MDS1 and EVI1 complex locus protein EVI1

Overview
NameMDS1 and EVI1 complex locus protein EVI1
Smed IDSMED30027162
Length (bp)1205
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MDS1 and EVI1 complex locus protein EVI1 (SMED30027162) t-SNE clustered cells

Violin plots show distribution of expression levels for MDS1 and EVI1 complex locus protein EVI1 (SMED30027162) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MDS1 and EVI1 complex locus protein EVI1 (SMED30027162) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MDS1 and EVI1 complex locus protein EVI1 (SMED30027162) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027162

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027162h1SMcG0018383 SmedASXL_001241SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30027162h1SMcG0018383 dd_Smed_v4_22685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027162h1SMcG0018383 dd_Smed_v4_22685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30027162h1SMcG0018383 dd_Smed_v4_22685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30027162h1SMcG0018383 dd_Smed_v4_22685_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027162h1SMcG0018383 dd_Smed_v6_22685_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Human
Match: MECOM (MDS1 and EVI1 complex locus [Source:HGNC Symbol;Acc:HGNC:3498])

HSP 1 Score: 143.28 bits (360), Expect = 1.806e-36
Identity = 77/161 (47.83%), Postives = 102/161 (63.35%), Query Frame = 1
Query:  727 SPLNVYTRQTSSYHNSIHNL-------PISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            SP  ++  Q S+  N    L       P + EL  S P +   N   PP +         P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  663 SPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSM--FNFRAPPNAL--------PENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 812          

HSP 2 Score: 72.7886 bits (177), Expect = 3.969e-13
Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  156 GARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 212          

HSP 3 Score: 67.3958 bits (163), Expect = 2.365e-11
Identity = 32/81 (39.51%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  131 YECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 210          

HSP 4 Score: 60.4622 bits (145), Expect = 3.511e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:   77 CKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 156          

HSP 5 Score: 60.077 bits (144), Expect = 4.731e-9
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  103 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 178          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Human
Match: MECOM (MDS1 and EVI1 complex locus [Source:HGNC Symbol;Acc:HGNC:3498])

HSP 1 Score: 142.895 bits (359), Expect = 2.156e-36
Identity = 77/161 (47.83%), Postives = 102/161 (63.35%), Query Frame = 1
Query:  727 SPLNVYTRQTSSYHNSIHNL-------PISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            SP  ++  Q S+  N    L       P + EL  S P +   N   PP +         P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  851 SPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSM--FNFRAPPNAL--------PENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 1000          

HSP 2 Score: 73.1738 bits (178), Expect = 3.806e-13
Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  344 GARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 400          

HSP 3 Score: 67.3958 bits (163), Expect = 2.261e-11
Identity = 32/81 (39.51%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  319 YECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 398          

HSP 4 Score: 60.4622 bits (145), Expect = 3.344e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:  265 CKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 344          

HSP 5 Score: 60.077 bits (144), Expect = 4.544e-9
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  291 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 366          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Human
Match: MECOM (MDS1 and EVI1 complex locus [Source:HGNC Symbol;Acc:HGNC:3498])

HSP 1 Score: 142.895 bits (359), Expect = 2.203e-36
Identity = 77/161 (47.83%), Postives = 102/161 (63.35%), Query Frame = 1
Query:  727 SPLNVYTRQTSSYHNSIHNL-------PISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            SP  ++  Q S+  N    L       P + EL  S P +   N   PP +         P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  663 SPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSM--FNFRAPPNAL--------PENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 812          

HSP 2 Score: 72.7886 bits (177), Expect = 4.602e-13
Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  156 GARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 212          

HSP 3 Score: 67.0106 bits (162), Expect = 2.717e-11
Identity = 32/81 (39.51%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  131 YECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 210          

HSP 4 Score: 60.4622 bits (145), Expect = 3.965e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:   77 CKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 156          

HSP 5 Score: 60.077 bits (144), Expect = 5.295e-9
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  103 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 178          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Human
Match: MECOM (MDS1 and EVI1 complex locus [Source:HGNC Symbol;Acc:HGNC:3498])

HSP 1 Score: 141.739 bits (356), Expect = 5.447e-36
Identity = 71/134 (52.99%), Postives = 93/134 (69.40%), Query Frame = 1
Query:  787 PISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            P + EL  S P +   N   PP +         P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  699 PEASELLQSVPSM--FNFRAPPNAL--------PENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 821          

HSP 2 Score: 72.7886 bits (177), Expect = 4.051e-13
Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  156 GARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 212          

HSP 3 Score: 67.3958 bits (163), Expect = 2.413e-11
Identity = 32/81 (39.51%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  131 YECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 210          

HSP 4 Score: 60.4622 bits (145), Expect = 3.519e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:   77 CKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 156          

HSP 5 Score: 60.077 bits (144), Expect = 4.741e-9
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  103 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 178          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Human
Match: MECOM (MDS1 and EVI1 complex locus [Source:HGNC Symbol;Acc:HGNC:3498])

HSP 1 Score: 141.739 bits (356), Expect = 5.447e-36
Identity = 71/134 (52.99%), Postives = 93/134 (69.40%), Query Frame = 1
Query:  787 PISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            P + EL  S P +   N   PP +         P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  699 PEASELLQSVPSM--FNFRAPPNAL--------PENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 821          

HSP 2 Score: 72.7886 bits (177), Expect = 4.051e-13
Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  156 GARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 212          

HSP 3 Score: 67.3958 bits (163), Expect = 2.413e-11
Identity = 32/81 (39.51%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  131 YECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 210          

HSP 4 Score: 60.4622 bits (145), Expect = 3.519e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:   77 CKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 156          

HSP 5 Score: 60.077 bits (144), Expect = 4.741e-9
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  103 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 178          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Celegans
Match: egl-43 (pep chromosome:WBcel235:II:9960333:9962344:1 gene:WBGene00001207.1 transcript:R53.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:egl-43)

HSP 1 Score: 105.531 bits (262), Expect = 2.464e-25
Identity = 45/56 (80.36%), Postives = 50/56 (89.29%), Query Frame = 1
Query:  910 DRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQK 1077
            DRY C+FC K+FPRSANLTRH+RTHTGEQPYKC +C R FSISSNLQRH+RNIH K
Sbjct:  221 DRYTCKFCQKVFPRSANLTRHLRTHTGEQPYKCQYCERSFSISSNLQRHVRNIHNK 276          

HSP 2 Score: 54.299 bits (129), Expect = 5.396e-8
Identity = 23/51 (45.10%), Postives = 32/51 (62.75%), Query Frame = 1
Query: 1000 YKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKN 1152
            Y C FC + F  S+NL RH+R  H  E+P+ C  C + F   +NL+RHV+N
Sbjct:  223 YTCKFCQKVFPRSANLTRHLRT-HTGEQPYKCQYCERSFSISSNLQRHVRN 272          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Celegans
Match: egl-43 (pep chromosome:WBcel235:II:9955185:9962344:1 gene:WBGene00001207.1 transcript:R53.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:egl-43)

HSP 1 Score: 104.375 bits (259), Expect = 4.550e-24
Identity = 45/56 (80.36%), Postives = 50/56 (89.29%), Query Frame = 1
Query:  910 DRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQK 1077
            DRY C+FC K+FPRSANLTRH+RTHTGEQPYKC +C R FSISSNLQRH+RNIH K
Sbjct:  442 DRYTCKFCQKVFPRSANLTRHLRTHTGEQPYKCQYCERSFSISSNLQRHVRNIHNK 497          

HSP 2 Score: 73.559 bits (179), Expect = 6.063e-14
Identity = 30/51 (58.82%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
            C  C K F+S +GLKQH H H + KP+RC +CPK+YTQFSNLCRH++ H +
Sbjct:  161 CGVCPKSFSSASGLKQHSHIHCSLKPFRCHLCPKSYTQFSNLCRHRRVHSD 211          

HSP 3 Score: 53.1434 bits (126), Expect = 2.145e-7
Identity = 23/51 (45.10%), Postives = 32/51 (62.75%), Query Frame = 1
Query: 1000 YKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKN 1152
            Y C FC + F  S+NL RH+R  H  E+P+ C  C + F   +NL+RHV+N
Sbjct:  444 YTCKFCQKVFPRSANLTRHLRT-HTGEQPYKCQYCERSFSISSNLQRHVRN 493          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 87.0409 bits (214), Expect = 3.871e-18
Identity = 40/83 (48.19%), Postives = 56/83 (67.47%), Query Frame = 1
Query:  907 RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + RY C+ C K F + +NL  HVRTHTGE+P+KC  CT+ F+  ++LQ+H   +H  ERP  CDIC KRF   +NL+ H++ H
Sbjct:  505 KTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKH-HLVHTGERPHRCDICDKRFSSTSNLKTHLRLH 586          

HSP 2 Score: 60.077 bits (144), Expect = 1.660e-9
Identity = 28/78 (35.90%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVK 1149
            + C  C K F  ++NL  H+R H G++PY C  C   F+   +L+ H R +H  ERP++C  C K++   + L  H K
Sbjct:  564 HRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKR-LHANERPYSCGTCGKKYISPSGLRTHWK 640          

HSP 3 Score: 50.0618 bits (118), Expect = 2.197e-6
Identity = 20/51 (39.22%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSH 375
            + C DC+K F   + LK H  TH+  +P++C IC K +TQ ++L +H   H
Sbjct:  508 YACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVH 558          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 86.6557 bits (213), Expect = 4.195e-18
Identity = 40/83 (48.19%), Postives = 56/83 (67.47%), Query Frame = 1
Query:  907 RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + RY C+ C K F + +NL  HVRTHTGE+P+KC  CT+ F+  ++LQ+H   +H  ERP  CDIC KRF   +NL+ H++ H
Sbjct:  505 KTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKH-HLVHTGERPHRCDICDKRFSSTSNLKTHLRLH 586          

HSP 2 Score: 60.077 bits (144), Expect = 1.847e-9
Identity = 28/78 (35.90%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVK 1149
            + C  C K F  ++NL  H+R H G++PY C  C   F+   +L+ H R +H  ERP++C  C K++   + L  H K
Sbjct:  564 HRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKR-LHANERPYSCGTCGKKYISPSGLRTHWK 640          

HSP 3 Score: 50.0618 bits (118), Expect = 2.363e-6
Identity = 20/51 (39.22%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSH 375
            + C DC+K F   + LK H  TH+  +P++C IC K +TQ ++L +H   H
Sbjct:  508 YACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVH 558          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 78.9518 bits (193), Expect = 9.832e-18
Identity = 38/86 (44.19%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  931 CGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSSA 1188
            C K F RS  LTRH+R HTG++P++C  C R FS S +L  H+R  H  E+P++CDIC K+F +     RH K H  +Q++    A
Sbjct:   20 CDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRT-HTGEKPYSCDICGKKFARCDERTRHTKIHKKSQRSGSRQA 104          

HSP 2 Score: 55.4546 bits (132), Expect = 2.014e-9
Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQK 1077
            + CR C + F RS +LT HVRTHTGE+PY C  C + F+      RH + IH+K
Sbjct:   43 FQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTK-IHKK 95          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Fly
Match: CG10348 (gene:FBgn0032707 transcript:FBtr0343112)

HSP 1 Score: 147.517 bits (371), Expect = 3.784e-39
Identity = 66/94 (70.21%), Postives = 77/94 (81.91%), Query Frame = 1
Query:  874 TPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            TPN P      +DRY C+FCGK+FPRSANLTRH+RTHTGEQPYKC +C R FSISSNLQRH+RNIH KERPF C+IC + FGQ+ NL+RH+K H
Sbjct:  300 TPNLPQR---NKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Fly
Match: CG10348 (gene:FBgn0032707 transcript:FBtr0301647)

HSP 1 Score: 147.517 bits (371), Expect = 3.784e-39
Identity = 66/94 (70.21%), Postives = 77/94 (81.91%), Query Frame = 1
Query:  874 TPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            TPN P      +DRY C+FCGK+FPRSANLTRH+RTHTGEQPYKC +C R FSISSNLQRH+RNIH KERPF C+IC + FGQ+ NL+RH+K H
Sbjct:  300 TPNLPQR---NKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Fly
Match: ham (gene:FBgn0045852 transcript:FBtr0332016)

HSP 1 Score: 146.747 bits (369), Expect = 2.206e-38
Identity = 61/86 (70.93%), Postives = 73/86 (84.88%), Query Frame = 1
Query:  898 IVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +  +DRY C+FCGK+FPRSANLTRH+RTHTGEQPY C +C R FSISSNLQRH+RNIH KERPF C++C + FGQ+ NL+RHVK H
Sbjct:  454 LKTKDRYSCKFCGKVFPRSANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHVKKH 539          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Fly
Match: ham (gene:FBgn0045852 transcript:FBtr0332017)

HSP 1 Score: 144.05 bits (362), Expect = 4.030e-37
Identity = 61/83 (73.49%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  907 RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +DRY C+FCGK+FPRSANLTRH+RTHTGEQPY C +C R FSISSNLQRH+RNIH KERPF C++C + FGQ+ NL+RHVK H
Sbjct:  770 KDRYSCKFCGKVFPRSANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHVKKH 852          

HSP 2 Score: 74.7146 bits (182), Expect = 4.232e-14
Identity = 30/49 (61.22%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSH 375
            C +C K F + +GLKQH+H HS+ KP+ C +C KAYTQFSNLCRHK+ H
Sbjct:  267 CPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNLCRHKRMH 315          

HSP 3 Score: 62.7734 bits (151), Expect = 3.085e-10
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +Y C  C K+F   +NL RH+R  H G + + C  C + F  SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  235 KYSCENCSKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQH-QHIHSSVKPFACEVCSKAYTQFSNLCRHKRMH 315          

HSP 4 Score: 49.2914 bits (116), Expect = 4.875e-6
Identity = 29/81 (35.80%), Postives = 40/81 (49.38%), Query Frame = 1
Query:  904 KRDRYHCRFCGKLFPRSANLTRH-VRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            K+D + C+ C   F     L +H   +H   + Y C  C++ F   SNLQRHIR  H   R   C  C K FG  + L++H
Sbjct:  203 KQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCSKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQH 283          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Fly
Match: ham (gene:FBgn0045852 transcript:FBtr0305621)

HSP 1 Score: 144.05 bits (362), Expect = 4.093e-37
Identity = 61/83 (73.49%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  907 RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +DRY C+FCGK+FPRSANLTRH+RTHTGEQPY C +C R FSISSNLQRH+RNIH KERPF C++C + FGQ+ NL+RHVK H
Sbjct:  814 KDRYSCKFCGKVFPRSANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHVKKH 896          

HSP 2 Score: 74.7146 bits (182), Expect = 4.378e-14
Identity = 30/49 (61.22%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSH 375
            C +C K F + +GLKQH+H HS+ KP+ C +C KAYTQFSNLCRHK+ H
Sbjct:  311 CPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNLCRHKRMH 359          

HSP 3 Score: 62.7734 bits (151), Expect = 3.072e-10
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +Y C  C K+F   +NL RH+R  H G + + C  C + F  SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  279 KYSCENCSKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQH-QHIHSSVKPFACEVCSKAYTQFSNLCRHKRMH 359          

HSP 4 Score: 49.6766 bits (117), Expect = 4.839e-6
Identity = 29/81 (35.80%), Postives = 40/81 (49.38%), Query Frame = 1
Query:  904 KRDRYHCRFCGKLFPRSANLTRH-VRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            K+D + C+ C   F     L +H   +H   + Y C  C++ F   SNLQRHIR  H   R   C  C K FG  + L++H
Sbjct:  247 KQDEFPCKQCALRFCHRPLLIKHEAISHNNIRKYSCENCSKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQH 327          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Zebrafish
Match: si:ch211-263k4.2 (si:ch211-263k4.2 [Source:ZFIN;Acc:ZDB-GENE-081104-207])

HSP 1 Score: 141.354 bits (355), Expect = 5.137e-36
Identity = 62/97 (63.92%), Postives = 79/97 (81.44%), Query Frame = 1
Query:  868 SETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            S  P+  D+ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  573 SPPPSLSDAILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 669          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Zebrafish
Match: si:ch211-263k4.2 (si:ch211-263k4.2 [Source:ZFIN;Acc:ZDB-GENE-081104-207])

HSP 1 Score: 139.813 bits (351), Expect = 1.333e-35
Identity = 62/97 (63.92%), Postives = 79/97 (81.44%), Query Frame = 1
Query:  868 SETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            S  P+  D+ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  694 SPPPSLSDAILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 790          

HSP 2 Score: 74.7146 bits (182), Expect = 5.936e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++  TC +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:   93 GARAHTCPECGKTFATSSGLKQHKHIHSSVKPFSCEVCHKSYTQFSNLCRHKRMHAD 149          

HSP 3 Score: 67.3958 bits (163), Expect = 1.204e-11
Identity = 32/82 (39.02%), Postives = 52/82 (63.41%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF+C++C K + Q +NL RH + H
Sbjct:   67 RFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH-KHIHSSVKPFSCEVCHKSYTQFSNLCRHKRMH 147          

HSP 4 Score: 61.2326 bits (147), Expect = 1.119e-9
Identity = 31/83 (37.35%), Postives = 48/83 (57.83%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            + C+ C K+FP   +L +H+  HT E+ YKC  C + F+  SNL RH  + H   + F C+ C K F   +NL+RH+++  V 
Sbjct:   12 HECKDCEKIFPSEYSLGQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMS-HDSGKRFECENCDKVFTDPSNLQRHIRSQHVG 93          

HSP 5 Score: 58.151 bits (139), Expect = 1.164e-8
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + ++C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:   40 YKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH 115          

HSP 6 Score: 54.299 bits (129), Expect = 1.781e-7
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            C DC+KIF SE  L QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:   14 CKDCEKIFPSEYSLGQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 63          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Zebrafish
Match: znf1018 (zinc finger protein 1018 [Source:ZFIN;Acc:ZDB-GENE-110913-173])

HSP 1 Score: 96.6709 bits (239), Expect = 3.099e-21
Identity = 86/325 (26.46%), Postives = 143/325 (44.00%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTMY-HNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDDN--NCKTSINHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMI------SPLNVYT-----RQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            FTCT C K F   + L +H  TH+  KP+ CT C K++ + S+L +H +       +++  + +      +  +Q +++Y H   H     ++ T   G S+ +    +L +++   +    C      F+ S S  +     RI   + P            +   NK +       P+         RQTSS +  +      +    +   I   NC    K +    T   P         + C  CG+ F RS+NL  H+R HTGE+P+ C+ C + F+ SSNL +HIR IH  E+P  C +C K F Q ++L +H++ H
Sbjct:  201 FTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIR-------IHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQC-GKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLYKH---MRIHTGEKPFTCTQCGKSFHQASSLNKHMRIHTEEKPITCTQCGKSFRQTSSLNKHMRIHTGEKPFTCTQCGIS-FNCSSYLKQHMRIHTGEKP---------FTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIR-IHTGEKPITCTLCGKSFRQSSSLSKHMRTH 503          

HSP 2 Score: 93.2041 bits (230), Expect = 4.917e-20
Identity = 78/319 (24.45%), Postives = 137/319 (42.95%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTMY-HNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDDNNCKTSINHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYT-------RQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
             TCT C K F   + L +H   H+  KP+ CT C K+++Q SN   H +       +++  + +      +   Q +++Y H   H     ++ T   G S+ +   L+  +++  ++      I       SF++   L++                      ++ +   + ++T        Q     N   NL     +++         C Q  KS+  S   +             C  CGK F +S++L++H+RTHTGE+P+ C+ C + FS SSN   H+R IH  E+PF C  C K F Q ++L +H++ H
Sbjct:  257 ITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMR-------IHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQC-GKSFHQASSLNKHMRIHTEEK----PITCTQCGKSFRQTSSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMRIHTGE---KPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMR-IHTGEKPFTCTQCGKSFRQASSLNKHMRIH 559          

HSP 3 Score: 78.5666 bits (192), Expect = 2.848e-15
Identity = 38/80 (47.50%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + C  CGK F RS+NL  H+R HTGE+P+ C+ C + F+ SSNL +HIR IH  E+P  C +C K F Q ++L +H++ H
Sbjct:   89 FTCTQCGKSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIR-IHTGEKPITCTLCGKSFRQSSSLSKHMRIH 167          

HSP 4 Score: 78.5666 bits (192), Expect = 3.033e-15
Identity = 41/108 (37.96%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  832 LNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
              C Q  KS+  S   +             C  CGK F +S++L++H+R HTGE+P+ C+ C + FS SSN   H+R IH  E+PF C  C K F Q ++L +H++ H
Sbjct:  117 FTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMR-IHTGEKPFTCTQCGKSFRQASSLNKHMRTH 223          

HSP 5 Score: 75.8702 bits (185), Expect = 2.435e-14
Identity = 41/108 (37.96%), Postives = 62/108 (57.41%), Query Frame = 1
Query:  832 LNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
              C Q  KS+  S   N           + C  CGK F ++++L +H+RTHTGE+P+ C+ C + F+ SS+L +HIR IH  E+P  C  C K F Q ++L +H++ H
Sbjct:  173 FTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIR-IHTGEKPITCTQCGKSFRQSSSLYKHMRIH 279          

HSP 6 Score: 73.559 bits (179), Expect = 1.096e-13
Identity = 40/108 (37.04%), Postives = 61/108 (56.48%), Query Frame = 1
Query:  832 LNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
              C Q  KS+  S   N           + C  CGK F ++++L +H+R HTGE+P+ C+ C + F+ SS+L +HIR IH  E+P  C  C K F Q ++L +H++ H
Sbjct:  509 FTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKSFNRSSHLNQHIR-IHTGEKPITCTQCGKSFRQSSSLYKHMRIH 615          

HSP 7 Score: 73.559 bits (179), Expect = 1.334e-13
Identity = 73/293 (24.91%), Postives = 113/293 (38.57%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE-ETNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDDNNCKTSINHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCD 1098
             TCT C K F   + L +H   H+  KP+ CT C  ++   S L +H + H  E  F  +              +  N  +H   H     ++ T   G S++    LD  +++   +      I       SF++   LS+                            P        S   +S  NL +       P       C Q  KS++ + + N           + C  CGK F RS++L +H+R HTGE+P  C+ C + F  SS+L +H+R IH  E+PF C 
Sbjct:  369 ITCTQCGKSFRQTSSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQC-------GRSFNRSSNLDHHMRIHTGEKPFTCTQC-GKSFNRSSNLDQHIRIHTGEK----PITCTLCGKSFRQSSSLSKHMRTHTGEK-------------------PFTCTQCGKSFSQSSNFNLHMRIHTGEKP-----FTCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMR-IHTGEKPFTCS 624          

HSP 8 Score: 68.5514 bits (166), Expect = 5.543e-12
Identity = 38/89 (42.70%), Postives = 58/89 (65.17%), Query Frame = 1
Query:  889 DSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            DS + +RD+ +C  C   F  S+ L +H+R HTGE+P+ C+ C + F+ SSNL  H+R IH  E+PF C  C K F + +NL++H++ H
Sbjct:   54 DSILKRRDK-NCFTCTH-FNCSSYLKQHMRIHTGEKPFTCTQCGKSFNRSSNLDHHMR-IHTGEKPFTCTQCGKSFNRSSNLDQHIRIH 139          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Zebrafish
Match: znf979 (zinc finger protein 979 [Source:ZFIN;Acc:ZDB-GENE-110913-140])

HSP 1 Score: 95.9005 bits (237), Expect = 4.786e-21
Identity = 89/323 (27.55%), Postives = 134/323 (41.49%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE-ETNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDDN--NCKTSINHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYTRQ--------TSSYHNSIH-NLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            FTCT C K FN  + L QH   H+  K + CT C K+++  +NL +H + H  E  F  +              +  N  +H   H     ++  S  G S+ +   L+L +++   +    C           SF +  IL+              L        +  +   + ++T +          S+ NS + NL +       P       C Q  KS+  S   N           + C  CGK F +S  L  H+R HTGE+P+ CS C + FS SS+L  H+R IH  E+PF C  C K F Q +NL  H++NH
Sbjct:   94 FTCTQCGKNFNQSSNLNQHMRIHTGEKLFTCTQCGKSFSNSANLNQHMRIHTGEKPFTCTQC-------GKSFSQSSNLNHHMRIHTGEKPFT-CSQCGKSFSQSSSLNLHMRIHTGEKPFTCTQC------GKSFSQSSILNIHMRNHTGEKPFTCLQCGKSFSQSTYLNQHMRIHTGENLFTCTQCGKSFSNSANLNLHMRIHTGEKP-----FTCTQCGKSFSQSSNLNIHMRIHTGEKPFTCSQCGKSFSQSPYLNHHMRIHTGEKPFTCSQCGKSFSQSSSLNLHMR-IHTGEKPFTCTQCGKSFSQSSNLNIHMRNH 396          

HSP 2 Score: 80.8777 bits (198), Expect = 4.387e-16
Identity = 79/322 (24.53%), Postives = 126/322 (39.13%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDD-----NNCKTS------INHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            FTCT C K F+  + L  H   H+  KP+ C  C K+++Q + L +H + H   N            ++A      N   H   H     ++ T   G S+ +   L++ +++   +     + C  S      +NH    ++ ++P   S+                           S LN++ R        IH            P      C Q  KS+  S   N           + C  CGK F RS++L RH+  HTGE+ + C  C   F  ++ L+RH R +H  E+P+ C  C KRF +   L+ H + H
Sbjct:  206 FTCTQCGKSFSQSSILNIHMRNHTGEKPFTCLQCGKSFSQSTYLNQHMRIHTGENLFTCTQCGKSFSNSA------NLNLHMRIHTGEKPFTCTQC-GKSFSQSSNLNIHMRIHTGEKPFTCSQCGKSFSQSPYLNHHMRIHTGEKPFTCSQCGKSFSQS-------------------SSLNLHMR--------IHT--------GEKP----FTCTQCGKSFSQSSNLNIHMRNHTGEKPFTCLQCGKSFSRSSSLNRHMMIHTGEKEFMCLKCENTFITAAELKRHQR-VHTGEKPYKCSQCSKRFARSGTLKTHERIH 480          

HSP 3 Score: 61.2326 bits (147), Expect = 9.056e-10
Identity = 34/91 (37.36%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  889 DSFIVKRDR--YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            D  +  RD+  + C  CGK     + L  H+R H  E+ + C+ C + F+ SSNL +H+R IH  E+ F C  C K F   ANL +H++ H
Sbjct:   55 DDILKMRDKRCFTCNQCGKSLANKSKLKIHMRIHNREKLFTCTQCGKNFNQSSNLNQHMR-IHTGEKLFTCTQCGKSFSNSANLNQHMRIH 144          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Zebrafish
Match: znf1021 (zinc finger protein 1021 [Source:ZFIN;Acc:ZDB-GENE-110913-143])

HSP 1 Score: 94.7449 bits (234), Expect = 1.521e-20
Identity = 82/312 (26.28%), Postives = 132/312 (42.31%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTMY-HNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDDNNCKTSINHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            FTCT C K FN  + L QH   H+  KP  CT C K++ Q SN   H +       +++  + +      +   Q +++Y H   H     ++ T   G S+ +    +L +++   +      I       SF++   L +                           +      RQTSS +  +      +    +   I   NC    K +    T   P         + C  CG+ F RS+NL  H+R HTGE+P+ C+ C + FS SS+L++HIR IH  E+P  C +C K F Q ++L +H++ H
Sbjct:  289 FTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSNFNLHMR-------IHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQC-GKSFSQSSNFNLHMRIHTGEK----PITCTQCGKSFRQSSSLYKHMRIHTGEKPFT--------------CTQCGKSFRQTSSLNKHLRIHTGEKPFTCTQCGIS-FNCSSYLKQHMRIHTGEKP---------FTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFSCSSHLKQHIR-IHTGEKPITCTLCGKSFRQSSSLSKHMRTH 563          

HSP 2 Score: 87.4261 bits (215), Expect = 3.670e-18
Identity = 78/323 (24.15%), Postives = 136/323 (42.11%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTM-YHNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDD-----NNC------KTSINHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            FTCT C K FN  + L  H   H+  KP+ CT C K++ + SNL +H +       +++  + +      +  +Q +++  H   H     ++ T   G S+ +    +L +++   +       C       +S+N    +++ ++P   ++                            P+       S   +S  NL +       P     + C Q  KS+  S +             + C  CGK F +S+N   H+R HTGE+P  C+ C + F  SS+L +H+R IH  E+PF C  C K F Q ++L +H++ H
Sbjct:  149 FTCTQCGKSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIR-------IHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQ-CGKSFSQSSNFNLHMRIPTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGE------KPITCTQCGKSFRQSSNFNLHMRIHTGEKP-----ITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFRQSSSLYKHMR-IHTGEKPFTCTQCGKSFRQTSSLNKHLRIH 451          

HSP 3 Score: 75.485 bits (184), Expect = 3.060e-14
Identity = 36/78 (46.15%), Postives = 55/78 (70.51%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            C  CGK F +S++L++H+RTHTGE+P+ C+ C + F+ SS+L +HIR IH  E+P  C  C K F Q ++L +H++ H
Sbjct:  543 CTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIR-IHTGEKPITCTQCGKSFRQSSSLYKHMRIH 619          

HSP 4 Score: 74.7146 bits (182), Expect = 5.284e-14
Identity = 40/106 (37.74%), Postives = 61/106 (57.55%), Query Frame = 1
Query:  838 CEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            C Q  KS++ + + N           + C  CG  F  S+ L +H+R HTGE+P+ C+ C + F+ SSNL  H+R IH  E+PF C  C K F + +NL++H++ H
Sbjct:   95 CTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGKSFNRSSNLDHHMR-IHTGEKPFTCTQCGKSFNRSSNLDQHIRIH 199          

HSP 5 Score: 71.633 bits (174), Expect = 4.514e-13
Identity = 34/80 (42.50%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + C  CGK F ++++L +H+R HTGE+P+ C+ C   F+ SS L++H+R IH  E+PF C  C K F + +NL+ H++ H
Sbjct:   93 FMCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMR-IHTGEKPFTCTQCGKSFNRSSNLDHHMRIH 171          

HSP 6 Score: 63.5438 bits (153), Expect = 2.091e-10
Identity = 32/91 (35.16%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  889 DSFIVKRDR--YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            D  + +RD+  + C  CGK+    + L  H+  HTGE+P+ C+ C + F  +S+L +H+R IH  E+PF C  C   F   + L++H++ H
Sbjct:   54 DGILKRRDKNCFTCTQCGKILASKSKLKIHMIIHTGEKPFMCTQCGKSFRQASSLNKHMR-IHTGEKPFTCTQCGISFNCSSYLKQHMRIH 143          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Xenopus
Match: ENSXETT00000031589.1 (MDS1 and EVI1 complex locus protein EVI1-A-like [Source:NCBI gene;Acc:101731113])

HSP 1 Score: 142.124 bits (357), Expect = 1.949e-37
Identity = 64/102 (62.75%), Postives = 83/102 (81.37%), Query Frame = 1
Query:  886 PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSSA 1188
            P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++A
Sbjct:  121 PENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNLSGTAA 221          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Xenopus
Match: PRDM16 (PR domain 16 [Source:NCBI gene;Acc:100485690])

HSP 1 Score: 139.813 bits (351), Expect = 2.189e-35
Identity = 61/90 (67.78%), Postives = 76/90 (84.44%), Query Frame = 1
Query:  889 DSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            DS + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  833 DSILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 922          

HSP 2 Score: 76.2554 bits (186), Expect = 3.479e-14
Identity = 31/57 (54.39%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C DC K F + +GLKQH+H HST KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  256 GARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHAD 312          

HSP 3 Score: 66.2402 bits (160), Expect = 5.537e-11
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  230 RFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQH-KHIHSTVKPFICEVCHKSYTQFSNLCRHKRMH 310          

HSP 4 Score: 59.3066 bits (142), Expect = 7.134e-9
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            + C+ C + FP   +L +H+  HT E+ YKC  C + F+  SNL RH +  H   + F C+ C K F   +NL+RH+++  V 
Sbjct:  175 HECKDCERPFPNKYSLEQHMIIHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKRFECENCVKVFTDPSNLQRHIRSQHVG 256          

HSP 5 Score: 58.9214 bits (141), Expect = 1.154e-8
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + ++C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  203 YKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQH 278          

HSP 6 Score: 50.447 bits (119), Expect = 5.286e-6
Identity = 23/57 (40.35%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  208 DSSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            D+ Q   C DC++ F ++  L+QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  170 DNEQMHECKDCERPFPNKYSLEQHMIIHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 226          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Xenopus
Match: PRDM16 (PR domain 16 [Source:NCBI gene;Acc:100485690])

HSP 1 Score: 139.428 bits (350), Expect = 2.856e-35
Identity = 61/90 (67.78%), Postives = 76/90 (84.44%), Query Frame = 1
Query:  889 DSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            DS + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  806 DSILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 895          

HSP 2 Score: 75.8702 bits (185), Expect = 3.916e-14
Identity = 31/57 (54.39%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C DC K F + +GLKQH+H HST KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  230 GARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHAD 286          

HSP 3 Score: 65.855 bits (159), Expect = 6.303e-11
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  204 RFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQH-KHIHSTVKPFICEVCHKSYTQFSNLCRHKRMH 284          

HSP 4 Score: 58.9214 bits (141), Expect = 8.883e-9
Identity = 30/85 (35.29%), Postives = 48/85 (56.47%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQ 1170
            + C+ C + FP   +L +H+  HT E+ YKC  C + F+  SNL RH +  H   + F C+ C K F   +NL+RH+++  V  +
Sbjct:  149 HECKDCERPFPNKYSLEQHMIIHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKRFECENCVKVFTDPSNLQRHIRSQHVGAR 232          

HSP 5 Score: 58.5362 bits (140), Expect = 1.283e-8
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + ++C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  177 YKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQH 252          

HSP 6 Score: 50.0618 bits (118), Expect = 6.320e-6
Identity = 23/57 (40.35%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  208 DSSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            D+ Q   C DC++ F ++  L+QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  144 DNEQMHECKDCERPFPNKYSLEQHMIIHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 200          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Xenopus
Match: PRDM16 (PR domain 16 [Source:NCBI gene;Acc:100485690])

HSP 1 Score: 139.428 bits (350), Expect = 3.112e-35
Identity = 61/90 (67.78%), Postives = 76/90 (84.44%), Query Frame = 1
Query:  889 DSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            DS + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  833 DSILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 922          

HSP 2 Score: 75.8702 bits (185), Expect = 3.528e-14
Identity = 31/57 (54.39%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C DC K F + +GLKQH+H HST KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  256 GARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHAD 312          

HSP 3 Score: 65.855 bits (159), Expect = 6.244e-11
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  230 RFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQH-KHIHSTVKPFICEVCHKSYTQFSNLCRHKRMH 310          

HSP 4 Score: 58.9214 bits (141), Expect = 9.010e-9
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            + C+ C + FP   +L +H+  HT E+ YKC  C + F+  SNL RH  + H   + F C+ C K F   +NL+RH+++  V 
Sbjct:  175 HECKDCERPFPNKYSLEQHMIIHTEEREYKCDQCPKAFNWKSNLIRHQMS-HDSGKRFECENCVKVFTDPSNLQRHIRSQHVG 256          

HSP 5 Score: 58.5362 bits (140), Expect = 1.383e-8
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + ++C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  203 YKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQH 278          

HSP 6 Score: 50.447 bits (119), Expect = 5.273e-6
Identity = 23/57 (40.35%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  208 DSSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            D+ Q   C DC++ F ++  L+QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  170 DNEQMHECKDCERPFPNKYSLEQHMIIHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 226          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Xenopus
Match: stk31 (serine/threonine kinase 31 [Source:Xenbase;Acc:XB-GENE-983236])

HSP 1 Score: 91.6633 bits (226), Expect = 3.169e-19
Identity = 83/324 (25.62%), Postives = 131/324 (40.43%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSH-EETNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDDN--NC---------KTSINHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYTRQTS-SYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            FTCT+C K F  +  LK H   H+  +PY C+ C K++   +NL  H K H  E  F  +   +  K  A +I    + + H   H     +S T   G  + ++  L   +KV   +    C         K S+    N ++  +P   S                                 + +Q   +YH  IH               ++L C +  K  +S     S          Y C  CGK F +  NL  H++ HTGE+P+ C+ C +CF+   +L+ H++ IH  E+PF C  C K F Q++++  H+K H
Sbjct:  226 FTCTECGKGFTQKCYLKSHMKKHTGERPYTCSECGKSFAHSNNLVTHMKIHTGEKPFTCT---ECGKGFAQKI----SLLSHMKMHTGEKPFSCTEC-GKGFTQKCYLKSHIKVHTGEKPLTCTECGKQFEHKESLLGHLNLHTGVKPFTCSECGKGFARRSSLVSHMKLHKVEKEFSCTECGKKFAQQGGLAYHLKIHT-------------GEKLFCTECGKGVRSKSHLASHMKKHTGERPYTCSECGKGFAQKNNLDTHMKIHTGEKPFTCTECGKCFTQKKHLESHMK-IHTGEKPFTCTECGKDFAQKSSILSHMKTH 527          

HSP 2 Score: 66.6254 bits (161), Expect = 3.482e-11
Identity = 35/108 (32.41%), Postives = 58/108 (53.70%), Query Frame = 1
Query:  832 LNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + C +  K+  S  + N+          + C  CG  F    NL  H++THTGE+P+ C+ C + F++  +L RH+R IH  E+P++C  C   F  +++L  H+K H
Sbjct:  644 VTCPECGKTLSSRRSLNTHLKIHTGVKPFTCTECGIGFAEKNNLVSHMKTHTGEKPFTCTECGKSFTLKDSLTRHLR-IHTGEKPYSCTECGANFRYKSSLLDHLKIH 750          

HSP 3 Score: 63.5438 bits (153), Expect = 3.735e-10
Identity = 32/87 (36.78%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNS 1176
            + C  CGK F +   L  H++ HTGE+P  C+ C + F    +L  H+ N+H   +PF C  C K F +R++L  H+K H V ++ S
Sbjct:  310 FSCTECGKGFTQKCYLKSHIKVHTGEKPLTCTECGKQFEHKESLLGHL-NLHTGVKPFTCSECGKGFARRSSLVSHMKLHKVEKEFS 395          

HSP 4 Score: 62.7734 bits (151), Expect = 5.406e-10
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 1
Query:  802 LNSSPPHIDQLN--CEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +N    H  + N  C +  K+  SS + ++          + C  CGK F +   L  H++ HTGE+P+ C+ C + F+    L+ H++  H  ERP+ C  C K F    NL  H+K H
Sbjct:  158 VNHQKTHTGERNVTCPECGKTLSSSGSLHTHLKIHTGEKPFTCTECGKGFTQKCYLKSHIKVHTGEKPFTCTECGKGFTQKCYLKSHMKK-HTGERPYTCSECGKSFAHSNNLVTHMKIH 276          

HSP 5 Score: 62.7734 bits (151), Expect = 6.560e-10
Identity = 33/84 (39.29%), Postives = 47/84 (55.95%), Query Frame = 1
Query:  904 KRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            K+  + C  CGK F + + L  H +THTGE+   C  C +  S S +L  H++ IH  E+PF C  C K F Q+  L+ H+K H
Sbjct:  138 KKKPFTCNECGKRFSQKSLLVNHQKTHTGERNVTCPECGKTLSSSGSLHTHLK-IHTGEKPFTCTECGKGFTQKCYLKSHIKVH 220          

HSP 6 Score: 58.9214 bits (141), Expect = 1.052e-8
Identity = 29/80 (36.25%), Postives = 47/80 (58.75%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + C  CGK F + +++  H++THTGE+P+ C+ C + F+  ++ Q H++  H  E+PF C  C K +  R  L  H K H
Sbjct:  505 FTCTECGKDFAQKSSILSHMKTHTGEKPFTCTECGKNFAHKNSFQSHLQT-HTGEKPFTCTECGKGYFSRIALLAHQKCH 583          

HSP 7 Score: 56.9954 bits (136), Expect = 3.810e-8
Identity = 30/85 (35.29%), Postives = 46/85 (54.12%), Query Frame = 1
Query:  901 VKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
             ++  + C  CGK +     L  H ++HT  +P+ C  C + F   +NL  H R +H K++PF C+ C KRF Q++ L  H K H
Sbjct:   81 TRKKPFECTKCGKGYVSRIALLTHQKSHTVGKPFTCKKCGKSFHRKANLLCHQR-VHSKKKPFTCNECGKRFSQKSLLVNHQKTH 164          

HSP 8 Score: 56.6102 bits (135), Expect = 5.266e-8
Identity = 30/80 (37.50%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  CG  F   ++L  H++ HTGE P+ C+ C + F   S+L  H  N+H  E+PF C  C + F +++ L  H K+H
Sbjct:  728 YSCTECGANFRYKSSLLDHLKIHTGEAPFICTECGKIFQQKSSLITHF-NMHTGEKPFTCTECGESFYKKSLLVAHQKSH 806          

HSP 9 Score: 52.7582 bits (125), Expect = 9.636e-7
Identity = 29/80 (36.25%), Postives = 41/80 (51.25%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + C+ CGK F +   L  H  THTGE+   C  C +  S   +L  H++ IH   +PF C  C   F ++ NL  H+K H
Sbjct:  616 FSCKECGKCFNQKRLLIGHQNTHTGERNVTCPECGKTLSSRRSLNTHLK-IHTGVKPFTCTECGIGFAEKNNLVSHMKTH 694          

HSP 10 Score: 50.0618 bits (118), Expect = 5.996e-6
Identity = 27/74 (36.49%), Postives = 37/74 (50.00%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            C  CGK      +L+ H + H    PY C+ C + + I  +L  H R IH  E+PF C  C K F Q   L++H
Sbjct:  840 CTECGKHLTSKRSLSAHQKIHIRGTPYTCTECGKSYLIERSLLIHQR-IHTGEKPFTCTECGKGFTQSVGLQKH 912          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Mouse
Match: Mecom (MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc:MGI:95457])

HSP 1 Score: 141.739 bits (356), Expect = 2.448e-36
Identity = 65/105 (61.90%), Postives = 85/105 (80.95%), Query Frame = 1
Query:  877 PNS-PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            PN+ P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  385 PNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 488          

HSP 2 Score: 60.8474 bits (146), Expect = 1.635e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH  + H   + + C+ C K F   +NL+RH+++  V 
Sbjct:   77 CKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMS-HDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 156          

HSP 3 Score: 60.077 bits (144), Expect = 3.027e-9
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  103 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 178          

HSP 4 Score: 48.9062 bits (115), Expect = 9.516e-6
Identity = 20/50 (40.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            C +CD++F     L++H  +H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:   77 CKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 126          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Mouse
Match: Mecom (MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc:MGI:95457])

HSP 1 Score: 142.124 bits (357), Expect = 2.903e-36
Identity = 74/155 (47.74%), Postives = 102/155 (65.81%), Query Frame = 1
Query:  727 SPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNS-PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            SP  ++  Q S+  N    L      ++  P   +L  +  P  +     PN+ P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  464 SPGFLFHPQMSAIENMAEKL---ESFSALKPEASEL-LQSVPSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 613          

HSP 2 Score: 60.8474 bits (146), Expect = 1.664e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:  202 CKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 281          

HSP 3 Score: 60.077 bits (144), Expect = 3.273e-9
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  228 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 303          

HSP 4 Score: 49.2914 bits (116), Expect = 8.298e-6
Identity = 20/50 (40.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            C +CD++F     L++H  +H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  202 CKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 251          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Mouse
Match: Mecom (MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc:MGI:95457])

HSP 1 Score: 141.739 bits (356), Expect = 2.933e-36
Identity = 74/155 (47.74%), Postives = 102/155 (65.81%), Query Frame = 1
Query:  727 SPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNS-PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            SP  ++  Q S+  N    L      ++  P   +L  +  P  +     PN+ P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  416 SPGFLFHPQMSAIENMAEKL---ESFSALKPEASEL-LQSVPSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 565          

HSP 2 Score: 60.8474 bits (146), Expect = 1.795e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:  154 CKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 233          

HSP 3 Score: 60.077 bits (144), Expect = 3.440e-9
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  180 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 255          

HSP 4 Score: 48.9062 bits (115), Expect = 9.227e-6
Identity = 20/50 (40.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            C +CD++F     L++H  +H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  154 CKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 203          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Mouse
Match: Mecom (MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc:MGI:95457])

HSP 1 Score: 140.584 bits (353), Expect = 3.093e-36
Identity = 74/155 (47.74%), Postives = 102/155 (65.81%), Query Frame = 1
Query:  727 SPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNS-PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            SP  ++  Q S+  N    L      ++  P   +L  +  P  +     PN+ P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  329 SPGFLFHPQMSAIENMAEKL---ESFSALKPEASEL-LQSVPSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 478          

HSP 2 Score: 60.077 bits (144), Expect = 2.767e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:   67 CKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 146          

HSP 3 Score: 59.3066 bits (142), Expect = 4.865e-9
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:   93 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 168          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Mouse
Match: Mecom (MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc:MGI:95457])

HSP 1 Score: 141.739 bits (356), Expect = 4.131e-36
Identity = 74/155 (47.74%), Postives = 102/155 (65.81%), Query Frame = 1
Query:  727 SPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNS-PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            SP  ++  Q S+  N    L      ++  P   +L  +  P  +     PN+ P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  663 SPGFLFHPQMSAIENMAEKL---ESFSALKPEASEL-LQSVPSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 812          

HSP 2 Score: 72.7886 bits (177), Expect = 2.799e-13
Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  156 GARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 212          

HSP 3 Score: 67.3958 bits (163), Expect = 1.638e-11
Identity = 32/81 (39.51%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  131 YECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 210          

HSP 4 Score: 60.8474 bits (146), Expect = 2.113e-9
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:   77 CKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 156          

HSP 5 Score: 60.077 bits (144), Expect = 3.334e-9
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  103 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 178          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. UniProt/SwissProt
Match: sp|Q8I7Z8|HAM_DROME (Transcription factor hamlet OS=Drosophila melanogaster OX=7227 GN=ham PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 4.102e-36
Identity = 61/83 (73.49%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  907 RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +DRY C+FCGK+FPRSANLTRH+RTHTGEQPY C +C R FSISSNLQRH+RNIH KERPF C++C + FGQ+ NL+RHVK H
Sbjct:  814 KDRYSCKFCGKVFPRSANLTRHLRTHTGEQPYPCKYCDRAFSISSNLQRHVRNIHNKERPFRCELCDRSFGQQTNLDRHVKKH 896          

HSP 2 Score: 74.7146 bits (182), Expect = 4.388e-13
Identity = 30/49 (61.22%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSH 375
            C +C K F + +GLKQH+H HS+ KP+ C +C KAYTQFSNLCRHK+ H
Sbjct:  311 CPECGKTFGTSSGLKQHQHIHSSVKPFACEVCSKAYTQFSNLCRHKRMH 359          

HSP 3 Score: 62.7734 bits (151), Expect = 3.079e-9
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +Y C  C K+F   +NL RH+R  H G + + C  C + F  SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  279 KYSCENCSKVFCDPSNLQRHIRAYHVGARCHPCPECGKTFGTSSGLKQH-QHIHSSVKPFACEVCSKAYTQFSNLCRHKRMH 359          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. UniProt/SwissProt
Match: sp|B7ZRM8|EVI1B_XENLA (MDS1 and EVI1 complex locus protein EVI1-B OS=Xenopus laevis OX=8355 GN=mecom-b PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 9.833e-36
Identity = 65/102 (63.73%), Postives = 83/102 (81.37%), Query Frame = 1
Query:  886 PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSSA 1188
            P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRHIRNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++A
Sbjct:  720 PENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNLSGTAA 820          

HSP 2 Score: 74.3294 bits (181), Expect = 6.803e-13
Identity = 29/57 (50.88%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C++C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  157 GARAHACSECGKTFATSSGLKQHKHIHSSVKPFVCEVCHKSYTQFSNLCRHKRMHAD 213          

HSP 3 Score: 64.3142 bits (155), Expect = 9.131e-10
Identity = 33/82 (40.24%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  916 YHCRFCGK-LFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K +F   +NL RH+R+ H G + + CS C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  131 YECENCSKQVFTDPSNLQRHIRSQHVGARAHACSECGKTFATSSGLKQH-KHIHSSVKPFVCEVCHKSYTQFSNLCRHKRMH 211          

HSP 4 Score: 57.3806 bits (137), Expect = 1.797e-7
Identity = 29/84 (34.52%), Postives = 50/84 (59.52%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKR-FGQRANLERHVKNHLVN 1164
            + C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K+ F   +NL+RH+++  V 
Sbjct:   75 HECKECDQVFPDMQSLEKHLLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDTGKHYECENCSKQVFTDPSNLQRHIRSQHVG 157          

HSP 5 Score: 55.8398 bits (133), Expect = 5.261e-7
Identity = 30/77 (38.96%), Postives = 41/77 (53.25%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTR-CFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C++  F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  103 YKCDQCPKAFNWKSNLIRHQMSHDTGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSECGKTFATSSGLKQH 179          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. UniProt/SwissProt
Match: sp|Q03112|MECOM_HUMAN (Histone-lysine N-methyltransferase MECOM OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=3)

HSP 1 Score: 142.895 bits (359), Expect = 1.035e-35
Identity = 77/161 (47.83%), Postives = 102/161 (63.35%), Query Frame = 1
Query:  727 SPLNVYTRQTSSYHNSIHNL-------PISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            SP  ++  Q S+  N    L       P + EL  S P +   N   PP +         P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  851 SPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSM--FNFRAPPNAL--------PENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 1000          

HSP 2 Score: 73.1738 bits (178), Expect = 1.828e-12
Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  344 GARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 400          

HSP 3 Score: 67.3958 bits (163), Expect = 1.086e-10
Identity = 32/81 (39.51%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  319 YECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 398          

HSP 4 Score: 60.4622 bits (145), Expect = 1.606e-8
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:  265 CKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 344          

HSP 5 Score: 60.077 bits (144), Expect = 2.182e-8
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  291 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 366          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. UniProt/SwissProt
Match: sp|B7ZRU9|EVI1A_XENLA (MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis OX=8355 GN=mecom-a PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.369e-35
Identity = 64/102 (62.75%), Postives = 83/102 (81.37%), Query Frame = 1
Query:  886 PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSSA 1188
            P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++A
Sbjct:  723 PENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNLSGTAA 823          

HSP 2 Score: 76.2554 bits (186), Expect = 1.788e-13
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C+DC K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  157 GARAHACSDCGKTFATSSGLKQHKHIHSSVKPFVCEVCHKSYTQFSNLCRHKRMHAD 213          

HSP 3 Score: 64.6994 bits (156), Expect = 8.826e-10
Identity = 33/82 (40.24%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  916 YHCRFCGK-LFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K +F   +NL RH+R+ H G + + CS C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  131 YECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLKQH-KHIHSSVKPFVCEVCHKSYTQFSNLCRHKRMH 211          

HSP 4 Score: 57.7658 bits (138), Expect = 1.302e-7
Identity = 29/84 (34.52%), Postives = 50/84 (59.52%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKR-FGQRANLERHVKNHLVN 1164
            + C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K+ F   +NL+RH+++  V 
Sbjct:   75 HECKECDQVFPDMQSLEKHLLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDTGKHYECENCSKQVFTDPSNLQRHIRSQHVG 157          

HSP 5 Score: 55.8398 bits (133), Expect = 4.423e-7
Identity = 30/77 (38.96%), Postives = 41/77 (53.25%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTR-CFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C++  F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  103 YKCDQCPKAFNWKSNLIRHQMSHDTGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLKQH 179          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. UniProt/SwissProt
Match: sp|P14404|MECOM_MOUSE (Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 2.414e-35
Identity = 74/155 (47.74%), Postives = 102/155 (65.81%), Query Frame = 1
Query:  727 SPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNS-PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSS 1185
            SP  ++  Q S+  N    L      ++  P   +L  +  P  +     PN+ P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H  N   SG++
Sbjct:  853 SPGFLFHPQMSAIENMAEKL---ESFSALKPEASEL-LQSVPSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH-ENGNMSGTA 1002          

HSP 2 Score: 72.7886 bits (177), Expect = 1.861e-12
Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  346 GARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 402          

HSP 3 Score: 67.3958 bits (163), Expect = 1.058e-10
Identity = 32/81 (39.51%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  321 YECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 400          

HSP 4 Score: 60.8474 bits (146), Expect = 1.302e-8
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP   +L +H+ +HT E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:  267 CKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVG 346          

HSP 5 Score: 60.077 bits (144), Expect = 2.164e-8
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  293 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQH 368          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. TrEMBL
Match: A0A3S5BAW7 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS32433 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.558e-47
Identity = 75/102 (73.53%), Postives = 88/102 (86.27%), Query Frame = 1
Query:  856 SYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLV 1161
            +   SE   S     ++R+RYHC+FCGK+FPRSANLTRH+RTHTGEQPY+C++C RCFSISSNLQRHIRNIHQKERPF+C +C KRFGQRANLERHV+NHLV
Sbjct:   71 AAADSEEAESDRESGLRRERYHCQFCGKMFPRSANLTRHIRTHTGEQPYRCAYCPRCFSISSNLQRHIRNIHQKERPFHCSVCMKRFGQRANLERHVRNHLV 172          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. TrEMBL
Match: A0A3P8K3Q5 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5575 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.465e-46
Identity = 74/96 (77.08%), Postives = 86/96 (89.58%), Query Frame = 1
Query:  901 VKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSSA 1188
            +KR+RYHC++CGKLFPRSANLTRH+RTHTGEQPYKC  C R FSISSNLQRHIRNIHQKERPF+C +C KRFGQRANLERH++NHL++    GS+A
Sbjct:   56 LKRERYHCQYCGKLFPRSANLTRHIRTHTGEQPYKCMHCPRSFSISSNLQRHIRNIHQKERPFHCSVCLKRFGQRANLERHIRNHLISMNVCGSTA 151          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. TrEMBL
Match: A0A183AF40 (Uncharacterized protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.719e-46
Identity = 74/96 (77.08%), Postives = 86/96 (89.58%), Query Frame = 1
Query:  901 VKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSSA 1188
            +KR+RYHC++CGKLFPRSANLTRH+RTHTGEQPYKC  C R FSISSNLQRHIRNIHQKERPF+C +C KRFGQRANLERH++NHL++    GS+A
Sbjct:   56 LKRERYHCQYCGKLFPRSANLTRHIRTHTGEQPYKCMHCPRSFSISSNLQRHIRNIHQKERPFHCSVCLKRFGQRANLERHIRNHLISMNVCGSTA 151          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. TrEMBL
Match: A0A1S8X724 (Zinc finger, C2H2 type OS=Opisthorchis viverrini OX=6198 GN=X801_01618 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 3.939e-46
Identity = 75/96 (78.12%), Postives = 87/96 (90.62%), Query Frame = 1
Query:  895 FIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGS 1182
             I+KRDRYHC++CGKLFPRSANLTRH+RTHTGEQPYKC  C R FSISSNLQRHIRNIHQKERPF+C +CFKRFGQRANLERH++NHL++  +S +
Sbjct:  285 MILKRDRYHCQYCGKLFPRSANLTRHIRTHTGEQPYKCVHCPRSFSISSNLQRHIRNIHQKERPFHCLVCFKRFGQRANLERHIRNHLISMDSSTT 380          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. TrEMBL
Match: A0A075ACS5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00456 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 4.151e-46
Identity = 75/96 (78.12%), Postives = 87/96 (90.62%), Query Frame = 1
Query:  895 FIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGS 1182
             I+KRDRYHC++CGKLFPRSANLTRH+RTHTGEQPYKC  C R FSISSNLQRHIRNIHQKERPF+C +CFKRFGQRANLERH++NHL++  +S +
Sbjct:  285 MILKRDRYHCQYCGKLFPRSANLTRHIRTHTGEQPYKCVHCPRSFSISSNLQRHIRNIHQKERPFHCLVCFKRFGQRANLERHIRNHLISMDSSTT 380          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Cavefish
Match: si:ch211-263k4.2 (PR/SET domain 16 [Source:NCBI gene;Acc:103028334])

HSP 1 Score: 141.354 bits (355), Expect = 4.213e-36
Identity = 62/97 (63.92%), Postives = 79/97 (81.44%), Query Frame = 1
Query:  868 SETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            S  P+  D+ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  967 SPPPSLSDAILRKGKERYACRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 1063          

HSP 2 Score: 75.485 bits (184), Expect = 3.446e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++  TC +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  361 GARAHTCPECGKTFATSSGLKQHKHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMHAD 417          

HSP 3 Score: 67.781 bits (164), Expect = 1.072e-11
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  335 RFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH-KHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMH 415          

HSP 4 Score: 65.4698 bits (158), Expect = 5.386e-11
Identity = 32/83 (38.55%), Postives = 49/83 (59.04%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            Y C+ C K+FP   +L++H+  HT E+ YKC  C + F+  SNL RH  + H   + F C+ C K F   +NL+RH+++  V 
Sbjct:  280 YECKDCEKIFPSEYSLSQHMVVHTEEREYKCDQCPKAFNWKSNLIRHQMS-HDSGKRFECENCDKVFTDPSNLQRHIRSQHVG 361          

HSP 5 Score: 58.9214 bits (141), Expect = 6.265e-9
Identity = 29/77 (37.66%), Postives = 40/77 (51.95%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
             Y C  C K F   +NL RH  +H   + ++C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  307 EYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH 383          

HSP 6 Score: 56.225 bits (134), Expect = 4.549e-8
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            + C DC+KIF SE  L QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  280 YECKDCEKIFPSEYSLSQHMVVHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 331          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Cavefish
Match: si:ch211-263k4.2 (PR/SET domain 16 [Source:NCBI gene;Acc:103028334])

HSP 1 Score: 141.354 bits (355), Expect = 4.775e-36
Identity = 62/97 (63.92%), Postives = 79/97 (81.44%), Query Frame = 1
Query:  868 SETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            S  P+  D+ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  942 SPPPSLSDAILRKGKERYACRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 1038          

HSP 2 Score: 75.0998 bits (183), Expect = 3.836e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++  TC +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  364 GARAHTCPECGKTFATSSGLKQHKHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMHAD 420          

HSP 3 Score: 67.781 bits (164), Expect = 1.038e-11
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  338 RFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH-KHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMH 418          

HSP 4 Score: 65.4698 bits (158), Expect = 5.171e-11
Identity = 32/85 (37.65%), Postives = 50/85 (58.82%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQ 1170
            Y C+ C K+FP   +L++H+  HT E+ YKC  C + F+  SNL RH  + H   + F C+ C K F   +NL+RH+++  V  +
Sbjct:  283 YECKDCEKIFPSEYSLSQHMVVHTEEREYKCDQCPKAFNWKSNLIRHQMS-HDSGKRFECENCDKVFTDPSNLQRHIRSQHVGAR 366          

HSP 5 Score: 58.9214 bits (141), Expect = 6.191e-9
Identity = 29/77 (37.66%), Postives = 40/77 (51.95%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
             Y C  C K F   +NL RH  +H   + ++C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  310 EYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH 386          

HSP 6 Score: 55.8398 bits (133), Expect = 5.040e-8
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            + C DC+KIF SE  L QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  283 YECKDCEKIFPSEYSLSQHMVVHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 334          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Cavefish
Match: mecom (MDS1 and EVI1 complex locus [Source:ZFIN;Acc:ZDB-GENE-050208-123])

HSP 1 Score: 141.354 bits (355), Expect = 4.794e-36
Identity = 61/91 (67.03%), Postives = 77/91 (84.62%), Query Frame = 1
Query:  886 PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRHIRNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  719 PETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH 809          

HSP 2 Score: 74.3294 bits (181), Expect = 7.136e-14
Identity = 30/57 (52.63%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C DC K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  162 GARAHACPDCGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 218          

HSP 3 Score: 66.2402 bits (160), Expect = 2.791e-11
Identity = 32/81 (39.51%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  137 YECENCSKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 216          

HSP 4 Score: 60.077 bits (144), Expect = 2.681e-9
Identity = 30/76 (39.47%), Postives = 41/76 (53.95%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C++ F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  109 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCSKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQH 184          

HSP 5 Score: 56.9954 bits (136), Expect = 2.751e-8
Identity = 28/81 (34.57%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C+ C ++FP + +L  H  +H+ E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:   83 CKECEQVFPDTQSLEAHSLSHSEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCSKVFTDPSNLQRHIRSQHVG 162          

HSP 6 Score: 52.373 bits (124), Expect = 7.307e-7
Identity = 29/89 (32.58%), Postives = 49/89 (55.06%), Query Frame = 1
Query:  217 QGFTCTDCDKIFNSEAGLKQH-RHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHN 480
            Q + C  CD+ F+  + L++H R+ H+  KP++C +C + + Q +NL RH K HE    + SP  +L  D ++ I+  +   Y N   N
Sbjct:  756 QPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGTAMSSPQSEL--DSSSAILDDKEDSYFNEIRN 842          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Cavefish
Match: si:ch211-263k4.2 (PR/SET domain 16 [Source:NCBI gene;Acc:103028334])

HSP 1 Score: 141.354 bits (355), Expect = 4.988e-36
Identity = 62/97 (63.92%), Postives = 79/97 (81.44%), Query Frame = 1
Query:  868 SETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            S  P+  D+ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  959 SPPPSLSDAILRKGKERYACRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 1055          

HSP 2 Score: 75.0998 bits (183), Expect = 3.752e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++  TC +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  353 GARAHTCPECGKTFATSSGLKQHKHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMHAD 409          

HSP 3 Score: 67.781 bits (164), Expect = 1.080e-11
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  327 RFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH-KHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMH 407          

HSP 4 Score: 65.4698 bits (158), Expect = 5.284e-11
Identity = 32/83 (38.55%), Postives = 49/83 (59.04%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            Y C+ C K+FP   +L++H+  HT E+ YKC  C + F+  SNL RH +  H   + F C+ C K F   +NL+RH+++  V 
Sbjct:  272 YECKDCEKIFPSEYSLSQHMVVHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKRFECENCDKVFTDPSNLQRHIRSQHVG 353          

HSP 5 Score: 58.9214 bits (141), Expect = 6.323e-9
Identity = 29/77 (37.66%), Postives = 40/77 (51.95%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
             Y C  C K F   +NL RH  +H   + ++C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  299 EYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH 375          

HSP 6 Score: 56.225 bits (134), Expect = 4.800e-8
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            + C DC+KIF SE  L QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  272 YECKDCEKIFPSEYSLSQHMVVHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 323          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Cavefish
Match: si:ch211-263k4.2 (PR/SET domain 16 [Source:NCBI gene;Acc:103028334])

HSP 1 Score: 141.354 bits (355), Expect = 5.095e-36
Identity = 62/97 (63.92%), Postives = 79/97 (81.44%), Query Frame = 1
Query:  868 SETPNSPDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            S  P+  D+ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  967 SPPPSLSDAILRKGKERYACRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 1063          

HSP 2 Score: 75.485 bits (184), Expect = 3.726e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++  TC +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  361 GARAHTCPECGKTFATSSGLKQHKHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMHAD 417          

HSP 3 Score: 67.3958 bits (163), Expect = 1.192e-11
Identity = 32/82 (39.02%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  335 RFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH-KHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMH 415          

HSP 4 Score: 65.0846 bits (157), Expect = 6.093e-11
Identity = 32/83 (38.55%), Postives = 49/83 (59.04%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            Y C+ C K+FP   +L++H+  HT E+ YKC  C + F+  SNL RH +  H   + F C+ C K F   +NL+RH+++  V 
Sbjct:  280 YECKDCEKIFPSEYSLSQHMVVHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKRFECENCDKVFTDPSNLQRHIRSQHVG 361          

HSP 5 Score: 58.5362 bits (140), Expect = 7.095e-9
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + ++C  C + F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  308 YKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH 383          

HSP 6 Score: 55.8398 bits (133), Expect = 5.109e-8
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            + C DC+KIF SE  L QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  280 YECKDCEKIFPSEYSLSQHMVVHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 331          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007831.1 (pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 gene:ENSPMAG00000007084.1 transcript:ENSPMAT00000007831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 5.887e-19
Identity = 37/76 (48.68%), Postives = 51/76 (67.11%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            + C  CGK F +S++L  H RTHTGE+P+KCS C + FS SSNL++H R  H  E+PF C +C K F + + L +H
Sbjct:   32 FRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRT-HTGEKPFKCTVCEKAFTESSPLRKH 106          

HSP 2 Score: 71.633 bits (174), Expect = 7.361e-16
Identity = 35/80 (43.75%), Postives = 51/80 (63.75%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + C  C K F +S+ LT H+RTHT  +P++C  C + F+ SS+LQ H R  H  E+PF C +C K F Q +NL++H + H
Sbjct:    6 FKCTVCEKAFAQSSYLTIHLRTHT--KPFRCPLCGKAFAKSSDLQSHQRT-HTGEKPFKCSVCEKAFSQSSNLKKHQRTH 82          

HSP 3 Score: 50.8322 bits (120), Expect = 1.668e-8
Identity = 24/67 (35.82%), Postives = 41/67 (61.19%), Query Frame = 1
Query:  166 FIKVAKVMSRNSFTDSSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHK 366
            F K + + S        + F C+ C+K F+  + LK+H+ TH+  KP++CT+C KA+T+ S L +H+
Sbjct:   41 FAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFTESSPLRKHQ 107          

HSP 4 Score: 50.0618 bits (118), Expect = 3.562e-8
Identity = 21/51 (41.18%), Postives = 35/51 (68.63%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSH 375
            F C  C K F   + L+ H+ TH+  KP++C++C KA++Q SNL +H+++H
Sbjct:   32 FRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTH 82          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005225.1 (pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1 gene:ENSPMAG00000004710.1 transcript:ENSPMAT00000005225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 7.252e-19
Identity = 87/356 (24.44%), Postives = 140/356 (39.33%), Query Frame = 1
Query:  217 QGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKK-------------------------SHEETNFLYSPSEDL--QKDHAAEIIKQENTMYHNNAHNSPPIWS--RTSIIGSSYDEEFPLDLSVKVIPDDNNCKTSINHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYTRQ-----TSSYHNS-IHNLPISRE--------LNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + + C  CD  F +   LK+H  THS  +P+ C  C K +    N  +H K                         SH++   + +P +     +  A   + Q+            P  S  + ++IG    ++      V+ +  +    +      N   F E   LS+    +  L   F +   F        +  L   +       T++YH+  +   PIS +        L  S  H  QL+ EQ    Y+S       D     R  Y C +C K F +S++L +HVR+HTGE+P+KC+ C R F  S  L+ H+R  H  E+ + CD+C   F    +L RH+  H
Sbjct:  689 KAYKCVMCDGTFTTNGSLKRHMSTHSETRPFMCPYCQKTFKTSVNCKKHMKTHRYELAQQLQQQSTLPTEHMEDMASHQQGMLVLTPEQSTVSSEQQAMLGLGQQQPSDQQALLGLAPQQSAQQQTLIGLEQTQQLAEQQLVQALSQEEFVTSQHGLQANMDQF-EQQTLSQQTYEQQALTQGFTITESFGQQGQFTAVQQLQASSTLESQPLTTTYHSQEMLTRPISPQIVICQILSLQESSQHEVQLSAEQ--SEYQS-------DGEESTRRSYRCGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMRT-HTGEKAYKCDLCDATFTTNGSLTRHMVMH 1033          

HSP 2 Score: 72.4034 bits (176), Expect = 7.985e-14
Identity = 32/80 (40.00%), Postives = 49/80 (61.25%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C +C K F +S++L +H+R+HTGE+PY+C  C+R F  S  L+ HIR  H   + + C +C   F    +L+RH+  H
Sbjct:  635 YRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIRT-HVGLKAYKCVMCDGTFTTNGSLKRHMSTH 713          

HSP 3 Score: 69.3218 bits (168), Expect = 6.068e-13
Identity = 34/86 (39.53%), Postives = 51/86 (59.30%), Query Frame = 1
Query:  901 VKRDRYH-CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            V   R+H C +C K F + ++L RH+R HT E+PYKC+ C R F++ S L  H R  H   + F C +C K F  + +L+ H++ H
Sbjct:  450 VNGVRWHMCPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAH-RKTHTGLKEFMCPLCDKLFSTQGSLKVHIRLH 534          

HSP 4 Score: 69.3218 bits (168), Expect = 6.571e-13
Identity = 32/78 (41.03%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVK 1149
            + C  C K F + + L RH+R HTGE+P+ C  C R F+    LQ H +  H  ERP+ C  C   F QR NL  H++
Sbjct:  163 HRCEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIH-KAKHTGERPYRCAFCPHTFSQRGNLRAHIQ 239          

HSP 5 Score: 68.5514 bits (166), Expect = 1.059e-12
Identity = 31/78 (39.74%), Postives = 46/78 (58.97%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVK 1149
            Y C  C K F + + L RH R HTGE+PY C  C + F+ ++ LQ H++  H  E+P+ C  C   F Q+ N++ H+K
Sbjct: 1691 YKCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKK-HTGEKPYKCQYCDMAFSQKGNMKIHIK 1767          

HSP 6 Score: 63.5438 bits (153), Expect = 4.390e-11
Identity = 38/96 (39.58%), Postives = 52/96 (54.17%), Query Frame = 1
Query:  895 FIVKRDRYH-CRFCGKLFPRSANLTRHVRTH------TGEQP--YKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
             +   DR H C  C K F R+ +L  H++TH      + ++P  YKC  C + F+  S LQRH R IH  ERP+ C +C K F Q   L+ H+K H
Sbjct: 1647 LVHGEDRLHTCPLCSKSFKRATHLKEHMQTHEPGSSASRQKPRLYKCDHCDKSFAKPSQLQRHNR-IHTGERPYICQVCDKAFNQTNALQIHMKKH 1741          

HSP 7 Score: 60.8474 bits (146), Expect = 3.384e-10
Identity = 29/83 (34.94%), Postives = 43/83 (51.81%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERP------FNCDICFKRFGQRANLERHV 1146
            + C  CG+ F +   L  H   HTGE+PY+C+FC   FS   NL+ HI+ +H   +P      F C+ C   F +  +L  H+
Sbjct:  191 FTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDAKPGGEQPVFQCEDCSCVFKKLGSLNAHI 273          

HSP 8 Score: 60.077 bits (144), Expect = 6.188e-10
Identity = 29/85 (34.12%), Postives = 46/85 (54.12%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQ 1170
            Y C  C + F   + LT H +THTG + + C  C + FS   +L+ HIR +H   +PF+C  C K+F    + + H+ +H  + Q
Sbjct:  484 YKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIR-LHTGAKPFDCPHCNKKFRTSGHRKSHIASHFKDAQ 567          

HSP 9 Score: 57.3806 bits (137), Expect = 4.570e-9
Identity = 29/86 (33.72%), Postives = 49/86 (56.98%), Query Frame = 1
Query:  910 DRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKE----RPFNCDICFKRFGQRANLERHVKNH 1155
            D+  C  CG+ F R A+L  H+  H  E+   C+ C   F++ S L+RH+ ++H++E    R F C IC + F + + L  H+++H
Sbjct:   56 DQTACPDCGRTFSRIASLKAHIMLHEKEENLMCTECGDEFTLQSQLERHM-DMHRQELSGARTFTCRICHQEFQRVSTLREHMRSH 140          

HSP 10 Score: 53.5286 bits (127), Expect = 6.670e-8
Identity = 33/97 (34.02%), Postives = 44/97 (45.36%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTH------TGEQPYK-----------CSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + CR C + F R + L  H+R+H         + YK           C  C + F   S L RHIR IH  ERPF C+ C + F Q+  L+ H   H
Sbjct:  118 FTCRICHQEFQRVSTLREHMRSHYKIRASLSTRSYKRNIDRSGFSHRCEHCMKTFQKPSQLIRHIR-IHTGERPFTCEECGRAFNQKGALQIHKAKH 213          

HSP 11 Score: 52.7582 bits (125), Expect = 1.163e-7
Identity = 22/52 (42.31%), Postives = 32/52 (61.54%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIH 1071
            Y C+ C K F ++  L  H++ HTGE+PYKC +C   FS   N++ HI+  H
Sbjct: 1719 YICQVCDKAFNQTNALQIHMKKHTGEKPYKCQYCDMAFSQKGNMKIHIKRAH 1770          

HSP 12 Score: 51.6026 bits (122), Expect = 2.746e-7
Identity = 27/76 (35.53%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  943 FPRS----ANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHL 1158
             PRS    + L  HV+THTG++ +KC  C   FS   +L+ H+R +H   +PF C  C +RF    + + H+++H 
Sbjct: 1179 LPRSITVKSTLDCHVKTHTGQKHFKCHICNSPFSTKGSLKVHMR-LHTGAKPFKCPHCEQRFRTSGHRKSHIQSHF 1253          

HSP 13 Score: 50.0618 bits (118), Expect = 8.403e-7
Identity = 20/56 (35.71%), Postives = 36/56 (64.29%), Query Frame = 1
Query:  991 EQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHL 1158
            ++PY+C +C + F  SS+L++HIR+ H  E+P+ C  C + F     L+ H++ H+
Sbjct:  632 DRPYRCGYCNKAFKKSSHLKQHIRS-HTGEKPYRCGQCSRSFVSSGVLKAHIRTHV 686          

HSP 14 Score: 49.6766 bits (117), Expect = 9.486e-7
Identity = 19/47 (40.43%), Postives = 28/47 (59.57%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRH 363
            FTC +C + FN +  L+ H+  H+  +PYRC  CP  ++Q  NL  H
Sbjct:  191 FTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAH 237          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006002.1 (pep scaffold:Pmarinus_7.0:GL479218:16696:34135:-1 gene:ENSPMAG00000005404.1 transcript:ENSPMAT00000006002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 1.970e-18
Identity = 41/90 (45.56%), Postives = 56/90 (62.22%), Query Frame = 1
Query:  907 RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNS 1176
            R +Y CR CG+ F RS  L  H+R HTGE+PY+C  C R FS SS L+ H R +H  E+P+ C +C + F Q ++  RH K H V+  +S
Sbjct:    2 RQQYECRQCGREFVRSDALKAHMRIHTGEKPYRCGACGRAFSQSSGLKTHQR-VHTGEKPYRCGVCGRVFAQSSHCNRHRKAHTVSHMHS 90          

HSP 2 Score: 75.485 bits (184), Expect = 7.350e-16
Identity = 35/80 (43.75%), Postives = 51/80 (63.75%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + C  C + F   +N  RH RTHTG++PY+C  C R FS  SN++RH R+ H+ E+PF CD+C + F +  NL+ H+  H
Sbjct:  145 FRCDVCSRAFAEYSNYRRHTRTHTGQRPYRCEACGRAFSKRSNMKRHQRS-HKGEKPFGCDVCAQGFTRLCNLKVHLLKH 223          

HSP 3 Score: 50.447 bits (119), Expect = 1.806e-7
Identity = 20/51 (39.22%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSH 375
            + C  C + F+  +GLK H+  H+  KPYRC +C + + Q S+  RH+K+H
Sbjct:   33 YRCGACGRAFSQSSGLKTHQRVHTGEKPYRCGVCGRVFAQSSHCNRHRKAH 83          

HSP 4 Score: 46.2098 bits (108), Expect = 4.387e-6
Identity = 32/109 (29.36%), Postives = 49/109 (44.95%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKC-------------------------SFCTRCFSISSNL---QRHIR-NIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  CG++F +S++  RH + HT    + C                          FC +C+  SS++   + H R NI   ERPF CD+C + F + +N  RH + H
Sbjct:   61 YRCGVCGRVFAQSSHCNRHRKAHTVSHMHSCRQCTRHTRWQHKVAACRAVHIAMFPGFCIQCYKGSSDVVEFRVHFRANI--CERPFRCDVCSRAFAEYSNYRRHTRTH 167          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007400.1 (pep scaffold:Pmarinus_7.0:GL476367:705224:706108:-1 gene:ENSPMAG00000006685.1 transcript:ENSPMAT00000007400.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 2.724e-17
Identity = 32/51 (62.75%), Postives = 41/51 (80.39%), Query Frame = 1
Query: 1003 KCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:    1 RCKYCDRSFSISSNLQRHVRNIHNKEKPFRCPLCSRCFGQQTNLDRHLKKH 51          

HSP 2 Score: 53.1434 bits (126), Expect = 2.057e-9
Identity = 22/48 (45.83%), Postives = 33/48 (68.75%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVR-THTGEQPYKCSFCTRCFSISSNLQRHIR 1062
            C++C + F  S+NL RHVR  H  E+P++C  C+RCF   +NL RH++
Sbjct:    2 CKYCDRSFSISSNLQRHVRNIHNKEKPFRCPLCSRCFGQQTNLDRHLK 49          

HSP 3 Score: 43.1282 bits (100), Expect = 5.500e-6
Identity = 26/89 (29.21%), Postives = 47/89 (52.81%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQH-RHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNF----LYSPSEDLQKDHAAEIIKQENTMYHNNAHN 480
            C  CD+ F+  + L++H R+ H+  KP+RC +C + + Q +NL RH K H+  +       SPS D +      I+++ +  + +   N
Sbjct:    2 CKYCDRSFSISSNLQRHVRNIHNKEKPFRCPLCSRCFGQQTNLDRHLKKHDTDSVSGTAGSSPSSDRE---VGSILEERDDSFFSQIQN 87          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006856.1 (pep scaffold:Pmarinus_7.0:GL476534:515915:516469:1 gene:ENSPMAG00000006196.1 transcript:ENSPMAT00000006856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 3.508e-17
Identity = 37/82 (45.12%), Postives = 47/82 (57.32%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQ 1167
            C  CGK F  + NL  H R HTGE+PY+C+ C R FS S +L +H R  H  ERPF CD C + F Q   L+ H   H  ++
Sbjct:   32 CALCGKAFGTAWNLRIHERKHTGEKPYECNACGRAFSESGHLDKH-RATHAAERPFKCDTCGRAFAQARYLKSHRATHAADR 112          

HSP 2 Score: 64.3142 bits (155), Expect = 6.001e-13
Identity = 32/80 (40.00%), Postives = 42/80 (52.50%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  CG+ F  S +L +H  TH  E+P+KC  C R F+ +  L+ H R  H  +RPF C  C K F     L+RH   H
Sbjct:   58 YECNACGRAFSESGHLDKHRATHAAERPFKCDTCGRAFAQARYLKSH-RATHAADRPFECGACGKTFTLARYLDRHRSRH 136          

HSP 3 Score: 63.5438 bits (153), Expect = 1.293e-12
Identity = 28/78 (35.90%), Postives = 45/78 (57.69%), Query Frame = 1
Query:  934 GKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQ 1167
            G +   S NL +H RTHTGE+P+ C+ C + F  + NL+ H R  H  E+P+ C+ C + F +  +L++H   H   +
Sbjct:    8 GSMTTTSWNLHKHRRTHTGERPFTCALCGKAFGTAWNLRIHERK-HTGEKPYECNACGRAFSESGHLDKHRATHAAER 84          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 86.6557 bits (213), Expect = 9.299e-19
Identity = 38/80 (47.50%), Postives = 52/80 (65.00%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C+ C + F     L +H RTH+GE+PYKC  C + F+ISS+L+ HIR  H  E+P  C IC KRF + +NL +H+K H
Sbjct:  768 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIR-THTGEKPLQCKICGKRFNESSNLSKHIKTH 846          

HSP 2 Score: 70.0922 bits (170), Expect = 1.829e-13
Identity = 32/85 (37.65%), Postives = 49/85 (57.65%), Query Frame = 1
Query:  907 RDRYHCRF--CGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +  Y C +  C + FP+   L RH++ H+  +PYKC  C RCFS    L +H R  H  E+P+ C IC K+F   ++L+ H++ H
Sbjct:  735 KSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTR-THSGEKPYKCHICNKKFAISSSLKIHIRTH 818          

HSP 3 Score: 62.3882 bits (150), Expect = 5.518e-11
Identity = 32/73 (43.84%), Postives = 43/73 (58.90%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANL 1134
            Y C  C K F  S++L  H+RTHTGE+P +C  C + F+ SSNL +HI+  HQK+  + C  C K F     L
Sbjct:  796 YKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK-THQKK--YKCSDCSKSFDDLGKL 865          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 77.0258 bits (188), Expect = 1.229e-15
Identity = 31/81 (38.27%), Postives = 53/81 (65.43%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            ++ C +C +LF ++ +L  HVR+H G +P+ C +C + F+   NL+ H R +H  E+P++CDIC K+F ++ NL  H+  H
Sbjct:  592 KHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHER-LHTGEKPYSCDICDKKFSRKGNLAAHLVTH 671          

HSP 2 Score: 71.2478 bits (173), Expect = 8.415e-14
Identity = 34/78 (43.59%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDI--CFKRFGQRANLERH 1143
            + C +CGK F +  NL  H R HTGE+PY C  C + FS   NL  H+   HQK +PF C +  C K F Q  N++ H
Sbjct:  621 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLV-THQKLKPFVCKLENCNKTFTQLGNMKAH 697          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Yeast
Match: MSN2 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes; relative distribution to nucleus increases upon DNA replication stress [Source:SGD;Acc:S000004640])

HSP 1 Score: 63.1586 bits (152), Expect = 2.926e-11
Identity = 25/55 (45.45%), Postives = 37/55 (67.27%), Query Frame = 1
Query:  991 EQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            E+P+ C  C + F  S +L+RH+R++H  ERPF C IC K+F +  NL +H+K H
Sbjct:  644 EKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTH 698          

HSP 2 Score: 55.0694 bits (131), Expect = 1.186e-8
Identity = 32/86 (37.21%), Postives = 49/86 (56.98%), Query Frame = 1
Query:  841 EQPPKSYKSSETPNSPDSFIVKRDR------YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQK 1077
            E+ P   + S TP+   S +++  +      +HC  C K F RS +L RHVR+ H+ E+P+ C  C + FS S NL +HI+  H+K
Sbjct:  616 ERRPSYRRKSMTPSRRSSVVIESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK-THKK 700          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Yeast
Match: MSN4 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes, inducing gene expression; involved in diauxic shift [Source:SGD;Acc:S000001545])

HSP 1 Score: 61.6178 bits (148), Expect = 8.880e-11
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  994 QPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            +P+KC  C + F  S +L+RHIR++H  ERPF C  C K+F +  NL +H+K H
Sbjct:  571 KPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTH 624          

HSP 2 Score: 49.6766 bits (117), Expect = 5.570e-7
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = 1
Query:  208 DSSQGFTCTDCDKIFNSEAGLKQH-RHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
            D ++ F C DC+K F     LK+H R  HST +P+ C  C K +++  NL +H K+H++
Sbjct:  568 DKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKK 626          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 58.9214 bits (141), Expect = 5.804e-10
Identity = 30/87 (34.48%), Postives = 45/87 (51.72%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCD---------ICFKRFGQRANLERHVK 1149
            + C  CGK F R  NL  H+RTHT E+P+ CS C + F+   + +RH  ++H  ++ + C           C K+F +   L RH K
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRH-EDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Nematostella
Match: EDO47692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLH7])

HSP 1 Score: 86.2705 bits (212), Expect = 1.432e-20
Identity = 37/80 (46.25%), Postives = 55/80 (68.75%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + CR CG+ F +S+++T H+RTH GE+PYKC  C + F+ SS L +H+R  H  E+P+ C+IC +RF Q  N+ RH + H
Sbjct:   50 FRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRT-HTGEKPYQCEICHQRFSQSGNMNRHKRIH 128          

HSP 2 Score: 77.0258 bits (188), Expect = 3.140e-17
Identity = 36/80 (45.00%), Postives = 50/80 (62.50%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K F ++ANLT H R H+GE+P++C  C R FS SS++  H+R  H  ERP+ C +C K F   + L +HV+ H
Sbjct:   22 YQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMRT-HNGERPYKCKVCNKAFADSSTLTKHVRTH 100          

HSP 3 Score: 63.929 bits (154), Expect = 1.239e-12
Identity = 27/71 (38.03%), Postives = 46/71 (64.79%), Query Frame = 1
Query:  943 FPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + R + L  H+RTH+G +PY+C  C + F+ ++NL  H R IH  E+PF C +C ++F Q +++  H++ H
Sbjct:    3 YARLSTLRLHMRTHSGVKPYQCMVCLKSFTQAANLTAHFR-IHSGEKPFRCRVCGRQFSQSSSVTTHMRTH 72          

HSP 4 Score: 46.595 bits (109), Expect = 1.664e-6
Identity = 21/53 (39.62%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
            + C  C+K F   + L +H  TH+  KPY+C IC + ++Q  N+ RHK+ H E
Sbjct:   78 YKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQRFSQSGNMNRHKRIHNE 130          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Nematostella
Match: EDO29702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2W2])

HSP 1 Score: 85.1149 bits (209), Expect = 6.404e-19
Identity = 38/80 (47.50%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  CGK F RS  L  H+R H+G++PYKC  C +CFS S NL+RH+  IH  ++P+ CD+C K F +  NL++H+  H
Sbjct:  120 YECGECGKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLM-IHSGQKPYKCDVCGKCFSESGNLKKHLMIH 198          

HSP 2 Score: 83.1889 bits (204), Expect = 3.662e-18
Identity = 39/80 (48.75%), Postives = 55/80 (68.75%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  CGK F +S  L RH+R H+G++PYKC  C +CF+ S+NL+ H+R IH  ++P+ CD C K F Q  +L+RH+K H
Sbjct:   36 YRCDECGKGFTQSGALNRHLRIHSGQKPYKCDECGKCFNQSANLKTHLR-IHSGQKPYKCDECGKCFIQYVDLKRHLKIH 114          

HSP 3 Score: 79.337 bits (194), Expect = 7.453e-17
Identity = 35/80 (43.75%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  CGK F +  +L RH++ HTG++PY+C  C +CF+ S  L+ H+R IH  ++P+ CD+C K F +  NL+RH+  H
Sbjct:   92 YKCDECGKCFIQYVDLKRHLKIHTGQKPYECGECGKCFTRSERLKTHLR-IHSGQKPYKCDVCGKCFSESRNLKRHLMIH 170          

HSP 4 Score: 78.1814 bits (191), Expect = 1.924e-16
Identity = 42/109 (38.53%), Postives = 61/109 (55.96%), Query Frame = 1
Query:  838 CEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C +  K +  SE   +       +  Y C  CGK F  S NL RH+  H+G++PYKC  C +CFS S NL++H+  IH  ++P+ CD C K F     L R++K HL++
Sbjct:  122 CGECGKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLM-IHSGQKPYKCDECGKCF----ILYRNLKTHLIH 225          

HSP 5 Score: 72.4034 bits (176), Expect = 1.618e-14
Identity = 35/78 (44.87%), Postives = 49/78 (62.82%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            C  CG  F R A L RH+  H+G++PY+C  C + F+ S  L RH+R IH  ++P+ CD C K F Q ANL+ H++ H
Sbjct:   10 CGECGMGFTRHAYLKRHLMIHSGQKPYRCDECGKGFTQSGALNRHLR-IHSGQKPYKCDECGKCFNQSANLKTHLRIH 86          

HSP 6 Score: 65.855 bits (159), Expect = 2.742e-12
Identity = 32/79 (40.51%), Postives = 45/79 (56.96%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRN--IHQKERPFNCDICFKRFGQRANLERHV 1146
            Y C  CGK F  S NL +H+  H+G++PYKC  C +CF +  NL+ H+ +  IH  ++P  CD C K F Q    +  V
Sbjct:  176 YKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLIHLMIHSGQKPHKCDECGKCFHQSVLYDGQV 254          

HSP 7 Score: 48.521 bits (114), Expect = 1.730e-6
Identity = 23/51 (45.10%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSH 375
            + C +C K FN  A LK H   HS  KPY+C  C K + Q+ +L RH K H
Sbjct:   64 YKCDECGKCFNQSANLKTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLKIH 114          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Nematostella
Match: EDO41082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5G4])

HSP 1 Score: 87.4261 bits (215), Expect = 8.530e-19
Identity = 79/321 (24.61%), Postives = 138/321 (42.99%), Query Frame = 1
Query:  223 FTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDDNNCKTSINHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDR------YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQ 1167
            + C  CDK F+  +   QH   HS  + + C IC K++++ S L RH  SH +         +    ++A ++K +  +YH       P      I G ++ +   L    +    +   + S  H      F    +L+R                     V++ + S L ++T +   Y   I N    +  ++   H+   + ++P +     +T  S  + +    R      + C+ CGK+F RS NL++H+  HTGE+PYKC  C R F+ +S L+ H R  H   +P+ C+ C KRF       RH++ H  ++
Sbjct:   55 YECRYCDKRFSQPSHRVQHEFKHSGERSHMCDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDR-VYHRGV---KPY--ECDICGRAFSDRSGLVKHERTHTGERPFECSFCHMM----FSLKGLLTRHMRSHTGQRPYKCEYCSAAFSVSDTLKSHLRLHTGE-RPYKCEICNKGFVQS-SALSSHLLTHSGKRPYECLTCGQTFRSRSNLLYHERRHRGEAPFECQTCGKVFVRSDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRR-HDGIKPYKCERCDKRFTSSNERTRHMRTHTGDK 362          

HSP 2 Score: 69.3218 bits (168), Expect = 6.682e-13
Identity = 36/78 (46.15%), Postives = 45/78 (57.69%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVK 1149
            Y C  C K F  S   TRH+RTHTG++PY C  C   F  +++L RH + IH   +PF CD C K F   + L RHVK
Sbjct:  336 YKCERCDKRFTSSNERTRHMRTHTGDKPYTCDICKENFMYTTSLARH-KLIHSGAKPFKCDTCEKAFRSSSELTRHVK 412          

HSP 3 Score: 63.929 bits (154), Expect = 3.338e-11
Identity = 36/80 (45.00%), Postives = 47/80 (58.75%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y CR C K F R   LT H+R HTGE+PY+C +C + FS  S+  +H    H  ER   CDIC K F + + L RH+ +H
Sbjct:   27 YSCRTCDKEFTRRDALTCHIRIHTGERPYECRYCDKRFSQPSHRVQH-EFKHSGERSHMCDICSKSFSRASTLVRHMISH 105          

HSP 4 Score: 59.6918 bits (143), Expect = 8.607e-10
Identity = 31/80 (38.75%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C + F  + +L RH   H+G +P+KC  C + F  SS L RH++ +H K +PF CD C + F     L RH   H
Sbjct:  364 YTCDICKENFMYTTSLARHKLIHSGAKPFKCDTCEKAFRSSSELTRHVKLVHVK-KPFPCDTCKQAFRSEDALARHKNTH 442          

HSP 5 Score: 52.373 bits (124), Expect = 1.890e-7
Identity = 29/78 (37.18%), Postives = 41/78 (52.56%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            C  C + F   ++L +H R H  ++PY C  C + F+    L  HIR IH  ERP+ C  C KRF Q ++  +H   H
Sbjct:    1 CSECSRAFKNKSDLVKHKRVHCDDKPYSCRTCDKEFTRRDALTCHIR-IHTGERPYECRYCDKRFSQPSHRVQHEFKH 77          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Nematostella
Match: EDO49116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU6])

HSP 1 Score: 82.4185 bits (202), Expect = 1.075e-18
Identity = 40/106 (37.74%), Postives = 60/106 (56.60%), Query Frame = 1
Query:  838 CEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            C++ PK++  +      +        Y C  C + F +  NL RH+ THTGE+P+KC++C + F  SS+L+RH+R IH  ERP+ C  C K F    NL+ H+  H
Sbjct:   34 CQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVR-IHTGERPYKCKQCSKAFTTSGNLQSHILTH 138          

HSP 2 Score: 82.0333 bits (201), Expect = 1.130e-18
Identity = 37/80 (46.25%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C+ C K+F RS N  RHV  HTG++PYKC  C + F+++++L+ H R IH  E+P+ C+IC + F Q  NL+RH+  H
Sbjct:    4 YTCQHCSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNR-IHTGEKPYTCNICSRGFAQLTNLQRHILTH 82          

HSP 3 Score: 77.411 bits (189), Expect = 6.062e-17
Identity = 37/78 (47.44%), Postives = 50/78 (64.10%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            C +C K F  S++L RHVR HTGE+PYKC  C++ F+ S NLQ HI   H  E+P+ C IC  +F   +NL  H++ H
Sbjct:   90 CTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHILT-HTGEKPYKCSICNWKFISSSNLRTHIRIH 166          

HSP 4 Score: 45.8246 bits (107), Expect = 5.160e-6
Identity = 24/70 (34.29%), Postives = 36/70 (51.43%), Query Frame = 1
Query:  166 FIKVAKVMSRNSFTDSSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSH 375
            F   A +   N      + +TC  C + F     L++H  TH+  KP++CT CPKA+   S+L RH + H
Sbjct:   41 FALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVRIH 110          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Nematostella
Match: EDO45259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTG0])

HSP 1 Score: 81.2629 bits (199), Expect = 1.451e-18
Identity = 37/80 (46.25%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            + C FC K F     L RH+R+HTGE PYKC+ C+R F  S++LQRH+RN H  E+P+ C  C + F +  +L+RH++ H
Sbjct:   35 WKCSFCSKAFQYPCYLRRHMRSHTGESPYKCTQCSRAFVRSTDLQRHLRN-HTGEKPYKCKECSRAFARSTDLKRHMRTH 113          

HSP 2 Score: 78.5666 bits (192), Expect = 1.308e-17
Identity = 37/80 (46.25%), Postives = 52/80 (65.00%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C + F RS +L RH+R HTGE+PYKC  C+R F+ S++L+RH+R  H  E+P+ C  C K F Q  +L+ H+  H
Sbjct:   63 YKCTQCSRAFVRSTDLQRHLRNHTGEKPYKCKECSRAFARSTDLKRHMRT-HTGEKPYKCWQCSKAFSQSGSLQTHLHTH 141          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Medaka
Match: mecom (MDS1 and EVI1 complex locus [Source:NCBI gene;Acc:101169474])

HSP 1 Score: 142.124 bits (357), Expect = 2.532e-36
Identity = 61/91 (67.03%), Postives = 77/91 (84.62%), Query Frame = 1
Query:  886 PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRHIRNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  738 PETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH 828          

HSP 2 Score: 76.2554 bits (186), Expect = 1.934e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C+DC K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  160 GARAHACSDCGKTFATSSGLKQHKHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMHAD 216          

HSP 3 Score: 68.9366 bits (167), Expect = 4.082e-12
Identity = 33/81 (40.74%), Postives = 51/81 (62.96%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            Y C  C K+F   +NL RH+R+ H G + + CS C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  135 YECENCSKVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLKQH-KHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMH 214          

HSP 4 Score: 60.8474 bits (146), Expect = 1.590e-9
Identity = 30/76 (39.47%), Postives = 41/76 (53.95%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C++ F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  107 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCSKVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLKQH 182          

HSP 5 Score: 59.3066 bits (142), Expect = 4.755e-9
Identity = 35/118 (29.66%), Postives = 58/118 (49.15%), Query Frame = 1
Query:  838 CEQPPKSYKSSET---------PNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVN 1164
            C  PP S+ +SE          P     +      + C+ C ++FP   +L  H+ +H+ E+ YKC  C + F+  SNL RH +  H   + + C+ C K F   +NL+RH+++  V 
Sbjct:   44 CGGPPSSFLNSEEDFNGLKDHEPEDLRPYSSSHGLHECKECDQVFPDVQSLEAHMLSHSEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCSKVFTDPSNLQRHIRSQHVG 160          

HSP 6 Score: 53.9138 bits (128), Expect = 2.299e-7
Identity = 37/123 (30.08%), Postives = 61/123 (49.59%), Query Frame = 1
Query:  217 QGFTCTDCDKIFNSEAGLKQH-RHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNF----LYSPSEDLQKDHAAEIIKQENTMYHNNAHN---------SPPIWSRTSIIGSSYDEEFPL 543
            Q + C  CD+ F+  + L++H R+ H+  KP++C +C + + Q +NL RH K HE  N     + SP  +L  D ++ I+  +   Y N   N         + P  S   I G +++E  PL
Sbjct:  775 QPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAMSSPQSEL--DSSSAILDDKEDSYFNEIRNFISSTGQNQASPDPSEEGINGGAFEEGKPL 895          

HSP 7 Score: 49.2914 bits (116), Expect = 6.376e-6
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 1
Query:  211 SSQGF-TCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            SS G   C +CD++F     L+ H  +HS  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:   74 SSHGLHECKECDQVFPDVQSLEAHMLSHSEEREYKCDQCPKAFNWKSNLIRHQMSHD 130          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Medaka
Match: si:ch211-263k4.2 (PR/SET domain 16 [Source:NCBI gene;Acc:101156011])

HSP 1 Score: 141.739 bits (356), Expect = 3.080e-36
Identity = 68/118 (57.63%), Postives = 86/118 (72.88%), Query Frame = 1
Query:  832 LNCEQPPKSYKSSETP----NSP-----DSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            L  + PP S + S  P     SP     D+ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct: 1029 LKLDAPPNSLQHSAHPLFNFRSPPPSLSDAILRKGKERYACRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 1146          

HSP 2 Score: 74.7146 bits (182), Expect = 5.634e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++  TC +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  403 GARAHTCPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 459          

HSP 3 Score: 60.8474 bits (146), Expect = 1.556e-9
Identity = 32/88 (36.36%), Postives = 51/88 (57.95%), Query Frame = 1
Query:  913 RYHCRFCGKL------FPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+      F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  371 RFECENCDKVQHTQHVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 457          

HSP 4 Score: 55.8398 bits (133), Expect = 5.263e-8
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFK------RFGQRANLERHVKNHLVNQQ 1170
            + C+ C K+FP   +L +H+  HT E+ YKC  C + F+  SNL RH +  H   + F C+ C K       F   +NL+RH+++  V  +
Sbjct:  316 HECKDCEKIFPNEYSLGQHMIVHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKRFECENCDKVQHTQHVFTDPSNLQRHIRSQHVGAR 405          

HSP 5 Score: 53.9138 bits (128), Expect = 2.682e-7
Identity = 24/50 (48.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            C DC+KIF +E  L QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  318 CKDCEKIFPNEYSLGQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 367          

HSP 6 Score: 52.7582 bits (125), Expect = 5.969e-7
Identity = 29/83 (34.94%), Postives = 40/83 (48.19%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRC------FSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
             Y C  C K F   +NL RH  +H   + ++C  C +       F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  343 EYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCDKVQHTQHVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH 425          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Medaka
Match: si:ch211-263k4.2 (PR/SET domain 16 [Source:NCBI gene;Acc:101156011])

HSP 1 Score: 141.739 bits (356), Expect = 3.103e-36
Identity = 68/118 (57.63%), Postives = 86/118 (72.88%), Query Frame = 1
Query:  832 LNCEQPPKSYKSSETP----NSP-----DSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            L  + PP S + S  P     SP     D+ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct: 1020 LKLDAPPNSLQHSAHPLFNFRSPPPSLSDAILRKGKERYACRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 1137          

HSP 2 Score: 74.7146 bits (182), Expect = 5.882e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++  TC +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  394 GARAHTCPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 450          

HSP 3 Score: 60.8474 bits (146), Expect = 1.424e-9
Identity = 32/88 (36.36%), Postives = 51/88 (57.95%), Query Frame = 1
Query:  913 RYHCRFCGKL------FPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+      F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  362 RFECENCDKVQHTQHVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 448          

HSP 4 Score: 55.8398 bits (133), Expect = 5.167e-8
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFK------RFGQRANLERHVKNHLVNQQ 1170
            + C+ C K+FP   +L +H+  HT E+ YKC  C + F+  SNL RH +  H   + F C+ C K       F   +NL+RH+++  V  +
Sbjct:  307 HECKDCEKIFPNEYSLGQHMIVHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKRFECENCDKVQHTQHVFTDPSNLQRHIRSQHVGAR 396          

HSP 5 Score: 53.9138 bits (128), Expect = 2.610e-7
Identity = 24/50 (48.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            C DC+KIF +E  L QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  309 CKDCEKIFPNEYSLGQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 358          

HSP 6 Score: 52.7582 bits (125), Expect = 5.809e-7
Identity = 29/83 (34.94%), Postives = 40/83 (48.19%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRC------FSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
             Y C  C K F   +NL RH  +H   + ++C  C +       F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  334 EYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCDKVQHTQHVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH 416          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Medaka
Match: mecom (MDS1 and EVI1 complex locus [Source:NCBI gene;Acc:101169474])

HSP 1 Score: 141.739 bits (356), Expect = 3.675e-36
Identity = 61/91 (67.03%), Postives = 77/91 (84.62%), Query Frame = 1
Query:  886 PDSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            P++ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRHIRNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct:  936 PETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKH 1026          

HSP 2 Score: 69.707 bits (169), Expect = 2.124e-12
Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKP--------YRCTICPKAYTQFSNLCRHKKSHEE 381
             ++   C+DC K F + +GLKQH+H HS+ KP        Y C +C K+YTQFSNLCRHK+ H +
Sbjct:  349 GARAHACSDCGKTFATSSGLKQHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHAD 413          

HSP 3 Score: 56.9954 bits (136), Expect = 2.472e-8
Identity = 33/90 (36.67%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  916 YHCRFCGK-LFPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNC--------DICFKRFGQRANLERHVKNH 1155
            Y C  C K +F   +NL RH+R+ H G + + CS C + F+ SS L++H ++IH   +PF C        ++C K + Q +NL RH + H
Sbjct:  323 YECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLKQH-KHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMH 411          

HSP 4 Score: 56.225 bits (134), Expect = 4.841e-8
Identity = 30/77 (38.96%), Postives = 41/77 (53.25%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTR-CFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + Y+C  C++  F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  295 YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLKQH 371          

HSP 5 Score: 54.6842 bits (130), Expect = 1.199e-7
Identity = 28/84 (33.33%), Postives = 49/84 (58.33%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKR-FGQRANLERHVKNHLVN 1164
            + C+ C ++FP   +L  H+ +H+ E+ YKC  C + F+  SNL RH +  H   + + C+ C K+ F   +NL+RH+++  V 
Sbjct:  267 HECKECDQVFPDVQSLEAHMLSHSEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVG 349          

HSP 6 Score: 53.5286 bits (127), Expect = 2.695e-7
Identity = 37/123 (30.08%), Postives = 61/123 (49.59%), Query Frame = 1
Query:  217 QGFTCTDCDKIFNSEAGLKQH-RHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNF----LYSPSEDLQKDHAAEIIKQENTMYHNNAHN---------SPPIWSRTSIIGSSYDEEFPL 543
            Q + C  CD+ F+  + L++H R+ H+  KP++C +C + + Q +NL RH K HE  N     + SP  +L  D ++ I+  +   Y N   N         + P  S   I G +++E  PL
Sbjct:  973 QPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAMSSPQSEL--DSSSAILDDKEDSYFNEIRNFISSTGQNQASPDPSEEGINGGAFEEGKPL 1093          

HSP 7 Score: 49.2914 bits (116), Expect = 6.370e-6
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 1
Query:  211 SSQGF-TCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            SS G   C +CD++F     L+ H  +HS  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  262 SSHGLHECKECDQVFPDVQSLEAHMLSHSEEREYKCDQCPKAFNWKSNLIRHQMSHD 318          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Medaka
Match: si:ch211-263k4.2 (PR/SET domain 16 [Source:NCBI gene;Acc:101156011])

HSP 1 Score: 141.739 bits (356), Expect = 3.738e-36
Identity = 68/118 (57.63%), Postives = 86/118 (72.88%), Query Frame = 1
Query:  832 LNCEQPPKSYKSSETP----NSP-----DSFIVK-RDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            L  + PP S + S  P     SP     D+ + K ++RY CR+CGK+FPRSANLTRH+RTHTGEQPY+C +C R FSISSNLQRH+RNIH KE+PF C +C + FGQ+ NL+RH+K H
Sbjct: 1029 LKLDAPPNSLQHSAHPLFNFRSPPPSLSDAILRKGKERYACRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKH 1146          

HSP 2 Score: 74.7146 bits (182), Expect = 5.738e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  211 SSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE 381
             ++  TC +C K F + +GLKQH+H HS+ KP+ C +C K+YTQFSNLCRHK+ H +
Sbjct:  403 GARAHTCPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHAD 459          

HSP 3 Score: 60.8474 bits (146), Expect = 1.719e-9
Identity = 32/88 (36.36%), Postives = 51/88 (57.95%), Query Frame = 1
Query:  913 RYHCRFCGKL------FPRSANLTRHVRT-HTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            R+ C  C K+      F   +NL RH+R+ H G + + C  C + F+ SS L++H ++IH   +PF C++C K + Q +NL RH + H
Sbjct:  371 RFECENCDKVQHTQHVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH-KHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH 457          

HSP 4 Score: 55.8398 bits (133), Expect = 5.973e-8
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFK------RFGQRANLERHVKNHLVNQQ 1170
            + C+ C K+FP   +L +H+  HT E+ YKC  C + F+  SNL RH +  H   + F C+ C K       F   +NL+RH+++  V  +
Sbjct:  316 HECKDCEKIFPNEYSLGQHMIVHTEEREYKCDQCPKAFNWKSNLIRH-QMSHDSGKRFECENCDKVQHTQHVFTDPSNLQRHIRSQHVGAR 405          

HSP 5 Score: 53.5286 bits (127), Expect = 2.791e-7
Identity = 24/50 (48.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  229 CTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHE 378
            C DC+KIF +E  L QH   H+  + Y+C  CPKA+   SNL RH+ SH+
Sbjct:  318 CKDCEKIFPNEYSLGQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHD 367          

HSP 6 Score: 52.373 bits (124), Expect = 6.322e-7
Identity = 29/82 (35.37%), Postives = 40/82 (48.78%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRC------FSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERH 1143
            Y C  C K F   +NL RH  +H   + ++C  C +       F+  SNLQRHIR+ H   R   C  C K F   + L++H
Sbjct:  344 YKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCDKVQHTQHVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQH 425          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Planmine SMEST
Match: SMESG000028951.1 (SMESG000028951.1)

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 334/334 (100.00%), Postives = 334/334 (100.00%), Query Frame = 1
Query:  187 MSRNSFTDSSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDDNNCKTSINHFYNSYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSSA 1188
            MSRNSFTDSSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDDNNCKTSINHFYNSYSFKEPDILSRIFDFKLPLFWPFLLPPHFPSLVNNKMISPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSSA
Sbjct:    1 MSRNSFTDSSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHNSPPIWSRTSIIGSSYDEEFPLDLSVKVIPDDNNCKTSINHFYNSYSFKEPDILSRIFDFKLPLFWPFLLPPHFPSLVNNKMISPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSGSSA 334          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Planmine SMEST
Match: SMESG000063468.1 (SMESG000063468.1)

HSP 1 Score: 144.821 bits (364), Expect = 1.723e-39
Identity = 113/339 (33.33%), Postives = 162/339 (47.79%), Query Frame = 1
Query:  226 TCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAYTQFSNLCRHKKSHEE------------------TNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHNSPPIWSRTS---------IIGSS---------YDEEFP-LDLSVKVIPDDNNCKTSINHFYN-SYSFKEPDILSRIXXXXXXXXXXXXXXXXXXXXVNNKMISPLNVYTRQTSSYHNSIHNLPISRELNSSPPHIDQLNC------EQPP---KSYKSSE----------TPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIH 1071
            TC  C K F S +GLKQH H H++FKP+RC +C KAYTQFSNLCRHK+ H+                    N  +S  +D Q     E     +++  NN  + P   + ++         + G +          D+E P L L + + P  +       HF N  + F +P  L+   +  L       +     S +N  ++ PL+ + +   SY N I   P    L SS       NC      ++PP   +S+ SS+          +P+S       + ++ C  CGK+FPR+ANL RH+RTHTGEQPY C +C R FSISSN+QRH+RNIH
Sbjct:   13 TCPLCSKCFTSISGLKQHMHIHASFKPFRCQVCHKAYTQFSNLCRHKRMHKRCKRKSCFDSSNLIEPLINNNTYFSNLQDPQGKLKPETYNLPSSVIDNNT-SKPKFMTNSTQNFRFHIENLFGEADQKSKECKTIDKEKPFLLLPLPMKPSPSYLSNLYYHFSNMKHPFFQPFNLTAYKNIFLSQISMDNISTLINSNLN--ILPPLSTFLK---SYQNEIEMFPGLSHLKSSSTSQQLFNCNSYKPFQKPPMRPESFHSSKQISSINTVKFSPSSTHLMKKLKSQHPCSVCGKIFPRAANLNRHLRTHTGEQPYHCPYCERSFSISSNMQRHVRNIH 345          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Planmine SMEST
Match: SMESG000059642.1 (SMESG000059642.1)

HSP 1 Score: 123.25 bits (308), Expect = 1.833e-30
Identity = 52/79 (65.82%), Postives = 64/79 (81.01%), Query Frame = 1
Query:  913 RYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVK 1149
            RYHC  C K FPR+ANL RH+RTHTGEQPYKC+FC +CFSISSN+QRH+RNIH KERP+ C  C + F Q  +L+RH++
Sbjct:  497 RYHCHLCLKTFPRAANLNRHLRTHTGEQPYKCAFCDKCFSISSNMQRHVRNIHNKERPYKCTKCDRIFDQLTSLDRHIR 575          

HSP 2 Score: 50.447 bits (119), Expect = 1.938e-6
Identity = 47/156 (30.13%), Postives = 67/156 (42.95%), Query Frame = 1
Query:  748 RQTSSYHNSIHNLPISRELNSSPPHIDQLN-----CEQPPKSY-------KSSETPNSPDSFIVKRDRYHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQQNSG 1179
            R+TSS +    + PIS+ L+S   +   LN     C +P +S        K  + PNS          Y C  CGK F  S+ L +H+  H+  +PY C  C + ++  SNL RH R     +R   C  C   F      + H K H +    SG
Sbjct:  154 RKTSSDYKQSVSFPISK-LSSPISNGSNLNLFCDVCNKPCRSQVSLIRHRKQHQNPNS---------HYSCDVCGKTFKISSGLKQHMHIHSSNKPYSCLNCQKSYTQYSNLCRHKRMSRDCQRKAKCTECGMEFTNGKTYDTH-KQHCLGLDPSG 298          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Planmine SMEST
Match: SMESG000000679.1 (SMESG000000679.1)

HSP 1 Score: 85.5001 bits (210), Expect = 6.158e-18
Identity = 36/81 (44.44%), Postives = 55/81 (67.90%), Query Frame = 1
Query:  916 YHCRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHL 1158
            + C  C + F +S+++T H+RTH+GE+PY+C  C++ FS SS L +H R +H  E+P+ C IC  +F Q  NL RH++ HL
Sbjct:  373 FSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTR-VHSGEKPYKCRICLLKFSQSGNLNRHMRVHL 452          

HSP 2 Score: 77.7962 bits (190), Expect = 2.178e-15
Identity = 33/78 (42.31%), Postives = 52/78 (66.67%), Query Frame = 1
Query:  922 CRFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            C  CG+ + R + L  H+RTH+GE+P+KC+ C++ FS  +NL  H R IH  E+PF+C IC + F Q +++  H++ H
Sbjct:  319 CHLCGRSYARPSTLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKR-IHSGEKPFSCHICCRTFSQSSSVTTHMRTH 395          

HSP 3 Score: 49.6766 bits (117), Expect = 2.482e-6
Identity = 23/55 (41.82%), Postives = 33/55 (60.00%), Query Frame = 1
Query:  991 EQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNH 1155
            ++P +C  C R ++  S L+ H+R  H  ERPF C++C K F Q ANL  H + H
Sbjct:  314 DEPNQCHLCGRSYARPSTLKIHMR-THSGERPFKCNVCSKTFSQVANLTAHKRIH 367          
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Planmine SMEST
Match: SMESG000005384.1 (SMESG000005384.1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.193e-17
Identity = 43/86 (50.00%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  916 YHC--RFCGKLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERPFNCDICFKRFGQRANLERHVKNHLVNQ 1167
            Y C  + C K F RS  LTRH R H+GE+P+KCS C RCFS S +L  HIR  H  E+P+ C IC KRF +    +RH+K H   Q
Sbjct:  243 YQCNEKNCSKTFSRSDELTRHKRIHSGEKPFKCSKCERCFSRSDHLATHIR-THTGEKPYFCSICDKRFARSDERKRHLKIHSKGQ 327          
The following BLAST results are available for this feature:
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MECOM1.806e-3647.83MDS1 and EVI1 complex locus [Source:HGNC Symbol;Ac... [more]
MECOM2.156e-3647.83MDS1 and EVI1 complex locus [Source:HGNC Symbol;Ac... [more]
MECOM2.203e-3647.83MDS1 and EVI1 complex locus [Source:HGNC Symbol;Ac... [more]
MECOM5.447e-3652.99MDS1 and EVI1 complex locus [Source:HGNC Symbol;Ac... [more]
MECOM5.447e-3652.99MDS1 and EVI1 complex locus [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-432.464e-2580.36pep chromosome:WBcel235:II:9960333:9962344:1 gene:... [more]
egl-434.550e-2480.36pep chromosome:WBcel235:II:9955185:9962344:1 gene:... [more]
blmp-13.871e-1848.19B lymphocyte-induced maturation protein 1 homolog ... [more]
blmp-14.195e-1848.19B lymphocyte-induced maturation protein 1 homolog ... [more]
egrh-29.832e-1844.19EGR (Early Growth factor Response factor) Homolog ... [more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG103483.784e-3970.21gene:FBgn0032707 transcript:FBtr0343112[more]
CG103483.784e-3970.21gene:FBgn0032707 transcript:FBtr0301647[more]
ham2.206e-3870.93gene:FBgn0045852 transcript:FBtr0332016[more]
ham4.030e-3773.49gene:FBgn0045852 transcript:FBtr0332017[more]
ham4.093e-3773.49gene:FBgn0045852 transcript:FBtr0305621[more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-263k4.25.137e-3663.92si:ch211-263k4.2 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
si:ch211-263k4.21.333e-3563.92si:ch211-263k4.2 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
znf10183.099e-2126.46zinc finger protein 1018 [Source:ZFIN;Acc:ZDB-GENE... [more]
znf9794.786e-2127.55zinc finger protein 979 [Source:ZFIN;Acc:ZDB-GENE-... [more]
znf10211.521e-2026.28zinc finger protein 1021 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000031589.11.949e-3762.75MDS1 and EVI1 complex locus protein EVI1-A-like [S... [more]
PRDM162.189e-3567.78PR domain 16 [Source:NCBI gene;Acc:100485690][more]
PRDM162.856e-3567.78PR domain 16 [Source:NCBI gene;Acc:100485690][more]
PRDM163.112e-3567.78PR domain 16 [Source:NCBI gene;Acc:100485690][more]
stk313.169e-1925.62serine/threonine kinase 31 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mecom2.448e-3661.90MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc... [more]
Mecom2.903e-3647.74MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc... [more]
Mecom2.933e-3647.74MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc... [more]
Mecom3.093e-3647.74MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc... [more]
Mecom4.131e-3647.74MDS1 and EVI1 complex locus [Source:MGI Symbol;Acc... [more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8I7Z8|HAM_DROME4.102e-3673.49Transcription factor hamlet OS=Drosophila melanoga... [more]
sp|B7ZRM8|EVI1B_XENLA9.833e-3663.73MDS1 and EVI1 complex locus protein EVI1-B OS=Xeno... [more]
sp|Q03112|MECOM_HUMAN1.035e-3547.83Histone-lysine N-methyltransferase MECOM OS=Homo s... [more]
sp|B7ZRU9|EVI1A_XENLA1.369e-3562.75MDS1 and EVI1 complex locus protein EVI1-A OS=Xeno... [more]
sp|P14404|MECOM_MOUSE2.414e-3547.74Histone-lysine N-methyltransferase MECOM OS=Mus mu... [more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S5BAW71.558e-4773.53Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A3P8K3Q51.465e-4677.08Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A183AF401.719e-4677.08Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A1S8X7243.939e-4678.13Zinc finger, C2H2 type OS=Opisthorchis viverrini O... [more]
A0A075ACS54.151e-4678.13Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-263k4.24.213e-3663.92PR/SET domain 16 [Source:NCBI gene;Acc:103028334][more]
si:ch211-263k4.24.775e-3663.92PR/SET domain 16 [Source:NCBI gene;Acc:103028334][more]
mecom4.794e-3667.03MDS1 and EVI1 complex locus [Source:ZFIN;Acc:ZDB-G... [more]
si:ch211-263k4.24.988e-3663.92PR/SET domain 16 [Source:NCBI gene;Acc:103028334][more]
si:ch211-263k4.25.095e-3663.92PR/SET domain 16 [Source:NCBI gene;Acc:103028334][more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007831.15.887e-1948.68pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 g... [more]
ENSPMAT00000005225.17.252e-1924.44pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1... [more]
ENSPMAT00000006002.11.970e-1845.56pep scaffold:Pmarinus_7.0:GL479218:16696:34135:-1 ... [more]
ENSPMAT00000007400.12.724e-1762.75pep scaffold:Pmarinus_7.0:GL476367:705224:706108:-... [more]
ENSPMAT00000006856.13.508e-1745.12pep scaffold:Pmarinus_7.0:GL476534:515915:516469:1... [more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP19.299e-1947.50Zinc-regulated transcription factor; binds to zinc... [more]
AZF11.229e-1538.27Zinc-finger transcription factor; involved in diau... [more]
MSN22.926e-1145.45Stress-responsive transcriptional activator; activ... [more]
MSN48.880e-1146.30Stress-responsive transcriptional activator; activ... [more]
CRZ15.804e-1034.48Transcription factor, activates transcription of s... [more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476921.432e-2046.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297026.404e-1947.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410828.530e-1924.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491161.075e-1837.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452591.451e-1846.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mecom2.532e-3667.03MDS1 and EVI1 complex locus [Source:NCBI gene;Acc:... [more]
si:ch211-263k4.23.080e-3657.63PR/SET domain 16 [Source:NCBI gene;Acc:101156011][more]
si:ch211-263k4.23.103e-3657.63PR/SET domain 16 [Source:NCBI gene;Acc:101156011][more]
mecom3.675e-3667.03MDS1 and EVI1 complex locus [Source:NCBI gene;Acc:... [more]
si:ch211-263k4.23.738e-3657.63PR/SET domain 16 [Source:NCBI gene;Acc:101156011][more]
back to top
BLAST of MDS1 and EVI1 complex locus protein EVI1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028951.10.000e+0100.00SMESG000028951.1[more]
SMESG000063468.11.723e-3933.33SMESG000063468.1[more]
SMESG000059642.11.833e-3065.82SMESG000059642.1[more]
SMESG000000679.16.158e-1844.44SMESG000000679.1[more]
SMESG000005384.11.193e-1750.00SMESG000005384.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027162 ID=SMED30027162|Name=MDS1 and EVI1 complex locus protein EVI1|organism=Schmidtea mediterranea sexual|type=transcript|length=1205bp
TACATAGTACTGATGAGAGTCAAAAATCTAAAAAACTAGTCTGCCGTTAG
AAATCTCATTGAATATTACTTTGAAAAAACTTTTTTTAAATTGATTATTT
CATCCGAAAAATAAATAATAAATTAATTATAAATAACATAATAATGAAAT
AATAATAAATATTTTTTTATTAAGGTGGCAAAAGTTATGTCGAGAAATTC
ATTTACTGACAGTTCTCAAGGATTTACGTGTACTGATTGTGATAAAATAT
TCAACAGTGAAGCTGGCCTAAAACAGCACCGACATACGCATTCAACATTC
AAGCCTTATCGGTGTACAATTTGTCCTAAAGCTTATACACAATTCAGTAA
TTTATGTCGGCATAAAAAATCTCACGAGGAGACAAATTTTCTATATTCAC
CTTCTGAAGACTTACAAAAGGATCATGCTGCAGAAATAATTAAACAAGAA
AACACTATGTATCATAATAATGCGCACAATTCCCCACCAATCTGGTCACG
TACGTCTATCATTGGCAGTAGCTACGATGAGGAATTTCCGTTAGATTTAT
CAGTAAAAGTAATTCCAGATGACAACAATTGCAAAACCTCTATTAATCAT
TTTTATAATTCATATTCCTTTAAAGAACCTGATATTCTTTCAAGAATTTT
CGACTTTAAGCTACCATTATTTTGGCCTTTCCTATTACCGCCACATTTCC
CATCATTGGTCAACAATAAAATGATTTCTCCTTTGAATGTATACACAAGA
CAAACTTCTTCATATCACAATTCCATTCACAATTTGCCGATATCCCGAGA
ATTGAATTCGAGCCCCCCTCATATTGATCAATTAAATTGTGAACAACCCC
CCAAATCGTACAAGTCATCAGAAACTCCAAACTCTCCAGATTCGTTCATT
GTGAAAAGAGATAGATATCATTGTCGGTTTTGTGGAAAACTCTTTCCTAG
ATCAGCGAATTTAACTCGCCATGTCCGGACGCACACGGGAGAGCAGCCTT
ATAAATGCTCATTTTGTACAAGATGCTTTAGCATTTCTAGTAATTTACAA
AGACATATTAGAAACATTCATCAAAAAGAACGTCCGTTCAACTGTGATAT
TTGTTTTAAACGATTTGGACAACGCGCTAATCTTGAAAGACATGTTAAAA
ATCATTTAGTCAATCAACAAAATTCCGGATCATCCGCCTGATGATTCACA
ACTTT
back to top

protein sequence of SMED30027162-orf-1

>SMED30027162-orf-1 ID=SMED30027162-orf-1|Name=SMED30027162-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=335bp
MSRNSFTDSSQGFTCTDCDKIFNSEAGLKQHRHTHSTFKPYRCTICPKAY
TQFSNLCRHKKSHEETNFLYSPSEDLQKDHAAEIIKQENTMYHNNAHNSP
PIWSRTSIIGSSYDEEFPLDLSVKVIPDDNNCKTSINHFYNSYSFKEPDI
LSRIFDFKLPLFWPFLLPPHFPSLVNNKMISPLNVYTRQTSSYHNSIHNL
PISRELNSSPPHIDQLNCEQPPKSYKSSETPNSPDSFIVKRDRYHCRFCG
KLFPRSANLTRHVRTHTGEQPYKCSFCTRCFSISSNLQRHIRNIHQKERP
FNCDICFKRFGQRANLERHVKNHLVNQQNSGSSA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003674molecular_function
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 13..35
e-value: 0.0028
score: 26.9
coord: 41..63
e-value: 0.01
score: 25.0
coord: 244..266
e-value: 3.9E-4
score: 29.8
coord: 301..323
e-value: 0.0062
score: 25.7
coord: 272..295
e-value: 0.0022
score: 27.2
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 244..266
e-value: 1.7E-4
score: 21.9
coord: 41..63
e-value: 7.2E-4
score: 19.9
coord: 272..295
e-value: 8.8E-5
score: 22.8
coord: 13..35
e-value: 5.8E-4
score: 20.2
coord: 301..323
e-value: 0.0016
score: 18.8
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 15..35
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 303..323
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 246..266
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 43..63
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 274..295
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 244..271
score: 16.56
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 272..300
score: 14.856
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 13..40
score: 13.235
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 301..328
score: 10.97
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 41..68
score: 10.97
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 296..327
e-value: 2.6E-10
score: 41.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 243..270
e-value: 1.3E-12
score: 49.4
coord: 12..41
e-value: 8.5E-7
score: 30.7
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 271..295
e-value: 1.5E-10
score: 42.7
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 42..66
e-value: 3.7E-6
score: 28.6
NoneNo IPR availablePANTHERPTHR24393:SF69MDS1 AND EVI1 COMPLEX LOCUS PROTEINcoord: 10..63
NoneNo IPR availablePANTHERPTHR24393FAMILY NOT NAMEDcoord: 10..63
coord: 192..323
NoneNo IPR availablePANTHERPTHR24393:SF69MDS1 AND EVI1 COMPLEX LOCUS PROTEINcoord: 192..323
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 13..63
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 242..290
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 281..323