDHL----------EVGLINFEKRRKEFEVIAQIKLLQLTCNYYNFSRNQRFIDWFKRVEKLTE 534          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Zebrafish
Match: si:ch211-251j10.3 (si:ch211-251j10.3 [Source:ZFIN;Acc:ZDB-GENE-081105-110])

HSP 1 Score: 75.0998 bits (183), Expect = 2.219e-13
Identity = 106/482 (21.99%), Postives = 204/482 (42.32%), Query Frame = 1
Query:  118 KGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFR-RVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGD---SFYLKPEIK--QKKFNES-FLECSADLIANCLTHIDQKVLRDLK----LQEMLSYTRKKP----APSVTAIIDKYNQLYNVVCIT-INEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXL----YNQYQLLMKVNEPHINH--NKEL-------KRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSE 1476
            K  TLE++++         D   + I L TYR +     ++ L+               +NS         V  +L +WL   ++ DF   PD++ +  L+  ++         R++ +  E F+ R +  V    + F   D N  +N+    + C+ GD     +  PE    + +F+ S F+  S  ++A  LT +D ++ + +     L  + S   KK     AP++ A + ++N + N V  T ++  SL  RPF                              Q  + I+ WI++A+K   +++FSSL AI +AL +++   + +    +    Y  +Q L ++     N+  ++EL       K +I   +     +   + + + ++   +PYLGT+L +L  ++    D L          E  LIN EK R++F+V+ Q+KL            +  F++W+  +++ +E
Sbjct:   60 KAGTLEKLVEYMVFAFKGKDYTYVTIFLCTYRAFATTKQVLDLL---------------LNS--------TVSSILGAWLD-QYSEDFWSPPDHECLQSLISYLQLNFSGSDLERRALNLLEHFQHRQQCEVEIEGMIFTNNDFNFQTNFMRTCILCT-GDLCSCPFATPEESSLEDEFSPSHFMSFSPSIVAEQLTVMDAELFKRVVPYHCLGGIWSQRDKKGKEHLAPTIRATVSQFNSVTNCVIATCLDNRSL--RPF------------------------------QRAKRIEHWIEVARKCRILKSFSSLKAILSALQSNAIHRLRRAWDDVSRESYRTFQELSEIFSDDNNYSLSRELLIKEGTSKSAIVEINHKGAQRRHQQQRDMGVVQGTIPYLGTFLTDLVMLDTAMKDHL----------EVGLINFEKRRKEFEVIAQIKLLQLTCNYYNFSRNQRFIDWFKRVEKLTE 474          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Xenopus
Match: ralgds (ral guanine nucleotide dissociation stimulator [Source:NCBI gene;Acc:100135084])

HSP 1 Score: 83.5741 bits (205), Expect = 7.532e-16
Identity = 94/403 (23.33%), Postives = 170/403 (42.18%), Query Frame = 1
Query:  340 LLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVE------DRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIA-----NCLTHIDQKVLRDLKLQEMLSYTRKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQ-YQLLMKVNE---PHINHNKELKRSISNNSSSAPTKTRNKSKM---------LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSE 1476
            +L +WL   ++ DF + PDY  +  L+  +R         R++ +    F+R +      D V+        ++E   S+ +  P   SF          +Q    E F    A+L       +CL  I  +  RD K +E L       AP++ A + ++N + N V  T                                L   + +  Q  +VI++WI++A++   ++NFSSL AI +AL  ++   + K   ++  + Y++ M+++E      NH+   +  I   +S   T   N  +          + ++   +PYLGT+L +L  ++    D+L          E  LIN EK R++F+V+ Q+KL  SA        D+ F+ W+  ++R +E
Sbjct:  216 ILGAWLD-QYSEDFRQAPDYTCLKQLITYVRHNIPGSDLERRACNLLTQFKRQQISALEPDVVDHTSCTLRLVEEPLLSDGK--PDFLSF----------RQDMLAEQFTVMDAELFKKVVPYHCLGCIWSQ--RDKKGKEHL-------APTIRATVSQFNSVTNCVISTC-------------------------------LCDRSLKPQQRAKVIERWIEVARECRILKNFSSLRAILSALQCNAIHRLKKTWDEVSRESYRIFMELSEIFSDENNHSLSRELLIKEGTSKFATLDINPKRAQKRQQQQREMGVMQGTIPYLGTFLTDLVMLDTAMKDYL----------ESGLINFEKRRKEFEVIAQIKLLQSACNNYSFLPDESFVEWFHSVERLTE 555          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Xenopus
Match: ralgds (ral guanine nucleotide dissociation stimulator [Source:NCBI gene;Acc:100135084])

HSP 1 Score: 83.5741 bits (205), Expect = 7.865e-16
Identity = 94/403 (23.33%), Postives = 170/403 (42.18%), Query Frame = 1
Query:  340 LLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVE------DRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIA-----NCLTHIDQKVLRDLKLQEMLSYTRKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQ-YQLLMKVNE---PHINHNKELKRSISNNSSSAPTKTRNKSKM---------LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSE 1476
            +L +WL   ++ DF + PDY  +  L+  +R         R++ +    F+R +      D V+        ++E   S+ +  P   SF          +Q    E F    A+L       +CL  I  +  RD K +E L       AP++ A + ++N + N V  T                                L   + +  Q  +VI++WI++A++   ++NFSSL AI +AL  ++   + K   ++  + Y++ M+++E      NH+   +  I   +S   T   N  +          + ++   +PYLGT+L +L  ++    D+L          E  LIN EK R++F+V+ Q+KL  SA        D+ F+ W+  ++R +E
Sbjct:  161 ILGAWLD-QYSEDFRQAPDYTCLKQLITYVRHNIPGSDLERRACNLLTQFKRQQISALEPDVVDHTSCTLRLVEEPLLSDGK--PDFLSF----------RQDMLAEQFTVMDAELFKKVVPYHCLGCIWSQ--RDKKGKEHL-------APTIRATVSQFNSVTNCVISTC-------------------------------LCDRSLKPQQRAKVIERWIEVARECRILKNFSSLRAILSALQCNAIHRLKKTWDEVSRESYRIFMELSEIFSDENNHSLSRELLIKEGTSKFATLDINPKRAQKRQQQQREMGVMQGTIPYLGTFLTDLVMLDTAMKDYL----------ESGLINFEKRRKEFEVIAQIKLLQSACNNYSFLPDESFVEWFHSVERLTE 500          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Xenopus
Match: ralgds (ral guanine nucleotide dissociation stimulator [Source:NCBI gene;Acc:100135084])

HSP 1 Score: 83.5741 bits (205), Expect = 7.922e-16
Identity = 94/403 (23.33%), Postives = 170/403 (42.18%), Query Frame = 1
Query:  340 LLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVE------DRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIA-----NCLTHIDQKVLRDLKLQEMLSYTRKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQ-YQLLMKVNE---PHINHNKELKRSISNNSSSAPTKTRNKSKM---------LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSE 1476
            +L +WL   ++ DF + PDY  +  L+  +R         R++ +    F+R +      D V+        ++E   S+ +  P   SF          +Q    E F    A+L       +CL  I  +  RD K +E L       AP++ A + ++N + N V  T                                L   + +  Q  +VI++WI++A++   ++NFSSL AI +AL  ++   + K   ++  + Y++ M+++E      NH+   +  I   +S   T   N  +          + ++   +PYLGT+L +L  ++    D+L          E  LIN EK R++F+V+ Q+KL  SA        D+ F+ W+  ++R +E
Sbjct:  186 ILGAWLD-QYSEDFRQAPDYTCLKQLITYVRHNIPGSDLERRACNLLTQFKRQQISALEPDVVDHTSCTLRLVEEPLLSDGK--PDFLSF----------RQDMLAEQFTVMDAELFKKVVPYHCLGCIWSQ--RDKKGKEHL-------APTIRATVSQFNSVTNCVISTC-------------------------------LCDRSLKPQQRAKVIERWIEVARECRILKNFSSLRAILSALQCNAIHRLKKTWDEVSRESYRIFMELSEIFSDENNHSLSRELLIKEGTSKFATLDINPKRAQKRQQQQREMGVMQGTIPYLGTFLTDLVMLDTAMKDYL----------ESGLINFEKRRKEFEVIAQIKLLQSACNNYSFLPDESFVEWFHSVERLTE 525          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Xenopus
Match: ENSXETT00000049087.1 (ral guanine nucleotide dissociation stimulator like 2 [Source:NCBI gene;Acc:100489210])

HSP 1 Score: 70.0922 bits (170), Expect = 9.622e-12
Identity = 48/184 (26.09%), Postives = 94/184 (51.09%), Query Frame = 1
Query:  943 QVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXX----XXXXXXLYNQYQLLMKV--NEPHINHNKELKRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSE 1476
            Q  ++I+KW+++A++   +RNFSS+ AI TAL +++   +     + S ++   YQ + +V   + +    +EL     +       + + +++  + +   VPYLG +L +L  ++    D L+      NG     +N EK R++F+ L Q+++  S  +G    SD  F+ W+  +Q  SE
Sbjct:  270 QRARIIEKWVRVAEECRSLRNFSSVYAIITALQSTAVHRLKKVWAETSREILRSYQEMREVFCEKDNYARMRELLFQPHDQPEITSKRQQPRTRESRAVQGVVPYLGVFLTDLVMLDSAIRDQLE------NG----YLNFEKRRKEFEALSQIRILQSVCQGYRFHSDPQFITWFQRLQPISE 443          

HSP 2 Score: 53.1434 bits (126), Expect = 2.042e-6
Identity = 25/62 (40.32%), Postives = 40/62 (64.52%), Query Frame = 1
Query: 1948 ENILYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALA 2133
            EN +YK ++I+ +E     I+R+  K  ++   P   E+IQ+L   KE++IPE ANVFYA++
Sbjct:  590 ENSVYKSVRISSQEKAPAVIDRILRKHHMTPQGPQ--ELIQLLPEGKELVIPEKANVFYAMS 649          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Xenopus
Match: ENSXETT00000049092.1 (ral guanine nucleotide dissociation stimulator like 2 [Source:NCBI gene;Acc:100489210])

HSP 1 Score: 70.0922 bits (170), Expect = 1.146e-11
Identity = 49/184 (26.63%), Postives = 94/184 (51.09%), Query Frame = 1
Query:  943 QVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXX----XXXXXXLYNQYQLLMKVNEPHINHN--KELKRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSE 1476
            Q  ++I+KW+++A++   +RNFSS+ AI TAL +++   +     + S ++   YQ + +V     N+   +EL     +       + + +++  + +   VPYLG +L +L  ++    D L+      NG     +N EK R++F+ L Q+++  S  +G    SD  F+ W+  +Q  SE
Sbjct:  273 QRARIIEKWVRVAEECRSLRNFSSVYAIITALQSTAVHRLKKVWAETSREILRSYQEMREVFCEKDNYARMRELLFQPHDQPEITSKRQQPRTRESRAVQGVVPYLGVFLTDLVMLDSAIRDQLE------NG----YLNFEKRRKEFEALSQIRILQSVCQGYRFHSDPQFITWFQRLQPISE 446          

HSP 2 Score: 52.7582 bits (125), Expect = 2.386e-6
Identity = 25/62 (40.32%), Postives = 40/62 (64.52%), Query Frame = 1
Query: 1948 ENILYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALA 2133
            EN +YK ++I+ +E     I+R+  K  ++   P   E+IQ+L   KE++IPE ANVFYA++
Sbjct:  593 ENSVYKSVRISSQEKAPAVIDRILRKHHMTPQGPQ--ELIQLLPEGKELVIPEKANVFYAMS 652          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Mouse
Match: Rgl1 (ral guanine nucleotide dissociation stimulator,-like 1 [Source:MGI Symbol;Acc:MGI:107484])

HSP 1 Score: 102.064 bits (253), Expect = 1.086e-21
Identity = 119/487 (24.44%), Postives = 207/487 (42.51%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPS-EINSKENEGYTKAVI-----FLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYT--------RKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK----VNEPHINH-------NKELKRSISN-NSSSAPTKTRNKSKM-----LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEK 1479
            + K  TLE++++       + D   ++I L TYR +    ++++L+  R+  L+    P+ E +  ++   +KAVI      +L +WL    A DF E P +  +  LL+ ++        +  S+         E R  ++L +F K D + D+         +       + E  +   +  F   S DL+A  LT++D ++ + +     L            K  AP++ A I ++N L   V  T+                               L     +T Q  +VI+KWI IA +   ++NFSSL AI +AL ++S   + K  + +     L+ +    +   H NH        KE     +N +SS    + R + ++     + ++   VPYLGT+L +LT ++    D++          E  LIN EK RR+F+V+ Q+KL  SA     M  D  F+ W+   Q  SE+
Sbjct:  103 TIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTG---PNCEDDGSQSSPESKAVIRNAIASILRAWL-DQCAEDFREPPHFPCLQKLLEYLK------QMMPGSDP--------ERRAQNLLEQFQKQDVDSDNGL------LNTSSFSLEEEEELESGGSAEFTNFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSQRDKKENKHLAPTIRATISQFNTLTKCVVSTV-------------------------------LGSKELKTQQRARVIEKWINIAHECRILKNFSSLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEELSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYI----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCMGPDQKFIQWFQRQQLLSEE 524          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Mouse
Match: Rgl1 (ral guanine nucleotide dissociation stimulator,-like 1 [Source:MGI Symbol;Acc:MGI:107484])

HSP 1 Score: 101.679 bits (252), Expect = 1.263e-21
Identity = 119/487 (24.44%), Postives = 207/487 (42.51%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPS-EINSKENEGYTKAVI-----FLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYT--------RKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK----VNEPHINH-------NKELKRSISN-NSSSAPTKTRNKSKM-----LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEK 1479
            + K  TLE++++       + D   ++I L TYR +    ++++L+  R+  L+    P+ E +  ++   +KAVI      +L +WL    A DF E P +  +  LL+ ++        +  S+         E R  ++L +F K D + D+         +       + E  +   +  F   S DL+A  LT++D ++ + +     L            K  AP++ A I ++N L   V  T+                               L     +T Q  +VI+KWI IA +   ++NFSSL AI +AL ++S   + K  + +     L+ +    +   H NH        KE     +N +SS    + R + ++     + ++   VPYLGT+L +LT ++    D++          E  LIN EK RR+F+V+ Q+KL  SA     M  D  F+ W+   Q  SE+
Sbjct:   66 TIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTG---PNCEDDGSQSSPESKAVIRNAIASILRAWL-DQCAEDFREPPHFPCLQKLLEYLK------QMMPGSDP--------ERRAQNLLEQFQKQDVDSDNGL------LNTSSFSLEEEEELESGGSAEFTNFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSQRDKKENKHLAPTIRATISQFNTLTKCVVSTV-------------------------------LGSKELKTQQRARVIEKWINIAHECRILKNFSSLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEELSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYI----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCMGPDQKFIQWFQRQQLLSEE 487          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Mouse
Match: Rgl1 (ral guanine nucleotide dissociation stimulator,-like 1 [Source:MGI Symbol;Acc:MGI:107484])

HSP 1 Score: 101.293 bits (251), Expect = 1.573e-21
Identity = 119/487 (24.44%), Postives = 207/487 (42.51%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPS-EINSKENEGYTKAVI-----FLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYT--------RKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK----VNEPHINH-------NKELKRSISN-NSSSAPTKTRNKSKM-----LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEK 1479
            + K  TLE++++       + D   ++I L TYR +    ++++L+  R+  L+    P+ E +  ++   +KAVI      +L +WL    A DF E P +  +  LL+ ++        +  S+         E R  ++L +F K D + D+         +       + E  +   +  F   S DL+A  LT++D ++ + +     L            K  AP++ A I ++N L   V  T+                               L     +T Q  +VI+KWI IA +   ++NFSSL AI +AL ++S   + K  + +     L+ +    +   H NH        KE     +N +SS    + R + ++     + ++   VPYLGT+L +LT ++    D++          E  LIN EK RR+F+V+ Q+KL  SA     M  D  F+ W+   Q  SE+
Sbjct:   68 TIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTG---PNCEDDGSQSSPESKAVIRNAIASILRAWL-DQCAEDFREPPHFPCLQKLLEYLK------QMMPGSDP--------ERRAQNLLEQFQKQDVDSDNGL------LNTSSFSLEEEEELESGGSAEFTNFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSQRDKKENKHLAPTIRATISQFNTLTKCVVSTV-------------------------------LGSKELKTQQRARVIEKWINIAHECRILKNFSSLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEELSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYI----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCMGPDQKFIQWFQRQQLLSEE 489          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Mouse
Match: Ralgds (ral guanine nucleotide dissociation stimulator [Source:MGI Symbol;Acc:MGI:107485])

HSP 1 Score: 77.7962 bits (190), Expect = 3.615e-14
Identity = 51/185 (27.57%), Postives = 98/185 (52.97%), Query Frame = 1
Query:  952 QVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXL-YNQYQLLMKVNEPHINHNK-ELKRSISNNSSSA--------PTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSE 1476
            +V++ WI++A++   ++NFSSL AI +AL +++   + K   ++  + +++  K++E   + N   L R +     ++        P + + + K   ++   VPYLGT+L +L  ++    D+L      Y     RLIN EK R++F+V+ Q+KL  SA     +  ++ F  W+  ++R SE
Sbjct:  455 RVVEHWIEVARECRALKNFSSLYAILSALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPRRAQRRQKETGVIQGTVPYLGTFLTDLVMLDTAMKDYL------YG----RLINFEKRRKEFEVIAQIKLLQSACNNYSIAPEEHFGTWFRAMERLSE 629          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Mouse
Match: Ralgds (ral guanine nucleotide dissociation stimulator [Source:MGI Symbol;Acc:MGI:107485])

HSP 1 Score: 77.7962 bits (190), Expect = 4.069e-14
Identity = 51/185 (27.57%), Postives = 98/185 (52.97%), Query Frame = 1
Query:  952 QVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHNK-ELKRSISNNSSSA--------PTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSE 1476
            +V++ WI++A++   ++NFSSL AI +AL +++   + K   ++  + +++  K++E   + N   L R +     ++        P + + + K   ++   VPYLGT+L +L  ++    D+L      Y     RLIN EK R++F+V+ Q+KL  SA     +  ++ F  W+  ++R SE
Sbjct:  454 RVVEHWIEVARECRALKNFSSLYAILSALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPRRAQRRQKETGVIQGTVPYLGTFLTDLVMLDTAMKDYL------YG----RLINFEKRRKEFEVIAQIKLLQSACNNYSIAPEEHFGTWFRAMERLSE 628          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. UniProt/SwissProt
Match: sp|Q9NZL6|RGL1_HUMAN (Ral guanine nucleotide dissociation stimulator-like 1 OS=Homo sapiens OX=9606 GN=RGL1 PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.565e-22
Identity = 121/481 (25.16%), Postives = 207/481 (43.04%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSN---EVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLS--YTR------KKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK----VNEPHINH-------NKELKRSISN-NSSSAPTKTRNKSKM-----LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQ 1470
            + K  TLE++++       + D   ++I L TYR +    ++++L+  R+  L++   E   S+ +S+       A+  +L +WL    A DF E P +  +  LL  +         +  S+         E R  ++L +F K +   D+    LP   SF      +    +   +  F   S DL+A  LT++D ++ + +     L   ++R      K  AP++ A I ++N L   V  TI                               L G   +T Q  ++I+KWI IA +   ++NFSSL AI +AL ++S   + K  + +     L+ +    +   H NH        KE     +N +SS    + R + ++     + ++   VPYLGT+L +LT ++    D++          E  LIN EK RR+F+V+ Q+KL  SA     M  D  F+ W+   QRQ
Sbjct:   68 TIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTSPNCEEDGSQSSSESKMVIRNAIASILRAWL-DQCAEDFREPPHFPCLQKLLDYL------TRMMPGSDP--------ERRAQNLLEQFQKQEVETDNG---LPNTISFSLEEEEE---LEGGESAEFTCFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSRRDKKENKHLAPTIRATISQFNTLTKCVVSTI-------------------------------LGGKELKTQQRAKIIEKWINIAHECRLLKNFSSLRAIVSALQSNSIYRLKKTWAAVPRDRMLMFEELSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYI----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCMTPDQKFIQWF---QRQ 483          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. UniProt/SwissProt
Match: sp|Q60695|RGL1_MOUSE (Ral guanine nucleotide dissociation stimulator-like 1 OS=Mus musculus OX=10090 GN=Rgl1 PE=1 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 1.100e-20
Identity = 119/487 (24.44%), Postives = 207/487 (42.51%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPS-EINSKENEGYTKAVI-----FLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYT--------RKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK----VNEPHINH-------NKELKRSISN-NSSSAPTKTRNKSKM-----LKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEK 1479
            + K  TLE++++       + D   ++I L TYR +    ++++L+  R+  L+    P+ E +  ++   +KAVI      +L +WL    A DF E P +  +  LL+ ++        +  S+         E R  ++L +F K D + D+         +       + E  +   +  F   S DL+A  LT++D ++ + +     L            K  AP++ A I ++N L   V  T+                               L     +T Q  +VI+KWI IA +   ++NFSSL AI +AL ++S   + K  + +     L+ +    +   H NH        KE     +N +SS    + R + ++     + ++   VPYLGT+L +LT ++    D++          E  LIN EK RR+F+V+ Q+KL  SA     M  D  F+ W+   Q  SE+
Sbjct:   68 TIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTG---PNCEDDGSQSSPESKAVIRNAIASILRAWL-DQCAEDFREPPHFPCLQKLLEYLK------QMMPGSDP--------ERRAQNLLEQFQKQDVDSDNGL------LNTSSFSLEEEEELESGGSAEFTNFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSQRDKKENKHLAPTIRATISQFNTLTKCVVSTV-------------------------------LGSKELKTQQRARVIEKWINIAHECRILKNFSSLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEELSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYI----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCMGPDQKFIQWFQRQQLLSEE 489          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. UniProt/SwissProt
Match: sp|Q6P112|RGL1_DANRE (Ral guanine nucleotide dissociation stimulator-like 1 OS=Danio rerio OX=7955 GN=rgl1 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.184e-19
Identity = 114/489 (23.31%), Postives = 202/489 (41.31%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSN-EVRPSEINSKEN-EGYTKAVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHID----QKVLRDLKLQEMLSYTRKK----PAPSVTAIIDKYNQLYNVVCITI-----NEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHN----------KELKRSISNNSSSAPTKTRNKSKMLKI------LYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEK 1479
            S +  TLE +++       + D    +I L TYR +     +++L+  R+    + E   S+  + E+ +   KA+  +L +WL   P   DF E P Y S++ +L           F++K+    E  RR +  +  + V+ + ++   +  ++ +   C   D      E  +    E F     DL+A  LT++D    +KV+    L  + S   KK     AP++ A I ++N +   V  TI       P L  R                                    +I +WI IAQ+    +NFSSL AI +AL ++    + +  + +  +  Q+  ++++   + N          +E     ++  S A    +   K L++      +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+V+ Q+KL  SA     +  D  F  W+    + SE+
Sbjct:  104 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFASTQSVLELLLDRYGSFEDCEGERSQCQTGESRKAVRKALASILRAWLDQCP--EDFQEPPSYPSLHRVL----------GFLQKAMPGSEPMRRAQSLLEQLRVQAS-LENETEGGFQCINPFCLGED------EEVEIDLQEDFFSFEVDLVAEQLTYMDALLFKKVVPHHCLGSIWSQRDKKDGKQSAPTIRATITQFNAVTACVVSTILRQRQIRPHLCAR------------------------------------IIQRWIDIAQECRIRKNFSSLRAIVSALQSNPLYRLKRTWASVAKDSMQMFEELSDIFSDQNNYLTSRELLMREGTSKFASLDSCAKDHQKRSQKRLQLQKDMGAMQGTIPYLGTFLTDLTMLDTALPDQV----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCLTPDPAFFRWFKSQPQYSEE 527          

HSP 2 Score: 53.5286 bits (127), Expect = 8.681e-6
Identity = 22/59 (37.29%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 1957 LYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALA 2133
            LYK I +  ++ T   I R   K  L     +++E++QV+   +E++IP+NANVFYA++
Sbjct:  699 LYKSIMLTSQDKTPAVISRAMTKHNLEGEQAADYELVQVISEERELVIPDNANVFYAMS 757          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. UniProt/SwissProt
Match: sp|Q12967|GNDS_HUMAN (Ral guanine nucleotide dissociation stimulator OS=Homo sapiens OX=9606 GN=RALGDS PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 2.348e-14
Identity = 61/212 (28.77%), Postives = 109/212 (51.42%), Query Frame = 1
Query:  904 ILSELVGN--NKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXL-YNQYQLLMKVNEPHINHNK-ELKRSISNNSSSA--------PTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEHRNSYN 1503
            +++  +GN   K  D+  +V++ WI++A++   ++NFSSL AI +AL ++S   + K    +  + +++  K++E   + N   L R +     ++        P + + + K   I+   VPYLGT+L +L  ++    D+L      Y     RLIN EK R++F+V+ Q+KL  SA     +  D+ F  W+  ++R SE      SYN
Sbjct:  444 VITTCLGNRSTKAPDRA-RVVEHWIEVARECRILKNFSSLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYL------YG----RLINFEKRRKEFEVIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSET----ESYN 640          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. UniProt/SwissProt
Match: sp|Q03385|GNDS_MOUSE (Ral guanine nucleotide dissociation stimulator OS=Mus musculus OX=10090 GN=Ralgds PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 2.992e-13
Identity = 51/185 (27.57%), Postives = 98/185 (52.97%), Query Frame = 1
Query:  952 QVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHNK-ELKRSISNNSSSA--------PTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSE 1476
            +V++ WI++A++   ++NFSSL AI +AL +++   + K   ++  + +++  K++E   + N   L R +     ++        P + + + K   ++   VPYLGT+L +L  ++    D+L      Y     RLIN EK R++F+V+ Q+KL  SA     +  ++ F  W+  ++R SE
Sbjct:  399 RVVEHWIEVARECRALKNFSSLYAILSALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPRRAQRRQKETGVIQGTVPYLGTFLTDLVMLDTAMKDYL------YG----RLINFEKRRKEFEVIAQIKLLQSACNNYSIAPEEHFGTWFRAMERLSE 573          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. TrEMBL
Match: A0A2C9JH06 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056337 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.801e-24
Identity = 127/497 (25.55%), Postives = 209/497 (42.05%), Query Frame = 1
Query:   73 HLFLKIKYIYIMASYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYT-KAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLS--YTRKKP-----APSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDX-------XXXXXXXXXXXXLYNQYQLLMKVNEPHINHNKELKRSISN-----NSSSAPTKTRNKSKML-----KILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEH 1488
            HL  +   + ++   +  TL ++++  T+    MDS  +NI L TYR +     ++  +  R++ L ++ +  +    EN   + K+V+F+   WL   +  DFH  PDY  ++ L +  +          K +   E+FR+                E+ +   R+L +  S  D     P+    K + + L+ S   IA  LT  D  + R +     L   ++R+       APS+ A I ++N +   V  TI    L TR                             +T Q  +VI KWI IAQ L +++NFSSL AI T L +        +   + K +  L+ +   +  V    IN  + L +  +      +S S   K +N  K        I+   VPYLGT+L +LT I+  +PD            EE LIN EK R++F+VL Q++L  SA     +  D  F  W++ I   ++   H
Sbjct:   64 HLMWETHKVRVI---RAGTLAKLVESLTNIQGEMDSSYVNIFLATYRTFATSRQVLDALMERYRFLRSQTKVDKTELCENMLRSLKSVLFV---WLD-SYPEDFHMAPDYTCLHELQKFAKDTAPGSGIEAKVKEKLEAFRQ----------------EDAEMTARQLELSFSLTDGSGHPPDTDSSK-SLALLDISCRKIAEQLTFKDADLFRKVIPHHCLGAYWSRRDKEGQCDAPSIQATIQQFNNVSRRVIATI----LKTREL---------------------------KTAQRAKVIQKWIMIAQDLRELKNFSSLKAIITGLQSHPVYRLKKTWAVLSKDAMVLFEELSEIFSVENNQINSRELLMKEATAKFPDLDSQSKSLKRKNLQKRRSWIDNGIVQGTVPYLGTFLTDLTMIDTAYPD----------CTEEGLINFEKRRKEFEVLAQLRLLQSAASIYNIAEDSSFWRWFNSITTYADLESH 495          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. TrEMBL
Match: A0A2D0R0R1 (ral guanine nucleotide dissociation stimulator-like 1 isoform X2 OS=Ictalurus punctatus OX=7998 GN=rgl1 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.291e-22
Identity = 117/475 (24.63%), Postives = 204/475 (42.95%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVR-PSEINSKENEGYTK-AVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHID----QKVLRDLKLQEMLSYTRKK----PAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHN----------KELKRSISNNSSSAPTKTRNKSKMLKI------LYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWY 1452
            S +  TLE +++       + D    +I L TYR +     +++L+  R+  + +  R  S+  + EN G  + A+  +L +WL   P   DF E P Y S+  +L           F++K+    E  RR +  +  +    N   E     +   P     G+   ++ E++     E FL  SADL+A  LT++D    +KV+    L  + S   KK     AP+V A I ++N +   V  T+  P    RP  +                               ++I +WI IA++    +NFSSL AI +AL ++    + +  + ++ +  Q+  ++++   +HN          +E     +N  + A    +   K L++      +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+++ Q+KL  SA     +  D  FL W+
Sbjct:   68 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFASTHSVLQLLLDRYGHMEDSDRESSQSQAGENRGAVRTALASILRAWLDQCP--EDFQEPPSYPSLRRVL----------GFLKKAMPDSEPTRRAQSLLEQLQSHSNGESETDGGFHGNSPF--CLGEDEEVEIEVQ-----EDFLSFSADLVAEQLTYMDALLFKKVVPHHCLGSVWSQRDKKENKQAAPTVRATITQFNAVAGCVVSTVLHPR-HLRPHLR------------------------------ARIIQRWIDIAKECRIRKNFSSLKAIVSALQSNPIYRLKRAWACVHKDSMQMFEELSDIFSDHNNYLTSRELLMREGTSKFANLENCAKEHQKRSQKRLQLQKETGAMQGTIPYLGTFLTDLTMLDTALPDLV----------EGGLINFEKRRREFELIAQIKLLQSACNSYCLNPDPAFLRWF 482          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. TrEMBL
Match: A0A5N5NI43 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00229160 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.355e-22
Identity = 119/484 (24.59%), Postives = 210/484 (43.39%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVR-PSEINSKENEGYTK-AVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHID----QKVLRDLKLQEMLSYTRKK----PAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHNKELKR-------------SISNNSSSAPTKTRNKSKMLK---ILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEK 1479
            S +  TLE +++       + D    +I L TYR +    ++++L+  R+  + +  R  S+  + EN    + A+  +L +WL   P   DF E P Y S++ +L+          F++K+    E  RR +  +  +    N   E     +   P     G+   ++ E++     E FL  SADL+A  LT++D    +KV+    L  + S   KK     AP+V A I ++N +   V  T+  P    RP  +                               ++I +WI IAQ+    +NFSSL AI +AL ++    + +  + ++ +  Q   ++++   +HN  L               S+ N +     +++ + ++ K    +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+V+ Q+KL  SA     +  D  FL W+    + SE+
Sbjct:  104 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFAGTHNVLQLLLDRYGHMEDSDRESSQSQTGENRAAVRTALASILRAWLDQCP--EDFQEPPSYPSLHRVLE----------FLKKAMPDSEPTRRAQSLLEQLQSHSNGESETDGGFHGNSPF--CLGEDEEVEIEVQ-----EDFLSFSADLVAEQLTYMDALLFKKVVPHHCLGSVWSQRDKKENKQAAPTVRATITQFNAVAGCVVSTVLHPR-HLRPHLR------------------------------ARIIQRWIDIAQECRIRKNFSSLKAIVSALQSNPIYRLKRAWACVHKDSMQTFEELSDIFSDHNNYLTSRELLMREGTSKFASLENCAKEHQKRSQKRLQLQKDTGAMQGTIPYLGTFLTDLTMLDTALPDLV----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCLNPDPAFLRWFKNQPQHSEE 527          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. TrEMBL
Match: A0A2D0R1H1 (ral guanine nucleotide dissociation stimulator-like 1 isoform X1 OS=Ictalurus punctatus OX=7998 GN=rgl1 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.520e-22
Identity = 117/475 (24.63%), Postives = 204/475 (42.95%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVR-PSEINSKENEGYTK-AVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHID----QKVLRDLKLQEMLSYTRKK----PAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHN----------KELKRSISNNSSSAPTKTRNKSKMLKI------LYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWY 1452
            S +  TLE +++       + D    +I L TYR +     +++L+  R+  + +  R  S+  + EN G  + A+  +L +WL   P   DF E P Y S+  +L           F++K+    E  RR +  +  +    N   E     +   P     G+   ++ E++     E FL  SADL+A  LT++D    +KV+    L  + S   KK     AP+V A I ++N +   V  T+  P    RP  +                               ++I +WI IA++    +NFSSL AI +AL ++    + +  + ++ +  Q+  ++++   +HN          +E     +N  + A    +   K L++      +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+++ Q+KL  SA     +  D  FL W+
Sbjct:  104 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFASTHSVLQLLLDRYGHMEDSDRESSQSQAGENRGAVRTALASILRAWLDQCP--EDFQEPPSYPSLRRVL----------GFLKKAMPDSEPTRRAQSLLEQLQSHSNGESETDGGFHGNSPF--CLGEDEEVEIEVQ-----EDFLSFSADLVAEQLTYMDALLFKKVVPHHCLGSVWSQRDKKENKQAAPTVRATITQFNAVAGCVVSTVLHPR-HLRPHLR------------------------------ARIIQRWIDIAKECRIRKNFSSLKAIVSALQSNPIYRLKRAWACVHKDSMQMFEELSDIFSDHNNYLTSRELLMREGTSKFANLENCAKEHQKRSQKRLQLQKETGAMQGTIPYLGTFLTDLTMLDTALPDLV----------EGGLINFEKRRREFELIAQIKLLQSACNSYCLNPDPAFLRWF 518          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. TrEMBL
Match: A0A3B3BIW4 (Ral guanine nucleotide dissociation stimulator-like 1 OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 7.701e-22
Identity = 123/490 (25.10%), Postives = 218/490 (44.49%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKL-SNEVRPSEINSKENEGYTK-AVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEF-NKIDENKDSNYRELPVDCSF-GDSFYL--KPEIKQKKFNESFLECSADLIANCLTHID----QKVLRDLKLQEMLSYTRKK----PAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHN----------KELKRSISNNSSSAPTKTRNKSKMLKI------LYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWY-SEIQRQSEKS 1482
            S +  TLE +++       + D    +I L TYR +     +++L+  R+  +  N + P + +S E  G  + A+  +L +WL   P   DF E PDY  ++ L+           ++R+++   E+ RR E    S+LV+  N+  +++         D  F G+S +   + E  + +  E FL   ADL+A  LT++D    +KV+    L  + S   KK     AP++ A I ++N +   V  T+                     + H  L          +     ++I +WI +AQ+    +NFSSL AI +AL ++    + +  + ++ +  Q   ++++   +HN          +E     ++  S A    +   K L++      +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+V+ Q+KL  SA     +  D  FL W+ S+ Q   E+S
Sbjct:   74 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFASTQTVLQLLLDRYGNVEENGLEPEQCHSPEGRGAIRNALASILRAWLDQCP--EDFQEPPDYPCLHRLM----------GYLRRAQPGSETLRRAE----SLLVQLQNQAGQDE--------ADGGFHGNSSFCLGEEEEVEIEVQEDFLSFDADLVAEQLTYMDAVLFKKVVPHHCLGSIWSQRDKKDNKHSAPTIRATITQFNAVAACVVSTV---------------------LKHRQL----------RPHVRARLIQRWIDVAQECRIRKNFSSLRAIVSALQSNPLYRLKRVWACVHRDSMQTFEELSDIFSDHNNYLTSRELLMREGTSKFASLESCAKEHQKRTHKRLQLQKEMGAMQGTIPYLGTFLTDLTMLDTALPDLV----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCLSGDAAFLRWFRSQPQLSEEES 498          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Cavefish
Match: rgl1 (ral guanine nucleotide dissociation stimulator like 1 [Source:NCBI gene;Acc:103024218])

HSP 1 Score: 108.997 bits (271), Expect = 5.991e-24
Identity = 118/486 (24.28%), Postives = 211/486 (43.42%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSE-INSKENEGYTK-AVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHID----QKVLRDLKLQEMLSYTRKK----PAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHN----------KELKRSISNNSSSAPTKTRNKSKMLKI------LYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWY-SEIQRQSEKS 1482
            S +  TLE +++       + D    +I L TYR +     +++L+  ++  + +  R S  + + E+ G  + A+  +L +WL   P   DF E P Y  +  +L           F++K+    E  RR +  +  +  +   ++ + D  +      C  G+   ++ E++     E FL  SADL+A  LT++D    +KV+    L  + S   KK     AP+V A I ++N +   V  T                      V H   +   L           ++I +WI +AQ+    +NFSSL AI +AL ++    + +  + ++ +  Q+  ++++   +HN          +E     +N  + A    +   K L++      +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+V+ Q+KL  SA     +  D  FL W+ S+ Q   E+S
Sbjct:   74 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFASTQSVLELLLDKYGNMEDCNRESSPLQAGESRGAVRTALASILRAWLDQCP--EDFQEPPSYPCLTRVL----------DFLQKAMPSSEPTRRAQSLLEQLQSQ-TSLESDTDGGFHGNSPFC-LGEDEEVEIEVQ-----EDFLSFSADLVAEQLTYMDALLFKKVVPHHCLGSVWSQRDKKENKQAAPTVRATITQFNAVAGCVVST----------------------VLHQRHLRPHLRA---------RIIQRWIDVAQECRIRKNFSSLKAIVSALQSNPIYRLKRAWACVHKDNMQVFEELSDIFSDHNNYLTSRELLMREGTSKFANLENCAKEHQKRSQKRLQLQKDAGAMQGTIPYLGTFLTDLTMLDTALPDLV----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCLSPDSAFLRWFKSQSQHTEEES 499          

HSP 2 Score: 51.9878 bits (123), Expect = 2.463e-6
Identity = 22/58 (37.93%), Postives = 36/58 (62.07%), Query Frame = 1
Query: 1957 LYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYAL 2130
            LYK I +  ++ T   I R   K  L      ++E++QV+ + +E++IP+NANVFYA+
Sbjct:  672 LYKSIMLTNQDKTPAVISRAMAKHNLEEEQAEDYELVQVISDERELVIPDNANVFYAM 729          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Cavefish
Match: rgl1 (ral guanine nucleotide dissociation stimulator like 1 [Source:NCBI gene;Acc:103024218])

HSP 1 Score: 108.997 bits (271), Expect = 5.997e-24
Identity = 118/486 (24.28%), Postives = 211/486 (43.42%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSE-INSKENEGYTK-AVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHID----QKVLRDLKLQEMLSYTRKK----PAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHN----------KELKRSISNNSSSAPTKTRNKSKMLKI------LYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWY-SEIQRQSEKS 1482
            S +  TLE +++       + D    +I L TYR +     +++L+  ++  + +  R S  + + E+ G  + A+  +L +WL   P   DF E P Y  +  +L           F++K+    E  RR +  +  +  +   ++ + D  +      C  G+   ++ E++     E FL  SADL+A  LT++D    +KV+    L  + S   KK     AP+V A I ++N +   V  T                      V H   +   L           ++I +WI +AQ+    +NFSSL AI +AL ++    + +  + ++ +  Q+  ++++   +HN          +E     +N  + A    +   K L++      +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+V+ Q+KL  SA     +  D  FL W+ S+ Q   E+S
Sbjct:  105 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFASTQSVLELLLDKYGNMEDCNRESSPLQAGESRGAVRTALASILRAWLDQCP--EDFQEPPSYPCLTRVL----------DFLQKAMPSSEPTRRAQSLLEQLQSQ-TSLESDTDGGFHGNSPFC-LGEDEEVEIEVQ-----EDFLSFSADLVAEQLTYMDALLFKKVVPHHCLGSVWSQRDKKENKQAAPTVRATITQFNAVAGCVVST----------------------VLHQRHLRPHLRA---------RIIQRWIDVAQECRIRKNFSSLKAIVSALQSNPIYRLKRAWACVHKDNMQVFEELSDIFSDHNNYLTSRELLMREGTSKFANLENCAKEHQKRSQKRLQLQKDAGAMQGTIPYLGTFLTDLTMLDTALPDLV----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCLSPDSAFLRWFKSQSQHTEEES 530          

HSP 2 Score: 51.9878 bits (123), Expect = 2.331e-6
Identity = 22/58 (37.93%), Postives = 36/58 (62.07%), Query Frame = 1
Query: 1957 LYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYAL 2130
            LYK I +  ++ T   I R   K  L      ++E++QV+ + +E++IP+NANVFYA+
Sbjct:  703 LYKSIMLTNQDKTPAVISRAMAKHNLEEEQAEDYELVQVISDERELVIPDNANVFYAM 760          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Cavefish
Match: rgl3a (ral guanine nucleotide dissociation stimulator-like 1 [Source:NCBI gene;Acc:103035789])

HSP 1 Score: 83.1889 bits (204), Expect = 6.456e-16
Identity = 125/503 (24.85%), Postives = 201/503 (39.96%), Query Frame = 1
Query:  118 KGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYREL----PVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQ----KVLRDLKLQEMLSYTRKKP----APSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLIL-----------SELVGNNKQTD--------QVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQ-YQLLMKVNEPHINHNKELK-RSISNNS--------SSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEHRNSYN 1503
            K  TL+ ++     P  + D     I L TYR +     +++L+ +R   ++N      + S        +V  L+  WL   +  DF + P   ++  L   +R               +  FRR+  +  ++L    + D+   S   EL     VD   G       + +     E  L  SA  IA  LT +D     KV+    L  + S   KK     AP+V A I ++N + N V  ++  P+ A+ P      S   +P S  S  L           S  +    Q+         Q  ++I+KWI +AQ+   +RNFSSL AI +AL ++S   + K  + +  +   +  ++ E   + N  L  R I  +         S AP   R   +       EVPYLGTYL  LT ++   PD +          E  LIN EK RR+F++L Q+++  ++       +     +W     R S     + SYN
Sbjct:   63 KAATLQRLVSELVQPECS-DPDYPRIFLSTYRAFTCTTSLVQLLFQREDSITNLDSSVCVRS--------SVPVLVRLWL-DEYWEDFRDAPQRSALRLLCAHLR--------------HRLCFRRLARQAETLLHTLQEEDKRSISEQSELSSGPAVDGISGKELTGSDQAQ----TEGLLSFSARDIAEQLTRLDADLFVKVVPFHCLGCIWSQRDKKENRSLAPTVRATIAQFNAVTNWVITSLLCPNSASTP------SSPQTPRSPKSSCLPTPPQSPKPPRSPRLARMCQSALCLLTSPAQRARIIEKWISVAQECHQLRNFSSLRAILSALQSNSVYRLKKTWAAVSRESVAVFEQLCENFPDENCVLTTREILEDGNQTDDGCLSKAPKSPRLSPRHTSCSTGEVPYLGTYLTALTMLDTALPDTV----------EGGLINFEKRRREFEILSQIRVLQASCSLYSFPTHPSICSWL----RSSTPLSDQQSYN 517          

HSP 2 Score: 58.9214 bits (141), Expect = 1.660e-8
Identity = 26/66 (39.39%), Postives = 41/66 (62.12%), Query Frame = 1
Query: 1951 NILYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALAKQDQY 2148
              +YK I I  ++ T+  ++R   K  L NL  ++F +IQ+L +NKE+L+P+ ANVFYA+     Y
Sbjct:  648 GTIYKSILITSQDKTSQVVQRALSKHNLDNLTSNDFSLIQMLPHNKELLLPDKANVFYAMCPSASY 713          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Cavefish
Match: rgl3a (ral guanine nucleotide dissociation stimulator-like 1 [Source:NCBI gene;Acc:103035789])

HSP 1 Score: 82.8037 bits (203), Expect = 9.052e-16
Identity = 125/503 (24.85%), Postives = 201/503 (39.96%), Query Frame = 1
Query:  118 KGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYREL----PVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQ----KVLRDLKLQEMLSYTRKKP----APSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLIL-----------SELVGNNKQTD--------QVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQ-YQLLMKVNEPHINHNKELK-RSISNNS--------SSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEHRNSYN 1503
            K  TL+ ++     P  + D     I L TYR +     +++L+ +R   ++N      + S        +V  L+  WL   +  DF + P   ++  L   +R               +  FRR+  +  ++L    + D+   S   EL     VD   G       + +     E  L  SA  IA  LT +D     KV+    L  + S   KK     AP+V A I ++N + N V  ++  P+ A+ P      S   +P S  S  L           S  +    Q+         Q  ++I+KWI +AQ+   +RNFSSL AI +AL ++S   + K  + +  +   +  ++ E   + N  L  R I  +         S AP   R   +       EVPYLGTYL  LT ++   PD +          E  LIN EK RR+F++L Q+++  ++       +     +W     R S     + SYN
Sbjct:  106 KAATLQRLVSELVQPECS-DPDYPRIFLSTYRAFTCTTSLVQLLFQREDSITNLDSSVCVRS--------SVPVLVRLWL-DEYWEDFRDAPQRSALRLLCAHLR--------------HRLCFRRLARQAETLLHTLQEEDKRSISEQSELSSGPAVDGISGKELTGSDQAQ----TEGLLSFSARDIAEQLTRLDADLFVKVVPFHCLGCIWSQRDKKENRSLAPTVRATIAQFNAVTNWVITSLLCPNSASTP------SSPQTPRSPKSSCLPTPPQSPKPPRSPRLARMCQSALCLLTSPAQRARIIEKWISVAQECHQLRNFSSLRAILSALQSNSVYRLKKTWAAVSRESVAVFEQLCENFPDENCVLTTREILEDGNQTDDGCLSKAPKSPRLSPRHTSCSTGEVPYLGTYLTALTMLDTALPDTV----------EGGLINFEKRRREFEILSQIRVLQASCSLYSFPTHPSICSWL----RSSTPLSDQQSYN 560          

HSP 2 Score: 58.9214 bits (141), Expect = 1.731e-8
Identity = 26/66 (39.39%), Postives = 41/66 (62.12%), Query Frame = 1
Query: 1951 NILYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALAKQDQY 2148
              +YK I I  ++ T+  ++R   K  L NL  ++F +IQ+L +NKE+L+P+ ANVFYA+     Y
Sbjct:  691 GTIYKSILITSQDKTSQVVQRALSKHNLDNLTSNDFSLIQMLPHNKELLLPDKANVFYAMCPSASY 756          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Cavefish
Match: rgl2 (ral guanine nucleotide dissociation stimulator-like 2 [Source:NCBI gene;Acc:103024618])

HSP 1 Score: 72.0182 bits (175), Expect = 1.588e-12
Identity = 53/193 (27.46%), Postives = 98/193 (50.78%), Query Frame = 1
Query:  934 QTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDX----XXXXXXXXXXXXLYNQYQLLMKVNEPHINHNKE---LKRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEHR 1491
            +T Q  + ++KWI +A+     +NFSSL AI +AL +        +  +   +   +Y+ L  +     N+++    LK   ++ +++  TK  N+ +        VPYLG +L +LT ++    D L+      NG     IN +K RR+F+VL +++L  S+ +    +SD+ FL+WY  +   +E+  +R
Sbjct:  330 KTQQRSRFLEKWISVAEACRARKNFSSLYAIVSALQSNPIHRLRKTWQETDREAVKRYEELAYIFSEKDNYSQSRELLKEEGTSKTANVDTKINNR-RHTSSAQGTVPYLGIFLTDLTMLDAAVKDRLE------NG----YINFDKRRREFEVLAKIRLLQSSCRNSTFRSDESFLHWYHSVPMLTEEESYR 511          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Sea Lamprey
Match: rgl1 (ral guanine nucleotide dissociation stimulator-like 1 [Source:NCBI gene;Acc:402933])

HSP 1 Score: 80.8777 bits (198), Expect = 6.978e-16
Identity = 65/251 (25.90%), Postives = 116/251 (46.22%), Query Frame = 1
Query:  757 APSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQ----YQLLMKVNEPHINH--NKEL--KRSISNNSSSAPTKTRNKSKMLK--ILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEK 1479
            APSV A I ++N +   V  T+       R       +G  +P +          G      Q  +V++ WI +AQ+   ++NFSSL AI +AL  +    + K    +  +    +  L ++     NH  ++EL  K   S  +S       ++ +  K  ++   +PYLGT+L +LT ++   PD++          E  LIN EK R++F+V+ Q++L   A     +  +  FL+W++  ++ SE+
Sbjct:  377 APSVRATIAQFNAVAACVACTV------LRCLSGQAAAGHGAPGT----------GARHAAAQRARVVEHWIAVAQECRMLKNFSSLRAILSALQTNPIHRLKKTWCCVSREKIVAFAELSEIFSDENNHFTSRELLMKEGTSKFASLDSNGKESQKRTFKAGLMQGTIPYLGTFLTDLTMLDTALPDYV----------EGGLINFEKRRKEFEVIAQIQLLQLACNNYSLSPEGKFLDWFNRQEKLSEE 601          

HSP 2 Score: 48.521 bits (114), Expect = 5.811e-6
Identity = 19/59 (32.20%), Postives = 39/59 (66.10%), Query Frame = 1
Query: 1957 LYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALA 2133
            LYK + +  ++ T+  I +  VK+ L      +++++QV+ N +E+++P+ ANVFYA++
Sbjct:  779 LYKSVLLTSQDKTSSVIGKAMVKYNLEMERAEDYQLVQVISNERELVMPDRANVFYAMS 837          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Medaka
Match: rgl1 (ral guanine nucleotide dissociation stimulator like 1 [Source:NCBI gene;Acc:101173538])

HSP 1 Score: 105.145 bits (261), Expect = 8.226e-23
Identity = 121/490 (24.69%), Postives = 209/490 (42.65%), Query Frame = 1
Query:  112 SYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKL--SNEVRPSEINSKENEGYTK-AVIFLLNSWL-MFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSF-GDSFYL--KPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYT--------RKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLY-NQYQLLMKVNEPHINHN----------KELKRSISNNSSSAPTKTRNKSKMLKI------LYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWY-SEIQRQSEKS 1482
            S +  TLE +++       + D    +I L TYR +     +++L+  R+  +  S  V P +  S E  G  + A+  +L +WL   P   DF E PDY  ++ L+           +++++    E+ RR E    S+L       E   S  R    D  F G+S +   + E  + +  E FL  +ADL+A  LT++D  + R +     L            K  AP++ A I ++N +   V  T+                     + H  L          +     ++I +WI +AQ+    +NFSSL AI +AL ++    + +  + ++ +  Q   ++++   +HN          +E     ++  S A    +   K L++      +   +PYLGT+L +LT ++   PD +          E  LIN EK RR+F+V+ Q+KL  SA     +  D  FL W+ S+ Q   E+S
Sbjct:   74 SIRAGTLERLVETLLTAFGDNDLTYTSIFLSTYRAFASTQTVLQLLLDRYGNVEESGPV-PEQCQSSEGHGAIRNALASILRAWLDQCP--EDFQEPPDYPCLHRLM----------GYLQRALPGSETLRRAE----SLL-------EQLQSQARLEETDGGFHGNSSFCLGEEEEVEIEVQEDFLSFNADLVAEQLTYMDALLFRKVIPHHCLGSIWSQRDKKDHKHSAPTIRATITQFNAVAACVVSTV---------------------LKHRQL----------RPHVRARLIQRWIDVAQECRIRKNFSSLRAIVSALQSNPLYRLKRVWACVHRDSMQTFEELSDIFSDHNNYLTSRELLMREGTSKFASLESGAKEHQKRTHKRLQLQKEMGAMQGTIPYLGTFLTDLTMLDTALPDLV----------EGGLINFEKRRREFEVIAQIKLLQSACNSYCLSGDAAFLRWFRSQPQLSEEES 498          

HSP 2 Score: 53.9138 bits (128), Expect = 6.842e-7
Identity = 25/63 (39.68%), Postives = 35/63 (55.56%), Query Frame = 1
Query: 1942 HLENILYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYAL 2130
            H    LYK I +  ++ T   I R   K  L       +E++QV+   KE+LIP+NANVFYA+
Sbjct:  662 HGNGNLYKSILLTSQDKTPAVISRAMAKHNLEGEPEDGYELVQVISEEKELLIPDNANVFYAM 724          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Medaka
Match: ENSORLT00000046063.1 (ral guanine nucleotide dissociation stimulator [Source:NCBI gene;Acc:101161408])

HSP 1 Score: 91.2781 bits (225), Expect = 1.643e-18
Identity = 115/472 (24.36%), Postives = 196/472 (41.53%), Query Frame = 1
Query:  118 KGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKA-VIFLLNSWLMFPFAFDFHELPDYKSINYLLQ----------KIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYT------RKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK------VNEPHINHNKEL-----KRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNW 1449
            K  TLE ++    D S + +     I L TYR +       KLI   F+      R S  +  E   Y+K+ ++ L+ +WL   ++ DF + P + ++  LL            +RS P   S   +++   + F++ E+  N      + +++N++ +  E        DS    P  +        ++ SA  +A  LT ID  +   + L + L         ++  +P++ A I ++N + N V       SL  +P D    SGR  P S                 Q  ++I+KWI++AQ    ++NFSS+ AI +AL +++   + K  + +                +E  +  N+EL      +    N S   +K     + +      VPYLGTYL  LT ++   PD L          E+ LIN EK RR+FDVL Q+++  +      + S      W
Sbjct:   60 KAATLERLVSHLLDGS-SQEPDFAKIFLSTYRTF---TSTTKLIEMLFQ------RDSACSDLEAADYSKSPLLTLIQTWL-DEYSEDFRDPPLHPALQLLLDHLRISSAVHDGMRSQPNFCSLAGQADDLLKLFQKKEEESNGGSAAAD-VEQNEEGSGDE--------DSGCESPPDQG-----GIMDFSALSVAEQLTRIDSALFVKVVLYQCLGCVWSQRDKKENMSPTIRATITQFNAVTNQVMA-----SLLCQPSD----SGRAPPTS---------------PAQRARIIEKWIKVAQNCRRLKNFSSVKAILSALQSNAVYRLRKTWTAVSRDSMAAFDNLCDTFPDENCVLTNRELTAEDGTQGTMENVSPKISKKCPLPRQMSTSGGVVPYLGTYLSVLTMLDTALPDTL----------EDGLINFEKRRREFDVLSQIRVLQACCAQYSLPSHPRIAAW 472          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Medaka
Match: ENSORLT00000020629.2 (ral guanine nucleotide dissociation stimulator [Source:NCBI gene;Acc:101161408])

HSP 1 Score: 90.8929 bits (224), Expect = 2.175e-18
Identity = 115/472 (24.36%), Postives = 196/472 (41.53%), Query Frame = 1
Query:  118 KGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKA-VIFLLNSWLMFPFAFDFHELPDYKSINYLLQ----------KIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYT------RKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMK------VNEPHINHNKEL-----KRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNW 1449
            K  TLE ++    D S + +     I L TYR +       KLI   F+      R S  +  E   Y+K+ ++ L+ +WL   ++ DF + P + ++  LL            +RS P   S   +++   + F++ E+  N      + +++N++ +  E        DS    P  +        ++ SA  +A  LT ID  +   + L + L         ++  +P++ A I ++N + N V       SL  +P D    SGR  P S                 Q  ++I+KWI++AQ    ++NFSS+ AI +AL +++   + K  + +                +E  +  N+EL      +    N S   +K     + +      VPYLGTYL  LT ++   PD L          E+ LIN EK RR+FDVL Q+++  +      + S      W
Sbjct:   60 KAATLERLVSHLLDGS-SQEPDFAKIFLSTYRTF---TSTTKLIEMLFQ------RDSACSDLEAADYSKSPLLTLIQTWL-DEYSEDFRDPPLHPALQLLLDHLRISSAVHDGMRSQPNFCSLAGQADDLLKLFQKKEEESNGGSAAAD-VEQNEEGSGDE--------DSGCESPPDQG-----GIMDFSALSVAEQLTRIDSALFVKVVLYQCLGCVWSQRDKKENMSPTIRATITQFNAVTNQVMA-----SLLCQPSD----SGRAPPTS---------------PAQRARIIEKWIKVAQNCRRLKNFSSVKAILSALQSNAVYRLRKTWTAVSRDSMAAFDNLCDTFPDENCVLTNRELTAEDGTQGTMENVSPKISKKCPLPRQMSTSGGVVPYLGTYLSVLTMLDTALPDTL----------EDGLINFEKRRREFDVLSQIRVLQACCAQYSLPSHPRIAAW 472          

HSP 2 Score: 55.4546 bits (132), Expect = 2.378e-7
Identity = 23/59 (38.98%), Postives = 39/59 (66.10%), Query Frame = 1
Query: 1957 LYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALA 2133
            +YK I +  ++ TA  I++   K  L ++D  NF + QV+  +KE++IP+ ANVFYA++
Sbjct:  655 MYKSILLTSQDKTAQVIQKALDKHHLEHMDGQNFSLTQVISQHKELVIPDKANVFYAMS 713          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Medaka
Match: rgl3a (ral guanine nucleotide dissociation stimulator-like 1 [Source:NCBI gene;Acc:101160466])

HSP 1 Score: 73.9442 bits (180), Expect = 3.971e-13
Identity = 100/451 (22.17%), Postives = 183/451 (40.58%), Query Frame = 1
Query:  118 KGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYT--------RKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDK------------YQYSGRNSP-VSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQ----YQLLMKV--NEPHINHNKELKRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVK 1389
            K  TL  ++    DP  + +   +++ L TYR +  P  +++L+ +R    SN    S ++S         ++ ++  WL   ++ DF E PD+ ++  L   +                +  FRR+  + + +L    +              DC   D      +  Q      F++ S   +A  LT +D ++   +     L            ++ APSV A I ++N + N V  ++  PS  +                 Y  S  +SP   H S                 ++I+ WI +AQ+   ++NFSSL AI +AL +++   + K  + +  +    ++ L +   +E  +  ++E+    S+     P +   +S+        VPYLGTYL  LT ++   PD L          E  L+N EK RR+F++L Q++
Sbjct:   61 KAGTLGRLVAHLLDPD-SREPDFIHVFLSTYRAFTSPRTLVELLFQRDVTFSN--LESAVSS------CSPLLPVVRLWLD-EYSKDFQEPPDFPALRLLCAHLHG--------------RLCFRRLAQKADVLLKRLQQ-------------QDCKQSDGHESLEDEGQISGKHDFMDFSVREVAEQLTRLDAELFVRVVPFHCLGCVWSQRDKKQNRQQAPSVRATISQFNAVTNRVITSLLCPSSPSPSTSSPISSPCPASTFLYPPSAPSSPHCPHSS------------PAHRARIIEWWITVAQECRQLKNFSSLRAILSALQSNAVYRLRKTWAAVSRESMSVFEHLCETFPDENCVLTSREVLEDGSHPDGIRPPRVCPESRHTSFSGGVVPYLGTYLTVLTMLDTALPDTL----------EGGLVNFEKRRREFEILSQIR 452          

HSP 2 Score: 52.373 bits (124), Expect = 1.817e-6
Identity = 27/86 (31.40%), Postives = 46/86 (53.49%), Query Frame = 1
Query: 1912 SVNKVENGAAHLENILYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALAKQDQYVVEVQPK 2169
            +V  V NG       +YK I ++ ++HT   I+R   K  + +    +F ++Q L + KE+ IP+ ANVFYA+     Y   ++P+
Sbjct:  637 TVESVSNGN------VYKSILLSSQDHTPQVIQRALEKHNMEDSSSGDFSLLQKLNHGKELHIPDKANVFYAMCTSANYDFVLRPR 716          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Medaka
Match: rgl3a (ral guanine nucleotide dissociation stimulator-like 1 [Source:NCBI gene;Acc:101160466])

HSP 1 Score: 73.9442 bits (180), Expect = 4.385e-13
Identity = 100/451 (22.17%), Postives = 183/451 (40.58%), Query Frame = 1
Query:  118 KGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYT--------RKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDK------------YQYSGRNSP-VSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQ----YQLLMKV--NEPHINHNKELKRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVK 1389
            K  TL  ++    DP  + +   +++ L TYR +  P  +++L+ +R    SN    S ++S         ++ ++  WL   ++ DF E PD+ ++  L   +                +  FRR+  + + +L    +              DC   D      +  Q      F++ S   +A  LT +D ++   +     L            ++ APSV A I ++N + N V  ++  PS  +                 Y  S  +SP   H S                 ++I+ WI +AQ+   ++NFSSL AI +AL +++   + K  + +  +    ++ L +   +E  +  ++E+    S+     P +   +S+        VPYLGTYL  LT ++   PD L          E  L+N EK RR+F++L Q++
Sbjct:  118 KAGTLGRLVAHLLDPD-SREPDFIHVFLSTYRAFTSPRTLVELLFQRDVTFSNLE--SAVSS------CSPLLPVVRLWLD-EYSKDFQEPPDFPALRLLCAHLHG--------------RLCFRRLAQKADVLLKRLQQ-------------QDCKQSDGHESLEDEGQISGKHDFMDFSVREVAEQLTRLDAELFVRVVPFHCLGCVWSQRDKKQNRQQAPSVRATISQFNAVTNRVITSLLCPSSPSPSTSSPISSPCPASTFLYPPSAPSSPHCPHSS------------PAHRARIIEWWITVAQECRQLKNFSSLRAILSALQSNAVYRLRKTWAAVSRESMSVFEHLCETFPDENCVLTSREVLEDGSHPDGIRPPRVCPESRHTSFSGGVVPYLGTYLTVLTMLDTALPDTL----------EGGLVNFEKRRREFEILSQIR 509          

HSP 2 Score: 52.373 bits (124), Expect = 2.049e-6
Identity = 27/86 (31.40%), Postives = 46/86 (53.49%), Query Frame = 1
Query: 1912 SVNKVENGAAHLENILYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALAKQDQYVVEVQPK 2169
            +V  V NG       +YK I ++ ++HT   I+R   K  + +    +F ++Q L + KE+ IP+ ANVFYA+     Y   ++P+
Sbjct:  694 TVESVSNGN------VYKSILLSSQDHTPQVIQRALEKHNMEDSSSGDFSLLQKLNHGKELHIPDKANVFYAMCTSANYDFVLRPR 773          
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Planmine SMEST
Match: SMESG000030180.1 (SMESG000030180.1)

HSP 1 Score: 1317.75 bits (3409), Expect = 0.000e+0
Identity = 689/690 (99.86%), Postives = 689/690 (99.86%), Query Frame = 1
Query:  106 MASYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYTRKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDXXXXXXXXXXXXXLYNQYQLLMKVNEPHINHNKELKRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEHRNSYNGSILSLESTKXXXXXXXXXXXXXVNQYFSAGKISKQYQYKSHQSLTDEIIRNRXXXXXXXXXXXXXRETKIETVNCKVATVKLKLPKYTEIQNTSLYRSTNCIQNLKVTKKPETISNSALYKRDRLLLPNLARSSSSVNKVENGAAHLENILYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPENANVFYALAKQDQYVVEVQPKRS 2175
            MASYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYTRKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDNSSNISIMKKSSKLYNQYQLLMKVNEPHINHNKELKRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEHRNSYNGSILSLESTKSDNSGNSDISSSSVNQYFSAGKISKQYQYKSHQSLTDEIIRNRSKSSPTKKVSTTKRETKIETVNCKVATVKLKLPKYTEIQNTSLYRSTNCIQNLKVTKKPETISNSALYKRDRLLLPNLARSSSSVNKVENGAAHLENILYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPE ANVFYALAKQDQYVVEVQPKRS
Sbjct:    1 MASYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINRRFKKLSNEVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKSINYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKDSNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKVLRDLKLQEMLSYTRKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFDKYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRNFSSLMAIFTALDNSSNISIMKKSSKLYNQYQLLMKVNEPHINHNKELKRSISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPSSIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYSEIQRQSEKSEHRNSYNGSILSLESTKSDNSGNSDISSSSVNQYFSAGKISKQYQYKSHQSLTDEIIRNRSKSSPTKKVSTTKRETKIETVNCKVATVKLKLPKYTEIQNTSLYRSTNCIQNLKVTKKPETISNSALYKRDRLLLPNLARSSSSVNKVENGAAHLENILYKKIQINEKEHTADFIERVFVKFCLSNLDPSNFEVIQVLENNKEILIPEKANVFYALAKQDQYVVEVQPKRS 690          
The following BLAST results are available for this feature:
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGL12.715e-2325.16ral guanine nucleotide dissociation stimulator lik... [more]
RGL13.260e-2325.16ral guanine nucleotide dissociation stimulator lik... [more]
RALGDS4.485e-1528.77ral guanine nucleotide dissociation stimulator [So... [more]
RALGDS4.973e-1528.77ral guanine nucleotide dissociation stimulator [So... [more]
RALGDS5.006e-1528.77ral guanine nucleotide dissociation stimulator [So... [more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rgl-11.723e-1227.87Ral GDS-Like [Source:UniProtKB/TrEMBL;Acc:G4SFM6][more]
rgl-11.819e-1227.87Ral GDS-Like [Source:UniProtKB/TrEMBL;Acc:G4SFM6][more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rgl2.905e-1329.67gene:FBgn0026376 transcript:FBtr0075793[more]
Rgl2.957e-1329.67gene:FBgn0026376 transcript:FBtr0330186[more]
Rgl3.555e-1329.67gene:FBgn0026376 transcript:FBtr0075794[more]
Rgl3.555e-1329.67gene:FBgn0026376 transcript:FBtr0075795[more]
Rgl3.555e-1329.67gene:FBgn0026376 transcript:FBtr0075796[more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgl17.282e-2123.55ral guanine nucleotide dissociation stimulator-lik... [more]
rgl18.100e-2123.55ral guanine nucleotide dissociation stimulator-lik... [more]
rgl18.873e-2123.55ral guanine nucleotide dissociation stimulator-lik... [more]
RALGDS7.002e-1621.13si:ch211-251j10.3 [Source:ZFIN;Acc:ZDB-GENE-081105... [more]
si:ch211-251j10.32.219e-1321.99si:ch211-251j10.3 [Source:ZFIN;Acc:ZDB-GENE-081105... [more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ralgds7.532e-1623.33ral guanine nucleotide dissociation stimulator [So... [more]
ralgds7.865e-1623.33ral guanine nucleotide dissociation stimulator [So... [more]
ralgds7.922e-1623.33ral guanine nucleotide dissociation stimulator [So... [more]
ENSXETT00000049087.19.622e-1226.09ral guanine nucleotide dissociation stimulator lik... [more]
ENSXETT00000049092.11.146e-1126.63ral guanine nucleotide dissociation stimulator lik... [more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rgl11.086e-2124.44ral guanine nucleotide dissociation stimulator,-li... [more]
Rgl11.263e-2124.44ral guanine nucleotide dissociation stimulator,-li... [more]
Rgl11.573e-2124.44ral guanine nucleotide dissociation stimulator,-li... [more]
Ralgds3.615e-1427.57ral guanine nucleotide dissociation stimulator [So... [more]
Ralgds4.069e-1427.57ral guanine nucleotide dissociation stimulator [So... [more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NZL6|RGL1_HUMAN1.565e-2225.16Ral guanine nucleotide dissociation stimulator-lik... [more]
sp|Q60695|RGL1_MOUSE1.100e-2024.44Ral guanine nucleotide dissociation stimulator-lik... [more]
sp|Q6P112|RGL1_DANRE2.184e-1923.31Ral guanine nucleotide dissociation stimulator-lik... [more]
sp|Q12967|GNDS_HUMAN2.348e-1428.77Ral guanine nucleotide dissociation stimulator OS=... [more]
sp|Q03385|GNDS_MOUSE2.992e-1327.57Ral guanine nucleotide dissociation stimulator OS=... [more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JH062.801e-2425.55Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2D0R0R11.291e-2224.63ral guanine nucleotide dissociation stimulator-lik... [more]
A0A5N5NI431.355e-2224.59Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A2D0R1H11.520e-2224.63ral guanine nucleotide dissociation stimulator-lik... [more]
A0A3B3BIW47.701e-2225.10Ral guanine nucleotide dissociation stimulator-lik... [more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgl15.991e-2424.28ral guanine nucleotide dissociation stimulator lik... [more]
rgl15.997e-2424.28ral guanine nucleotide dissociation stimulator lik... [more]
rgl3a6.456e-1624.85ral guanine nucleotide dissociation stimulator-lik... [more]
rgl3a9.052e-1624.85ral guanine nucleotide dissociation stimulator-lik... [more]
rgl21.588e-1227.46ral guanine nucleotide dissociation stimulator-lik... [more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rgl16.978e-1625.90ral guanine nucleotide dissociation stimulator-lik... [more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgl18.226e-2324.69ral guanine nucleotide dissociation stimulator lik... [more]
ENSORLT00000046063.11.643e-1824.36ral guanine nucleotide dissociation stimulator [So... [more]
ENSORLT00000020629.22.175e-1824.36ral guanine nucleotide dissociation stimulator [So... [more]
rgl3a3.971e-1322.17ral guanine nucleotide dissociation stimulator-lik... [more]
rgl3a4.385e-1322.17ral guanine nucleotide dissociation stimulator-lik... [more]
back to top
BLAST of Ral guanine nucleotide dissociation stimulator like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000030180.10.000e+099.86SMESG000030180.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027168 ID=SMED30027168|Name=Ral guanine nucleotide dissociation stimulator like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2491bp
TTTGAATGTTAAAATGTCATTATTTTTTCCAAAATTAATTAAATGGTTTT
TAAACCGGATAAACTAAAATAACATTTATTTTTGAAAATTAAATACATTT
ATATTATGGCATCGTATAAAGGATTGACTTTAGAAGAGATAATTGACTGT
TTTACAGATCCATCGTATAATATGGATAGTCAATTGTTGAATATTATTTT
ATATACTTACAGAAATTACTGTGATCCGTTGGATATTATTAAATTGATTA
ATAGGAGGTTTAAAAAACTGAGCAATGAAGTTAGACCTTCTGAAATAAAT
TCTAAGGAAAATGAAGGCTATACAAAGGCCGTCATTTTCCTGTTGAACAG
CTGGTTAATGTTTCCATTTGCCTTTGATTTCCATGAGCTACCTGATTATA
AATCTATTAATTACCTTCTACAGAAAATAAGATCCTGGCCCCAAGAAGTC
TCATTTATTAGGAAATCAGAATCCTTCAAAGAATCCTTTCGACGAGTCGA
AGACAGAGTCAACAGTGTTCTTGTGGAATTCAATAAGATAGACGAGAACA
AGGATTCAAATTATCGAGAGCTCCCCGTGGACTGTAGTTTTGGAGACTCA
TTTTACCTGAAACCAGAAATCAAGCAGAAGAAGTTTAATGAATCTTTTCT
TGAATGTTCTGCAGATTTAATAGCGAATTGTCTCACCCATATAGATCAAA
AAGTATTGAGGGATCTAAAATTACAAGAAATGCTAAGCTACACTCGGAAA
AAACCTGCACCCTCTGTGACAGCAATAATTGATAAATATAACCAGCTTTA
CAACGTCGTATGCATAACTATAAATGAGCCGTCTTTGGCTACAAGACCCT
TCGATAAATATCAGTATTCAGGGAGAAATTCTCCAGTGTCCCACGACAGC
CTGATCCTCAGTGAATTAGTGGGGAATAACAAGCAAACGGATCAAGTGTA
TCAAGTGATTGATAAATGGATTCAAATTGCCCAAAAATTAAGCGATATGC
GCAATTTTTCTTCATTGATGGCTATTTTTACTGCACTGGACAATTCATCC
AACATATCTATAATGAAGAAATCTTCTAAACTTTACAACCAATATCAATT
ATTAATGAAGGTAAACGAGCCTCATATAAATCATAATAAGGAACTCAAAA
GATCAATTTCAAATAATTCCTCTTCGGCTCCGACAAAAACTCGGAACAAA
TCGAAGATGTTGAAAATCCTCTACAATGAAGTTCCTTATTTAGGAACTTA
TTTGAAAAACTTGACCTACATCGAGGATGGATTTCCGGATTTTCTTAAAC
CCTCTTCAATCGTTTACAATGGCAACGAAGAGAGATTGATAAATTTAGAG
AAATGCCGAAGACAATTCGATGTACTTGTTCAAGTCAAACTGTGTATTTC
AGCACTGAAAGGTGTTGAGATGAAGTCAGACGATATATTTCTCAACTGGT
ACTCCGAAATTCAACGTCAATCTGAAAAATCCGAACATAGGAATTCGTAT
AATGGCTCAATTTTATCTCTCGAAAGTACAAAATCAGACAATTCCGGGAA
TTCTGATATCAGTTCCAGTTCAGTGAATCAATATTTTAGTGCCGGCAAGA
TTAGCAAGCAGTACCAATACAAATCCCACCAAAGTCTCACGGATGAAATA
ATTCGAAACAGATCAAAATCAAGCCCGACCAAAAAGGTGTCAACGACTAA
GCGAGAGACGAAAATTGAAACAGTCAACTGTAAAGTAGCGACTGTCAAAT
TGAAATTACCGAAATATACAGAAATTCAAAATACGAGCTTATATCGCTCA
ACGAATTGCATTCAAAACCTTAAGGTTACTAAGAAACCTGAAACGATTAG
TAACTCAGCGTTGTATAAGCGTGATAGGTTACTATTGCCAAATCTTGCTC
GCTCATCTTCGTCGGTGAATAAAGTCGAGAATGGAGCAGCCCATTTGGAG
AATATTCTTTACAAGAAAATACAGATAAATGAAAAAGAACATACAGCGGA
TTTTATTGAACGTGTTTTTGTGAAATTTTGCCTATCAAATTTAGATCCGT
CGAATTTTGAAGTGATCCAGGTCTTAGAAAACAATAAAGAAATCTTAATC
CCCGAAAACGCAAATGTGTTTTATGCATTGGCAAAACAAGATCAGTATGT
GGTGGAAGTCCAGCCTAAAAGATCCTAACTCTCTTGAAGTTGATTTCTAT
TCATTTTATAATTTTCTACGCTGTCTTTCAACTGCAAAGACCGAAACCGT
TGAAATCGTTCTAGTTTTGTATATAAAATTGTAATCTTAGACTTATTCCG
ATTTATCTCCAATAACGTGCTAAAGAAGATTTATTTTGCTTAAATTGGTT
TGAACCACAGTTTGAACGATTTATCTTTACTCTATCACTTTTATTTCACT
TTTATATTGAAAAATTTGGTGCAAAAATAGATTTGAATTATTTCAACTTG
TATTTCTTTGATAAATCGAATATTTCACAACTGGAAATGGA
back to top

protein sequence of SMED30027168-orf-1

>SMED30027168-orf-1 ID=SMED30027168-orf-1|Name=SMED30027168-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=691bp
MASYKGLTLEEIIDCFTDPSYNMDSQLLNIILYTYRNYCDPLDIIKLINR
RFKKLSNEVRPSEINSKENEGYTKAVIFLLNSWLMFPFAFDFHELPDYKS
INYLLQKIRSWPQEVSFIRKSESFKESFRRVEDRVNSVLVEFNKIDENKD
SNYRELPVDCSFGDSFYLKPEIKQKKFNESFLECSADLIANCLTHIDQKV
LRDLKLQEMLSYTRKKPAPSVTAIIDKYNQLYNVVCITINEPSLATRPFD
KYQYSGRNSPVSHDSLILSELVGNNKQTDQVYQVIDKWIQIAQKLSDMRN
FSSLMAIFTALDNSSNISIMKKSSKLYNQYQLLMKVNEPHINHNKELKRS
ISNNSSSAPTKTRNKSKMLKILYNEVPYLGTYLKNLTYIEDGFPDFLKPS
SIVYNGNEERLINLEKCRRQFDVLVQVKLCISALKGVEMKSDDIFLNWYS
EIQRQSEKSEHRNSYNGSILSLESTKSDNSGNSDISSSSVNQYFSAGKIS
KQYQYKSHQSLTDEIIRNRSKSSPTKKVSTTKRETKIETVNCKVATVKLK
LPKYTEIQNTSLYRSTNCIQNLKVTKKPETISNSALYKRDRLLLPNLARS
SSSVNKVENGAAHLENILYKKIQINEKEHTADFIERVFVKFCLSNLDPSN
FEVIQVLENNKEILIPENANVFYALAKQDQYVVEVQPKRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007264small GTPase mediated signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036964RASGEF_cat_dom_sf
IPR008937Ras-like_GEF
IPR030748RGL1
IPR001895RASGEF_cat_dom
IPR000651Ras-like_Gua-exchang_fac_N
IPR029071Ubiquitin-like_domsf
IPR023578Ras_GEF_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0008321Ral guanyl-nucleotide exchange factor activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001895Ras guanine-nucleotide exchange factors catalytic domainSMARTSM00147RasGEF_3coord: 181..475
e-value: 4.4E-15
score: 66.1
IPR001895Ras guanine-nucleotide exchange factors catalytic domainPFAMPF00617RasGEFcoord: 189..418
e-value: 9.9E-27
score: 94.3
IPR001895Ras guanine-nucleotide exchange factors catalytic domainPROSITEPS50009RASGEF_CATcoord: 185..462
score: 27.024
NoneNo IPR availableGENE3DG3DSA:1.20.870.10coord: 2..124
e-value: 3.8E-10
score: 41.7
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 582..690
e-value: 1.5E-15
score: 59.4
NoneNo IPR availableCDDcd00153RA_RalGDS_likecoord: 616..688
e-value: 1.79308E-15
score: 69.9102
IPR000651Ras-like guanine nucleotide exchange factor, N-terminalPFAMPF00618RasGEF_Ncoord: 4..97
e-value: 1.6E-8
score: 34.7
IPR000651Ras-like guanine nucleotide exchange factor, N-terminalPROSITEPS50212RASGEF_NTERcoord: 1..129
score: 13.613
IPR036964Ras guanine-nucleotide exchange factor catalytic domain superfamilyGENE3DG3DSA:1.10.840.10coord: 165..468
e-value: 1.2E-38
score: 135.1
IPR008937Ras-like guanine nucleotide exchange factorPANTHERPTHR23113GUANINE NUCLEOTIDE EXCHANGE FACTORcoord: 273..321
IPR008937Ras-like guanine nucleotide exchange factorPANTHERPTHR23113GUANINE NUCLEOTIDE EXCHANGE FACTORcoord: 331..680
coord: 9..239
IPR030748Ral guanine nucleotide dissociation stimulator-like 1PANTHERPTHR23113:SF199RAL GUANINE NUCLEOTIDE DISSOCIATION STIMULATOR-LIKE 1coord: 331..680
coord: 9..239
IPR030748Ral guanine nucleotide dissociation stimulator-like 1PANTHERPTHR23113:SF199RAL GUANINE NUCLEOTIDE DISSOCIATION STIMULATOR-LIKE 1coord: 273..321
IPR023578Ras guanine nucleotide exchange factor domain superfamilySUPERFAMILYSSF48366Ras GEFcoord: 269..463
IPR023578Ras guanine nucleotide exchange factor domain superfamilySUPERFAMILYSSF48366Ras GEFcoord: 5..241
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 615..679