Trig-1 protein

Overview
NameTrig-1 protein
Smed IDSMED30027157
Length (bp)1103
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027157

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30027157SMESG000049582.1 SmedASXL_019168SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30027157SMESG000049582.1 dd_Smed_v4_2184_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30027157SMESG000049582.1 Contig39031newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30027157SMESG000049582.1 Contig39031uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Trig-1 protein vs. TrEMBL
Match: A0A5P8I4P2 (Trig-1 protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 326/326 (100.00%), Postives = 326/326 (100.00%), Query Frame = 1
Query:   85 MKLLLLIIVLSAIGIICKDSEQDLWQIVSEELKEKRAIGLPKDLTLTGADFYEENLKFQTNPKSVSSSADSIQNDGKFNSENGIMFKPSETPIVLDVVLPRNKSNVCGLLIRPGKNGKDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFNLTISANNENKVLIIDPVPAEELKLILHADKEKGSSIRLSVMHNCQYSPTMKISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPICWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPGITFSRVYYDYTNSESEKNPESSTKAN 1062
            MKLLLLIIVLSAIGIICKDSEQDLWQIVSEELKEKRAIGLPKDLTLTGADFYEENLKFQTNPKSVSSSADSIQNDGKFNSENGIMFKPSETPIVLDVVLPRNKSNVCGLLIRPGKNGKDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFNLTISANNENKVLIIDPVPAEELKLILHADKEKGSSIRLSVMHNCQYSPTMKISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPICWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPGITFSRVYYDYTNSESEKNPESSTKAN
Sbjct:    1 MKLLLLIIVLSAIGIICKDSEQDLWQIVSEELKEKRAIGLPKDLTLTGADFYEENLKFQTNPKSVSSSADSIQNDGKFNSENGIMFKPSETPIVLDVVLPRNKSNVCGLLIRPGKNGKDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFNLTISANNENKVLIIDPVPAEELKLILHADKEKGSSIRLSVMHNCQYSPTMKISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPICWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPGITFSRVYYDYTNSESEKNPESSTKAN 326          
BLAST of Trig-1 protein vs. TrEMBL
Match: A0A5J6BUC9 (Adhesive organ protein 1 OS=Minona ileanae OX=60013 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 3.975e-39
Identity = 83/235 (35.32%), Postives = 122/235 (51.91%), Query Frame = 1
Query:  343 KPSETPIVLDVVLPRNKSNVCGLLIRPGKNG-KDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFNLTISANNENKVLIIDPVPAEE--LKLILHADKEKGSSIRLSVMHNCQYSPTMKISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPICWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPGITFSRVYYDYTNSESEKN 1038
            KP   P ++ ++LPR   +VCG+LI    N  K  + + EI W+      ++++  P TG+  FN  +S  NE + +  D VPA+   +KL    D+     IR++ +H+C Y  T  +SDC E  + N +        P+S+ CP  C     C G+KVYS+ S IC++A   FG   DG Y LY I  V  F  + DP+LN+  +CR S+    G TF R  YD  N E E +
Sbjct:   83 KPKGQPQLIKLMLPRTPVDVCGVLIGGVNNTEKFYVDSFEIHWRSDLGMKFDMLTDPKTGNSIFNTKLSKKNEFRAIFFDSVPAKYFIMKLFYKGDR---PGIRITFIHSCYYPNTKFLSDCGEKLDHNSRFDFLPVGTPISIKCPIDCILYRQCWGYKVYSSDSAICYSAVHAFGRYADGLYTLYKIANVSRFIYQPDPSLNHKAYCRGSSVQHSGFTFERRLYDEANKEYESH 314          
BLAST of Trig-1 protein vs. Planmine SMEST
Match: SMESG000049582.1 (SMESG000049582.1)

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 325/326 (99.69%), Postives = 326/326 (100.00%), Query Frame = 1
Query:   85 MKLLLLIIVLSAIGIICKDSEQDLWQIVSEELKEKRAIGLPKDLTLTGADFYEENLKFQTNPKSVSSSADSIQNDGKFNSENGIMFKPSETPIVLDVVLPRNKSNVCGLLIRPGKNGKDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFNLTISANNENKVLIIDPVPAEELKLILHADKEKGSSIRLSVMHNCQYSPTMKISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPICWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPGITFSRVYYDYTNSESEKNPESSTKAN 1062
            MKLLLLIIVLSAIGIICKDSEQDLWQIVSEELKEKRAIGLPKDLTLTGADFYEENLKFQTNPKSVSSSADSIQNDGKFNSENGIMFKPSETPIVLDVVLPRNKSNVCGLLIRPGKNGKDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFNLT+SANNENKVLIIDPVPAEELKLILHADKEKGSSIRLSVMHNCQYSPTMKISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPICWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPGITFSRVYYDYTNSESEKNPESSTKAN
Sbjct:    1 MKLLLLIIVLSAIGIICKDSEQDLWQIVSEELKEKRAIGLPKDLTLTGADFYEENLKFQTNPKSVSSSADSIQNDGKFNSENGIMFKPSETPIVLDVVLPRNKSNVCGLLIRPGKNGKDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFNLTLSANNENKVLIIDPVPAEELKLILHADKEKGSSIRLSVMHNCQYSPTMKISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPICWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPGITFSRVYYDYTNSESEKNPESSTKAN 326          
BLAST of Trig-1 protein vs. Planmine SMEST
Match: SMESG000049720.1 (SMESG000049720.1)

HSP 1 Score: 197.978 bits (502), Expect = 2.469e-60
Identity = 113/323 (34.98%), Postives = 171/323 (52.94%), Query Frame = 1
Query:   79 SKMKLLLLIIVLSAIGIICKDSEQDL------WQIVSEELKEKRAIGLPKDLTLTGADFYEENLKFQTNPKSVSSSADSIQNDGKFNSENGIMFKPS-ETPIVLDVVLP--RNKSNVCGLLIRPGKN-GKDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFNLTISANNENKVLIIDPVPAEELKLILHADKEKGSSIRLSVMHNCQYSPTMKISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPICWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPGITFSRVYYDYT 1017
            S+  L +  I+L A+     +  +D       +++V  E+   R +G+ K++  +  D     LK+  +P  +    +   N     + NG+  K +   PI L V LP  + + NVCGL+I    + G + I  + ++W+  S+ PW+L+A PT G+  + L +  N   +V+I D +PA +  L+L     K  + +L+ + NC+Y  T+ I DC E  ++N + QN   E P+S+ CP  C  S  C GFKVYST SPICWAA Q FG  GDG Y +Y I     F SE++P LN+G+FCR S       TF R YYD T
Sbjct:    2 SRYSLSVFFILLFAVQFSRVEPHKDWLKWFKAFKLVKVEMLSGRTLGIHKNIP-SSFDIVMNGLKYGIDPSILVDPVNHGPNKADLINGNGLTLKGNFLNPITLTVGLPVLKKQQNVCGLVITSLNDAGNEFIFNMRLMWQADSRIPWDLIANPTNGEYEYYLRMRPNLNTRVVIFDSIPALKFMLMLTTIPGKNVNFKLAFLRNCRYKNTINIVDCSEKIDSNPRFQNLPFEVPISIKCPVNCIRSWPCWGFKVYSTDSPICWAATQNFGRWGDGYYTVYKIQAAAAFNSELNPLLNHGVFCRKSILEYQAFTFDRKYYDMT 323          
The following BLAST results are available for this feature:
BLAST of Trig-1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A5P8I4P20.000e+0100.00Trig-1 protein OS=Schmidtea mediterranea OX=79327 ... [more]
A0A5J6BUC93.975e-3935.32Adhesive organ protein 1 OS=Minona ileanae OX=6001... [more]
back to top
BLAST of Trig-1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Trig-1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000049582.10.000e+099.69SMESG000049582.1[more]
SMESG000049720.12.469e-6034.98SMESG000049720.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027157 ID=SMED30027157|Name=Trig-1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1103bp
TGGTAATTAAGCGCCAGATGGGGTCGAAAAGCGTATAAAGGCTGCCACAG
AAATCTGTTAATTGTCTATGAGTAGCGATCAAAAATGAAACTTTTGTTAT
TAATAATTGTGTTGAGTGCAATCGGGATAATTTGCAAAGATTCGGAACAA
GATTTGTGGCAAATCGTATCTGAAGAATTGAAAGAAAAACGCGCAATTGG
ACTTCCGAAAGATCTTACTTTGACTGGCGCGGATTTTTACGAGGAAAATC
TAAAATTCCAAACCAATCCGAAATCAGTTTCAAGCTCTGCCGACAGCATT
CAGAATGATGGAAAGTTCAATTCGGAAAATGGGATAATGTTCAAGCCGAG
TGAAACACCAATTGTTCTTGACGTGGTTTTACCACGAAATAAAAGTAATG
TTTGTGGTTTATTAATTAGACCAGGAAAGAACGGAAAAGATGTTATTAAA
ACTATTGAAATAATATGGAAAGGTTCATCAAAAGGTCCCTGGAATCTTGT
AGCAGTCCCAACAACAGGGGATCTAGGATTTAATCTCACTATTTCTGCAA
ATAATGAAAATAAAGTTTTAATCATTGATCCGGTGCCTGCTGAAGAATTG
AAGCTTATCCTACATGCGGACAAAGAAAAAGGTTCAAGCATCCGGCTGTC
AGTAATGCACAACTGCCAATATTCTCCAACAATGAAGATTAGCGATTGTC
TCGAATCATTTGAAACGAATGAAAAATTGCAGAATTCTCAAACCGAAGGA
CCGGTAAGTGTTTCTTGCCCGACGACCTGCAACTCATCTTCGGTTTGTGT
CGGCTTCAAAGTTTATTCAACAGCGAGTCCAATTTGTTGGGCAGCTCACC
AGGTGTTCGGTAGCAACGGAGACGGAAATTATTTCCTCTACGTAATACCA
AGAGTTCCGTTTTTCAAATCGGAAGTCGACCCAACCTTGAACAATGGAAT
TTTTTGTCGAAGCTCCAATCAAGCAAGTCCTGGAATCACTTTCAGCCGGG
TTTATTACGATTACACAAACAGTGAAAGTGAAAAAAATCCAGAAAGTAGC
ACAAAAGCAAACTGATACTTTATTGTTGGTGCTTCAATAAATATAATTAT
TTA
back to top

protein sequence of SMED30027157-orf-1

>SMED30027157-orf-1 ID=SMED30027157-orf-1|Name=SMED30027157-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=327bp
MKLLLLIIVLSAIGIICKDSEQDLWQIVSEELKEKRAIGLPKDLTLTGAD
FYEENLKFQTNPKSVSSSADSIQNDGKFNSENGIMFKPSETPIVLDVVLP
RNKSNVCGLLIRPGKNGKDVIKTIEIIWKGSSKGPWNLVAVPTTGDLGFN
LTISANNENKVLIIDPVPAEELKLILHADKEKGSSIRLSVMHNCQYSPTM
KISDCLESFETNEKLQNSQTEGPVSVSCPTTCNSSSVCVGFKVYSTASPI
CWAAHQVFGSNGDGNYFLYVIPRVPFFKSEVDPTLNNGIFCRSSNQASPG
ITFSRVYYDYTNSESEKNPESSTKAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036609LCCL_sf
IPR004043LCCL
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004043LCCL domainPFAMPF03815LCCLcoord: 205..254
e-value: 2.4E-5
score: 24.4
IPR036609LCCL domain superfamilyGENE3DG3DSA:2.170.130.20coord: 205..304
e-value: 5.3E-5
score: 25.0
IPR036609LCCL domain superfamilySUPERFAMILYSSF69848LCCL domaincoord: 222..304
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.66