Dynamin-1-like protein

Overview
NameDynamin-1-like protein
Smed IDSMED30027152
Length (bp)2058
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin-1-like protein (SMED30027152) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin-1-like protein (SMED30027152) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-1-like protein (SMED30027152) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-1-like protein (SMED30027152) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027152

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027152 dd_Smed_v4_1818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027152 SMED30027152smed_20140614PMID:24950970
Talbot et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 295/540 (54.63%), Postives = 393/540 (72.78%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY---------TPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKHPHKKLAQNNDISIHEDEHAR 1659
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++         T   N     E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++   +LA+    ++  D+ ++
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRN---RLARELPSAVSRDKSSK 535          

HSP 2 Score: 107.457 bits (267), Expect = 1.651e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  636 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 735          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 295/540 (54.63%), Postives = 393/540 (72.78%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY---------TPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKHPHKKLAQNNDISIHEDEHAR 1659
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++         T   N     E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++   +LA+    ++  D+ ++
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRN---RLARELPSAVSRDKSSK 535          

HSP 2 Score: 107.457 bits (267), Expect = 1.674e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  625 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 724          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 296/539 (54.92%), Postives = 392/539 (72.73%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY---------TPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKHPHKKLAQNNDISIHEDEHA 1656
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++         T   N     E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++   +LA+    ++  D+ A
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRN---RLARELPSAVSRDKVA 534          

HSP 2 Score: 107.071 bits (266), Expect = 2.077e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  599 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 698          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 292/520 (56.15%), Postives = 383/520 (73.65%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY---------TPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKH 1599
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++         T   N     E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRN 518          

HSP 2 Score: 107.071 bits (266), Expect = 2.303e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  610 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 709          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 296/553 (53.53%), Postives = 394/553 (71.25%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY---------TPINNDGG-------------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKHPHKKLAQNNDISIHEDEHAR 1659
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++         T   ND                 E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++   +LA+    ++  D+ ++
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRN---RLARELPSAVSRDKSSK 548          

HSP 2 Score: 107.842 bits (268), Expect = 1.559e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  638 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 737          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 322/709 (45.42%), Postives = 463/709 (65.30%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSI--EKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGG---------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCG--THREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGA-------------YGKSMDHHGK---------------------------------------------------HPHKKLAQNNDISIHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+NLIPV+NKL DVF+++  +++ I+LPQIVV+GSQSAGKSSVLEN+VG DFLPRG GIVTR P+ILQL +  ++++             ++  F HT  K+F DF+ +++EIE +T+ + G  K +   PI+LKI+SH+V++L+LVDLPGITK+PV DQP +IE++IR + + Y    +SI+L+V+ AN D A SE +KLA  +D  G RT  +LTKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ +I + K I ++++ E  F +K YP+LA +NGTPYL+KRLN LLM HI++ LP LK  ++I   QC  +L A+G  V++K   L++IIT F  AY + I+G ++NI T+ELCGGARI YIF+  F ++++ ++ L NL    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQR++Q+CG  T +EM RFP+L +KI  VV+ +L++R +PTNE+V NLV IELA+IN KHP+F  +               +G+S + H                                                      P +K + N    + E +  R+   +  ++ RD  +IE LI++YF +VRK I+D VPK IM  LVN++++NLQ +LV ++    ++D+LL E  D AQRR++  + ++ L++A+ IISE+RETQ+
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGK--VIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEANLVTLLKEELLLDDRHGRSRNRHASTGERAQLQPVPGVNGVDLNAVLQQQQQQSQNQRASNGFLGLFGNAAASSKTSPQEKQSANFLPEVPETQLGRK---LTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEVRETQV 704          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 322/709 (45.42%), Postives = 463/709 (65.30%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSI--EKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGG---------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCG--THREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGA-------------YGKSMDHHGK---------------------------------------------------HPHKKLAQNNDISIHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+NLIPV+NKL DVF+++  +++ I+LPQIVV+GSQSAGKSSVLEN+VG DFLPRG GIVTR P+ILQL +  ++++             ++  F HT  K+F DF+ +++EIE +T+ + G  K +   PI+LKI+SH+V++L+LVDLPGITK+PV DQP +IE++IR + + Y    +SI+L+V+ AN D A SE +KLA  +D  G RT  +LTKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ +I + K I ++++ E  F +K YP+LA +NGTPYL+KRLN LLM HI++ LP LK  ++I   QC  +L A+G  V++K   L++IIT F  AY + I+G ++NI T+ELCGGARI YIF+  F ++++ ++ L NL    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQR++Q+CG  T +EM RFP+L +KI  VV+ +L++R +PTNE+V NLV IELA+IN KHP+F  +               +G+S + H                                                      P +K + N    + E +  R+   +  ++ RD  +IE LI++YF +VRK I+D VPK IM  LVN++++NLQ +LV ++    ++D+LL E  D AQRR++  + ++ L++A+ IISE+RETQ+
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGK--VIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEANLVTLLKEELLLDDRHGRSRNRHASTGERAQLQPVPGVNGVDLNAVLQQQQQQSQNQRASNGFLGLFGNAAASSKTSPQEKQSANFLPEVPETQLGRK---LTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEVRETQV 704          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 322/709 (45.42%), Postives = 463/709 (65.30%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSI--EKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGG---------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCG--THREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGA-------------YGKSMDHHGK---------------------------------------------------HPHKKLAQNNDISIHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+NLIPV+NKL DVF+++  +++ I+LPQIVV+GSQSAGKSSVLEN+VG DFLPRG GIVTR P+ILQL +  ++++             ++  F HT  K+F DF+ +++EIE +T+ + G  K +   PI+LKI+SH+V++L+LVDLPGITK+PV DQP +IE++IR + + Y    +SI+L+V+ AN D A SE +KLA  +D  G RT  +LTKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ +I + K I ++++ E  F +K YP+LA +NGTPYL+KRLN LLM HI++ LP LK  ++I   QC  +L A+G  V++K   L++IIT F  AY + I+G ++NI T+ELCGGARI YIF+  F ++++ ++ L NL    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQR++Q+CG  T +EM RFP+L +KI  VV+ +L++R +PTNE+V NLV IELA+IN KHP+F  +               +G+S + H                                                      P +K + N    + E +  R+   +  ++ RD  +IE LI++YF +VRK I+D VPK IM  LVN++++NLQ +LV ++    ++D+LL E  D AQRR++  + ++ L++A+ IISE+RETQ+
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGK--VIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEANLVTLLKEELLLDDRHGRSRNRHASTGERAQLQPVPGVNGVDLNAVLQQQQQQSQNQRASNGFLGLFGNAAASSKTSPQEKQSANFLPEVPETQLGRK---LTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEVRETQV 704          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 530.02 bits (1364), Expect = 3.277e-180
Identity = 276/558 (49.46%), Postives = 391/558 (70.07%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSI--EKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGG---------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCG--THREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKSM------DHHGKHPHKKLAQN-NDISIHEDEHARRYENMNDKDM 1689
            M+NLIPV+NKL DVF+++  +++ I+LPQIVV+GSQSAGKSSVLEN+VG DFLPRG GIVTR P+ILQL +  ++++             ++  F HT  K+F DF+ +++EIE +T+ + G  K +   PI+LKI+SH+V++L+LVDLPGITK+PV DQP +IE++IR + + Y    +SI+L+V+ AN D A SE +KLA  +D  G RT  +LTKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ +I + K I ++++ E  F +K YP+LA +NGTPYL+KRLN LLM HI++ LP LK  ++I   QC  +L A+G  V++K   L++IIT F  AY + I+G ++NI T+ELCGGARI YIF+  F ++++ ++ L NL    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQR++Q+CG  T +EM RFP+L +KI  VV+ +L++R +PTNE+V NLV IELA+IN KHP+F  +             D HG+  ++  +     +S H ++  +    +N  D+
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGK--VIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEANLVTLLKEELLLDDRHGRSRNRHASTGERAVSAHGEQQLQPVPGVNGVDL 556          

HSP 2 Score: 105.916 bits (263), Expect = 2.230e-23
Identity = 52/137 (37.96%), Postives = 87/137 (63.50%), Query Frame = 1
Query: 1561 GAYGKSMDHHGKHPHKKLAQNNDISIHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            G +G +       P +K + N    + E +  R+   +  ++ RD  +IE LI++YF +VRK I+D VPK IM  LVN++++NLQ +LV ++    ++D+LL E  D AQRR++  + ++ L++A+ IISE+RETQ+
Sbjct:  578 GLFGNAAASSKTSPQEKQSANFLPEVPETQLGRK---LTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEVRETQV 711          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 530.02 bits (1364), Expect = 3.277e-180
Identity = 276/558 (49.46%), Postives = 391/558 (70.07%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSI--EKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGG---------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCG--THREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKSM------DHHGKHPHKKLAQN-NDISIHEDEHARRYENMNDKDM 1689
            M+NLIPV+NKL DVF+++  +++ I+LPQIVV+GSQSAGKSSVLEN+VG DFLPRG GIVTR P+ILQL +  ++++             ++  F HT  K+F DF+ +++EIE +T+ + G  K +   PI+LKI+SH+V++L+LVDLPGITK+PV DQP +IE++IR + + Y    +SI+L+V+ AN D A SE +KLA  +D  G RT  +LTKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ +I + K I ++++ E  F +K YP+LA +NGTPYL+KRLN LLM HI++ LP LK  ++I   QC  +L A+G  V++K   L++IIT F  AY + I+G ++NI T+ELCGGARI YIF+  F ++++ ++ L NL    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQR++Q+CG  T +EM RFP+L +KI  VV+ +L++R +PTNE+V NLV IELA+IN KHP+F  +             D HG+  ++  +     +S H ++  +    +N  D+
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGK--VIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEANLVTLLKEELLLDDRHGRSRNRHASTGERAVSAHGEQQLQPVPGVNGVDL 556          

HSP 2 Score: 105.916 bits (263), Expect = 2.230e-23
Identity = 52/137 (37.96%), Postives = 87/137 (63.50%), Query Frame = 1
Query: 1561 GAYGKSMDHHGKHPHKKLAQNNDISIHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            G +G +       P +K + N    + E +  R+   +  ++ RD  +IE LI++YF +VRK I+D VPK IM  LVN++++NLQ +LV ++    ++D+LL E  D AQRR++  + ++ L++A+ IISE+RETQ+
Sbjct:  578 GLFGNAAASSKTSPQEKQSANFLPEVPETQLGRK---LTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEVRETQV 711          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: Drp1 (gene:FBgn0026479 transcript:FBtr0077744)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 296/524 (56.49%), Postives = 387/524 (73.85%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPI---------NNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCG--THREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKSMDHHGKHPHKKL 1614
            M+ LIPVINKL DVF+++  + I+LPQIVV+GSQS+GKSSV+E++VG  FLPRG GIVTR P++LQLIY+P+         N      E+G+FLHTK K F DF+EI++EIE +TE  AGS K +  +PINLKIFS  V+NLTLVDLPGITK+PV DQPEDIE +I+ L +KY +  NSI+L+V++AN D+A SE+LKLA  +DPDG RT  ++TKLDLMD GTDA DIL G   +   KLG+IGV+NRSQ DI ++K I + ++ EA F ++ YP+LA +NGTPYL+K LN LLM HI+  LP+LKT +NI   Q    L +YG +V +K + L++IIT F++AYC  I+G ++NI T+ELCGGAR+GYIF+  F +T+D I  L  L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++L+ +EMQRI+Q+CG    +EM RFPKL EKI++VVT LLR+R   TN MV N+V IELA+IN KHPDF    A   S+      P+ ++
Sbjct:    1 MEALIPVINKLQDVFNTVGSDSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTRRPLVLQLIYSPLDDRENRSAENGTSNAEEWGRFLHTK-KCFTDFDEIRKEIENETERAAGSNKGICPEPINLKIFSTHVVNLTLVDLPGITKVPVGDQPEDIEAQIKELVLKYIENPNSIILAVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGR--VIPVKLGIIGVMNRSQKDIMDQKHIDDQMKDEAAFLQRKYPTLATRNGTPYLAKTLNRLLMHHIRDCLPDLKTRVNIMATQFQSLLNSYGEDVSDKSQTLLQIITKFSSAYCCTIEGTARNIETTELCGGARMGYIFHETFGRTLDSIHPLAGLSKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELIHEEMQRIVQHCGNEVQQEMLRFPKLHEKIVDVVTQLLRRRLPHTNVMVENIVAIELAYINTKHPDFHKDAALVPSLLKTDSDPYSQI 521          

HSP 2 Score: 108.612 bits (270), Expect = 4.129e-24
Identity = 54/100 (54.00%), Postives = 72/100 (72.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            + DK+ +DC +IE+LIKSYF +VRK+I+D VPK IM FLVNY+K+NLQ +LV  +      + LL E+   A RRKE  D+L+ L +AN IISEIRET +
Sbjct:  635 LTDKEQKDCDVIEHLIKSYFYIVRKSIQDSVPKAIMHFLVNYVKDNLQSELVTHLYKSDKAETLLNESDHIAVRRKEAADMLKALTRANHIISEIRETHM 734          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: Drp1 (gene:FBgn0026479 transcript:FBtr0335173)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 296/524 (56.49%), Postives = 387/524 (73.85%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPI---------NNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCG--THREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKSMDHHGKHPHKKL 1614
            M+ LIPVINKL DVF+++  + I+LPQIVV+GSQS+GKSSV+E++VG  FLPRG GIVTR P++LQLIY+P+         N      E+G+FLHTK K F DF+EI++EIE +TE  AGS K +  +PINLKIFS  V+NLTLVDLPGITK+PV DQPEDIE +I+ L +KY +  NSI+L+V++AN D+A SE+LKLA  +DPDG RT  ++TKLDLMD GTDA DIL G   +   KLG+IGV+NRSQ DI ++K I + ++ EA F ++ YP+LA +NGTPYL+K LN LLM HI+  LP+LKT +NI   Q    L +YG +V +K + L++IIT F++AYC  I+G ++NI T+ELCGGAR+GYIF+  F +T+D I  L  L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++L+ +EMQRI+Q+CG    +EM RFPKL EKI++VVT LLR+R   TN MV N+V IELA+IN KHPDF    A   S+      P+ ++
Sbjct:    1 MEALIPVINKLQDVFNTVGSDSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTRRPLVLQLIYSPLDDRENRSAENGTSNAEEWGRFLHTK-KCFTDFDEIRKEIENETERAAGSNKGICPEPINLKIFSTHVVNLTLVDLPGITKVPVGDQPEDIEAQIKELVLKYIENPNSIILAVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGR--VIPVKLGIIGVMNRSQKDIMDQKHIDDQMKDEAAFLQRKYPTLATRNGTPYLAKTLNRLLMHHIRDCLPDLKTRVNIMATQFQSLLNSYGEDVSDKSQTLLQIITKFSSAYCCTIEGTARNIETTELCGGARMGYIFHETFGRTLDSIHPLAGLSKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELIHEEMQRIVQHCGNEVQQEMLRFPKLHEKIVDVVTQLLRRRLPHTNVMVENIVAIELAYINTKHPDFHKDAALVPSLLKTDSDPYSQI 521          

HSP 2 Score: 108.612 bits (270), Expect = 4.129e-24
Identity = 54/100 (54.00%), Postives = 72/100 (72.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            + DK+ +DC +IE+LIKSYF +VRK+I+D VPK IM FLVNY+K+NLQ +LV  +      + LL E+   A RRKE  D+L+ L +AN IISEIRET +
Sbjct:  635 LTDKEQKDCDVIEHLIKSYFYIVRKSIQDSVPKAIMHFLVNYVKDNLQSELVTHLYKSDKAETLLNESDHIAVRRKEAADMLKALTRANHIISEIRETHM 734          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301597)

HSP 1 Score: 387.497 bits (994), Expect = 2.441e-123
Identity = 219/504 (43.45%), Postives = 325/504 (64.48%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEI-IKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKN--------KKELLMEIITHFNAAYCNAIDGN-SKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            MD+LI ++NKL D F+S+   + + LPQI V+G QSAGKSSVLEN VG DFLPRG GIVTR P+ILQLI        G +EYG+FLH K K F  F+EI++EIE +T+ + GS K + + PINL+++S  VLNLTL+DLPG+TK+ + DQP DIE +I+ +  ++ +++  ++L+V+ AN DLANS++LKLA  +DP GVRT  ++TKLDLMD+GTDA+DIL     +   + G IGVVNRSQ DI  RK I ++L +E +FF  +  Y  +A + GTPYL + LN+ L  HI+ +LP L+     K+++ +L L+    E K+        K + ++++I    + +   I+G+ S  +NT+EL GGA+I  IF+      I ++        + I  AI+N  G R  LF P++ FE +VK QI+ L+EP + C+DLV+ E+  +++ C    +M+R+P+L E+   ++T  +RQR     E +  L+  ELA++N  H DF
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLI-------NGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDIL--ENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRD----KLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTA--KMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDF 489          

HSP 2 Score: 70.8626 bits (172), Expect = 2.576e-12
Identity = 38/132 (28.79%), Postives = 72/132 (54.55%), Query Frame = 1
Query: 1564 AYGKSMDHHGKHPHKKLAQNNDISIHEDEHARRYENMNDKDM-RDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            ++  S    G +P K+  Q N     +++ +   E+ +D  + R  + I NL+ SY  +V KT +D+VPK IM  ++N  K+ + G+L+  +    D  +++EE+A+ A RR+E+  +    + A  II ++
Sbjct:  611 SWKASFLRAGVYPEKQETQENGDEEGQEQKSASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDV 742          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074122)

HSP 1 Score: 386.726 bits (992), Expect = 3.467e-123
Identity = 219/504 (43.45%), Postives = 325/504 (64.48%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEI-IKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKN--------KKELLMEIITHFNAAYCNAIDGN-SKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            MD+LI ++NKL D F+S+   + + LPQI V+G QSAGKSSVLEN VG DFLPRG GIVTR P+ILQLI        G +EYG+FLH K K F  F+EI++EIE +T+ + GS K + + PINL+++S  VLNLTL+DLPG+TK+ + DQP DIE +I+ +  ++ +++  ++L+V+ AN DLANS++LKLA  +DP GVRT  ++TKLDLMD+GTDA+DIL     +   + G IGVVNRSQ DI  RK I ++L +E +FF  +  Y  +A + GTPYL + LN+ L  HI+ +LP L+     K+++ +L L+    E K+        K + ++++I    + +   I+G+ S  +NT+EL GGA+I  IF+      I ++        + I  AI+N  G R  LF P++ FE +VK QI+ L+EP + C+DLV+ E+  +++ C    +M+R+P+L E+   ++T  +RQR     E +  L+  ELA++N  H DF
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLI-------NGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDIL--ENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRD----KLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTA--KMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDF 489          

HSP 2 Score: 65.0846 bits (157), Expect = 1.880e-10
Identity = 39/131 (29.77%), Postives = 69/131 (52.67%), Query Frame = 1
Query: 1564 AYGKSMDHHGKHPHKKLAQNNDISIHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            ++  S    G +P K+  Q N      DE A    + + +  R  + I NL+ SY  +V KT +D+VPK IM  ++N  K+ + G+L+  +    D  +++EE+A+ A RR+E+  +    + A  II ++
Sbjct:  611 SWKASFLRAGVYPEKQETQENG-----DESASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDV 736          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074121)

HSP 1 Score: 386.726 bits (992), Expect = 3.467e-123
Identity = 219/504 (43.45%), Postives = 325/504 (64.48%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEI-IKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKN--------KKELLMEIITHFNAAYCNAIDGN-SKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            MD+LI ++NKL D F+S+   + + LPQI V+G QSAGKSSVLEN VG DFLPRG GIVTR P+ILQLI        G +EYG+FLH K K F  F+EI++EIE +T+ + GS K + + PINL+++S  VLNLTL+DLPG+TK+ + DQP DIE +I+ +  ++ +++  ++L+V+ AN DLANS++LKLA  +DP GVRT  ++TKLDLMD+GTDA+DIL     +   + G IGVVNRSQ DI  RK I ++L +E +FF  +  Y  +A + GTPYL + LN+ L  HI+ +LP L+     K+++ +L L+    E K+        K + ++++I    + +   I+G+ S  +NT+EL GGA+I  IF+      I ++        + I  AI+N  G R  LF P++ FE +VK QI+ L+EP + C+DLV+ E+  +++ C    +M+R+P+L E+   ++T  +RQR     E +  L+  ELA++N  H DF
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLI-------NGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDIL--ENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRD----KLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTA--KMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDF 489          

HSP 2 Score: 65.0846 bits (157), Expect = 1.880e-10
Identity = 39/131 (29.77%), Postives = 69/131 (52.67%), Query Frame = 1
Query: 1564 AYGKSMDHHGKHPHKKLAQNNDISIHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            ++  S    G +P K+  Q N      DE A    + + +  R  + I NL+ SY  +V KT +D+VPK IM  ++N  K+ + G+L+  +    D  +++EE+A+ A RR+E+  +    + A  II ++
Sbjct:  611 SWKASFLRAGVYPEKQETQENG-----DESASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDV 736          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:393896])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 346/692 (50.00%), Postives = 472/692 (68.21%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY--------TPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKH---------PHKKLA--------------------------------QNNDISIHEDEHARRY--------ENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIPVINKL DVF+++  +II+LPQI V+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++        T   N     E+GKFLHTK K++ DF+EI++EIE +TE ++G+ K + D+PI+LKIFS  V+NLTLVDLPGITK+PV DQP+DIE +IR L +KY    NSI+L+V++AN D+A SE+LK+A  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V++    L+++IT F   YCN I+G +K I T+ELCGGARI YIF+  F +T++ +D LG L    +LTAI+NA+GPR +LFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++         P  K+A                                Q++  +  +  HA             ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K++LQ +LV ++   + +D+LL E+ D AQRR E  D+L+ L+KA+ +I+EIRET L
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSEENGVDGEEWGKFLHTKNKIYTDFDEIRQEIENETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIELQIRELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGR--VIPVKLGLIGVVNRSQLDINNKKSVADSIRDEHGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLSAQYQSLLSSYGEPVEDMSATLLQLITKFATEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPTSVPRDKMAGGAQAEQEGGTGTWRGMLKKGDEGQGEEKTKLQSSIPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKPALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETHL 690          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: si:dkey-32e23.4 (si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-41])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 326/673 (48.44%), Postives = 453/673 (67.31%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPI--------NNDGG------------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKSMDHHGKHPHK--KLAQNNDISIHE-----------------DEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIP+IN+L +VF ++  EII+LPQIVV+GSQS+GKSSVLE++VG DFLPRG GIVTR P++LQL+  P         N +G               E+G FLH K ++F DFNEI++EIE +T+  + + K +  +PI LKI+S  VL+LTLVDLPGITK+PV DQPEDIE +++ + + Y    NS++L VS AN+DLA S++LKLA  +D DG RT  +++KLDLMD GTDA ++L G   +   +LG+IGVVNRSQ D+N +KS+S+S   E  F +++YPSLA + G+ YL++ L+ LLM HI+  LP LKT + +   Q    L +YG  V++    L++I+T F   YC+ I+G +++I TSELCGGAR+ YIF+  F +T+  ID LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +E+QRIIQ+C ++  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF  +     S++          K  +N  +   E                 D        ++ ++ RDC++I+ LIK YF +VRK+I+D VPKT+M FLVN++KE+LQ +LV ++  +  + ELL E+ + AQ+R E+  +LE L+KA+ IISEIRET L
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKQDNGNGSKQNSQNNYPGIKAEEWGTFLHCKNQIFTDFNEIRKEIEEETDR-STNNKGISKEPIYLKIYSPNVLSLTLVDLPGITKVPVGDQPEDIEIQVQEMILSYISNPNSLILCVSPANSDLATSDALKLAREVDADGRRTLLVVSKLDLMDAGTDALEVLLGR--VIPVRLGIIGVVNRSQHDLNTQKSLSDSCRDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLPELKTRVTVLTAQYQSRLNSYGQPVEDHSATLLQIVTKFATDYCSTIEGTARHIQTSELCGGARMCYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKKQIKRLEEPSLRCVELVHEELQRIIQHCSSYSTQELLRFPKLHDSIVEVVTGLLRKRLPITNEMVHNLVAIELAYINTKHPDFTDAAQVSASVNSQQAEAGDGGKRWKNEKMPSEEKGPMPGFGSPSKAINLLDTAVPVSRKLSSREQRDCEVIQRLIKCYFLIVRKSIQDSVPKTVMHFLVNFVKEHLQSELVGQLYKQPLLQELLIESQETAQQRTEVAHMLEALKKASNIISEIRETHL 670          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: si:dkey-32e23.4 (si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-41])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 326/673 (48.44%), Postives = 453/673 (67.31%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPI--------NNDGG------------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKSMDHHGKHPHK--KLAQNNDISIHE-----------------DEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIP+IN+L +VF ++  EII+LPQIVV+GSQS+GKSSVLE++VG DFLPRG GIVTR P++LQL+  P         N +G               E+G FLH K ++F DFNEI++EIE +T+  + + K +  +PI LKI+S  VL+LTLVDLPGITK+PV DQPEDIE +++ + + Y    NS++L VS AN+DLA S++LKLA  +D DG RT  +++KLDLMD GTDA ++L G   +   +LG+IGVVNRSQ D+N +KS+S+S   E  F +++YPSLA + G+ YL++ L+ LLM HI+  LP LKT + +   Q    L +YG  V++    L++I+T F   YC+ I+G +++I TSELCGGAR+ YIF+  F +T+  ID LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +E+QRIIQ+C ++  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF  +     S++          K  +N  +   E                 D        ++ ++ RDC++I+ LIK YF +VRK+I+D VPKT+M FLVN++KE+LQ +LV ++  +  + ELL E+ + AQ+R E+  +LE L+KA+ IISEIRET L
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKQDNGNGSKQNSQNNYPGIKAEEWGTFLHCKNQIFTDFNEIRKEIEEETDR-STNNKGISKEPIYLKIYSPNVLSLTLVDLPGITKVPVGDQPEDIEIQVQEMILSYISNPNSLILCVSPANSDLATSDALKLAREVDADGRRTLLVVSKLDLMDAGTDALEVLLGR--VIPVRLGIIGVVNRSQHDLNTQKSLSDSCRDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLPELKTRVTVLTAQYQSRLNSYGQPVEDHSATLLQIVTKFATDYCSTIEGTARHIQTSELCGGARMCYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKKQIKRLEEPSLRCVELVHEELQRIIQHCSSYSTQELLRFPKLHDSIVEVVTGLLRKRLPITNEMVHNLVAIELAYINTKHPDFTDAAQVSASVNSQQAEAGDGGKRWKNEKMPSEEKGPMPGFGSPSKAINLLDTAVPVSRKLSSREQRDCEVIQRLIKCYFLIVRKSIQDSVPKTVMHFLVNFVKEHLQSELVGQLYKQPLLQELLIESQETAQQRTEVAHMLEALKKASNIISEIRETHL 670          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:393896])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 290/524 (55.34%), Postives = 387/524 (73.85%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY--------TPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKHPHKKL 1614
            M+ LIPVINKL DVF+++  +II+LPQI V+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++        T   N     E+GKFLHTK K++ DF+EI++EIE +TE ++G+ K + D+PI+LKIFS  V+NLTLVDLPGITK+PV DQP+DIE +IR L +KY    NSI+L+V++AN D+A SE+LK+A  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V++    L+++IT F   YCN I+G +K I T+ELCGGARI YIF+  F +T++ +D LG L    +LTAI+NA+GPR +LFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++  ++L
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSEENGVDGEEWGKFLHTKNKIYTDFDEIRQEIENETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIELQIRELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGR--VIPVKLGLIGVVNRSQLDINNKKSVADSIRDEHGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLSAQYQSLLSSYGEPVEDMSATLLQLITKFATEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMREL 522          

HSP 2 Score: 106.301 bits (264), Expect = 2.505e-23
Identity = 51/100 (51.00%), Postives = 77/100 (77.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K++LQ +LV ++   + +D+LL E+ D AQRR E  D+L+ L+KA+ +I+EIRET L
Sbjct:  615 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKPALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETHL 714          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: dnm1a (dynamin 1a [Source:NCBI gene;Acc:100307098])

HSP 1 Score: 403.29 bits (1035), Expect = 2.932e-129
Identity = 222/499 (44.49%), Postives = 326/499 (65.33%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEI-IKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGN----EVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M++LIP++N++ D FS+I +   + LPQI V+G QSAGKSSVLEN VG DFLPRG GIVTR P++LQLI  P       +EY +FLH K K F DF+E+++EIE +T+ + G  K +   PINL+++S  VLNLTLVDLPG+TK+PV DQP DIE +I+++ +++  ++N +LL+VS AN+DLANS++LK+A  +DP G+RT  ++TKLDLMD+GTDA+DIL     +   + G IGVVNRSQ DI+ +K I+ ++ +E +FF  +  Y  LA + GTPYL K LN+ L  HI+ +LP L+ ++  ++     E++ Y N    +   K + L++++  F+  +   I+G+   I+T EL GGARI  IF+  F   + +++       K I  AI+N  G R  LF P+L FE +VK QI +L  P L CID+V+ E+   I+ C    ++A++P L E++  +VT  +R R   T   V  L+ IELA++N  H DF
Sbjct:    6 MEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCP-------TEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDIL--ENKLLPLRRGYIGVVNRSQKDIDGKKDINAAMAAERKFFLSHPSYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRAKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDLAFEAIVKKQIQKLNGPCLKCIDMVVSELTSTIRKCS--EKLAQYPMLREEMERIVTQHIRDRESRTKNQVLLLIDIELAYMNTNHEDF 493          

HSP 2 Score: 72.4034 bits (176), Expect = 1.235e-12
Identity = 41/136 (30.15%), Postives = 74/136 (54.41%), Query Frame = 1
Query: 1564 AYGKSMDHHGKHPHKKLAQNNDISIHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
             +  S    G +P + + +  + +  E+       +M+ +  R  + I NL+ SY  +V KT++DL+PKTIM  ++N  KE +  +L+  +    D + L+EE+A+ AQRR E+  +   L++A  II +I  T +
Sbjct:  614 GWKASFLRAGVYPERVVEKEKNDAGEENGSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLIPKTIMHLMINNTKEYINAELLASLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALNIIGDISTTTI 749          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 326/645 (50.54%), Postives = 444/645 (68.84%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPS--EYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF---DTSGAYGKSMDHHGKHPHKKLAQNNDISIHEDEHARR-----------------------YENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLE 1920
            M+ LIPVINKL DVF+++  ++I+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++   ++    S  E G        ++ DF+EI++EIE +TE I+G+ K +  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L ++Y    NSI+L+V++AN D+A SE+LK+A   DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V++K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF     +G  G  +   G    + + +     +  +E  R                           ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++     +++LL E+ D AQRRKE  D+L+
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGNVSARGSPIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGR--VIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADAAPAGNTGDGLPDAGTGNWRGMLKPKGEELPAEEKNRAPPALPASPLRGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLTESEDMAQRRKEAADMLK 643          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 327/712 (45.93%), Postives = 456/712 (64.04%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPS----------------------EYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKH--------PHKKLAQNNDIS---------------------IHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIK------DLVPKTIMCFLVNYIKENLQGKLVLEVLH----------ESD----------VDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIPVINKL DVF+++  ++I+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++   ++    S                      E+GKFLHTK K++ DF+EI++EIE +TE I+G+ K +  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L ++Y    NSI+L+V++AN D+A SE+LK+A   DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V++K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++        P +K A   +                       +  +E  R    +    +R   +  NL+     + RK         +++ + I  + +  +++N+Q  +   V+H          +S+          +++LL E+ D AQRRKE  D+L+ L++A+ II+EIRET L
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENDPNAWKIPKHFSKGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGR--VIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRIARELPPPREKAAPAGNTGDGLPDAGTGNWRGMLKPKGEELPAEEKNRAPPALPASPLRGHAV--NLLDVPVPVARKLSAREQRDCEVIERLIKSYFL-IVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLTESEDMAQRRKEAADMLKALQRASQIIAEIRETHL 707          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 287/503 (57.06%), Postives = 378/503 (75.15%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPS---------EYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIPVINKL DVF+++  ++I+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++   ++    S         E+GKFLHTK K++ DF+EI++EIE +TE I+G+ K +  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L ++Y    NSI+L+V++AN D+A SE+LK+A   DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V++K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGR--VIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDF 501          

HSP 2 Score: 89.7373 bits (221), Expect = 5.171e-18
Identity = 44/95 (46.32%), Postives = 68/95 (71.58%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++     +++LL E+ D AQRRKE  D+L+  + A+ +  EI
Sbjct:  611 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLTESEDMAQRRKEAADMLKPPKFAHSLYREI 705          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 289/509 (56.78%), Postives = 380/509 (74.66%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY--------TPINNDGGPS-------EYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIPVINKL DVF+++  ++I+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++        T  + +G  S       E+GKFLHTK K++ DF+EI++EIE +TE I+G+ K +  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L ++Y    NSI+L+V++AN D+A SE+LK+A   DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V++K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGNVSARGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGR--VIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDF 507          

HSP 2 Score: 87.4261 bits (215), Expect = 3.529e-17
Identity = 41/83 (49.40%), Postives = 62/83 (74.70%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLE 1920
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++     +++LL E+ D AQRRKE  D+L+
Sbjct:  617 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLTESEDMAQRRKEAADMLK 699          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 288/515 (55.92%), Postives = 379/515 (73.59%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTP--------------INNDGGP-------SEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIPVINKL DVF+++  ++I+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++                ++  G P        E+GKFLHTK K++ DF+EI++EIE +TE I+G+ K +  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L ++Y    NSI+L+V++AN D+A SE+LK+A   DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V++K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGNVSARGSPVQLGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGR--VIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDF 513          

HSP 2 Score: 105.531 bits (262), Expect = 6.604e-23
Identity = 51/100 (51.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++     +++LL E+ D AQRRKE  D+L+ L++A+ II+EIRET L
Sbjct:  634 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLTESEDMAQRRKEAADMLKALQRASQIIAEIRETHL 733          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 288/503 (57.26%), Postives = 376/503 (74.75%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY---------TPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG G+VTR P+ILQL++         T   N     E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LK+FS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDF 501          

HSP 2 Score: 107.457 bits (267), Expect = 1.250e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  599 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 698          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 289/526 (54.94%), Postives = 383/526 (72.81%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTP-------INNDGG--------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKH 1599
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG G+VTR P+ILQL++            + G          E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LK+FS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGKFQSWRVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRN 524          

HSP 2 Score: 107.071 bits (266), Expect = 1.380e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  616 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 715          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 289/516 (56.01%), Postives = 377/516 (73.06%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY---------TPINNDGG-------------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG G+VTR P+ILQL++         T   ND                 E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LK+FS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDF 514          

HSP 2 Score: 107.457 bits (267), Expect = 1.275e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  612 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 711          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 447.588 bits (1150), Expect = 3.542e-149
Identity = 233/421 (55.34%), Postives = 310/421 (73.63%), Query Frame = 1
Query:  346 LFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKH 1599
            L+ DF+EI++EIE +TE I+G+ K V  +PI+LK+FS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++
Sbjct:    2 LYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRN 420          

HSP 2 Score: 106.686 bits (265), Expect = 1.531e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  512 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 611          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 407.527 bits (1046), Expect = 6.743e-134
Identity = 203/359 (56.55%), Postives = 264/359 (73.54%), Query Frame = 1
Query:  496 ITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSG 1563
            +TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G
Sbjct:    1 MTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACG 357          

HSP 2 Score: 107.457 bits (267), Expect = 8.960e-24
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  487 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 586          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|Q7SXN5|DNM1L_DANRE (Dynamin-1-like protein OS=Danio rerio OX=7955 GN=dnm1l PE=2 SV=1)

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 346/692 (50.00%), Postives = 472/692 (68.21%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY--------TPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKH---------PHKKLA--------------------------------QNNDISIHEDEHARRY--------ENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIPVINKL DVF+++  +II+LPQI V+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++        T   N     E+GKFLHTK K++ DF+EI++EIE +TE ++G+ K + D+PI+LKIFS  V+NLTLVDLPGITK+PV DQP+DIE +IR L +KY    NSI+L+V++AN D+A SE+LK+A  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V++    L+++IT F   YCN I+G +K I T+ELCGGARI YIF+  F +T++ +D LG L    +LTAI+NA+GPR +LFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++         P  K+A                                Q++  +  +  HA             ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K++LQ +LV ++   + +D+LL E+ D AQRR E  D+L+ L+KA+ +I+EIRET L
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSEENGVDGEEWGKFLHTKNKIYTDFDEIRQEIENETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIELQIRELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGR--VIPVKLGLIGVVNRSQLDINNKKSVADSIRDEHGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLSAQYQSLLSSYGEPVEDMSATLLQLITKFATEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPTSVPRDKMAGGAQAEQEGGTGTWRGMLKKGDEGQGEEKTKLQSSIPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKPALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETHL 690          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|O00429|DNM1L_HUMAN (Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 295/540 (54.63%), Postives = 393/540 (72.78%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY---------TPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKHPHKKLAQNNDISIHEDEHAR 1659
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++         T   N     E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++   +LA+    ++  D+ ++
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRN---RLARELPSAVSRDKSSK 535          

HSP 2 Score: 107.457 bits (267), Expect = 7.930e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  636 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 735          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|Q2KIA5|DNM1L_BOVIN (Dynamin-1-like protein OS=Bos taurus OX=9913 GN=DNM1L PE=2 SV=1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 296/553 (53.53%), Postives = 394/553 (71.25%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY---------TPINNDGG-------------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKHPHKKLAQNNDISIHEDEHAR 1659
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++         T   ND                 E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LKIFS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++   +LA+    ++  D+ ++
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVAPEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRN---RLARELPSAVSRDKSSK 548          

HSP 2 Score: 107.842 bits (268), Expect = 6.303e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  649 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 748          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|Q8K1M6|DNM1L_MOUSE (Dynamin-1-like protein OS=Mus musculus OX=10090 GN=Dnm1l PE=1 SV=2)

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 287/509 (56.39%), Postives = 376/509 (73.87%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTP-------INNDGG--------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG G+VTR P+ILQL++            + G          E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LK+FS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGKFQSWRVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDF 507          

HSP 2 Score: 107.842 bits (268), Expect = 7.221e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  642 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 741          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|O35303|DNM1L_RAT (Dynamin-1-like protein OS=Rattus norvegicus OX=10116 GN=Dnm1l PE=1 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 294/553 (53.16%), Postives = 394/553 (71.25%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY---------TPINNDGG-------------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKHPHKKLAQNNDISIHEDEHAR 1659
            M+ LIPVINKL DVF+++  +II+LPQIVV+G+QS+GKSSVLE++VG D LPRG G+VTR P+ILQL++         T   ND                 E+GKFLHTK KL+ DF+EI++EIE +TE I+G+ K V  +PI+LK+FS  V+NLTLVDLPG+TK+PV DQP+DIE +IR L +++    NSI+L+V++AN D+A SE+LK++  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+KS+++S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F   YCN I+G +K I TSELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++   +LA+    ++  D+ ++
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRN---RLARELPSAVSRDKSSK 548          

HSP 2 Score: 107.842 bits (268), Expect = 7.524e-23
Identity = 53/100 (53.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++   S +D+LL E+ D AQRRKE  D+L+ L+ A+ II+EIRET L
Sbjct:  655 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHL 754          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: A0A095ALR2 (Dynamin-1-like protein OS=Schistosoma haematobium OX=6185 GN=MS3_03326 PE=3 SV=1)

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 357/696 (51.29%), Postives = 479/696 (68.82%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTP--------INNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-----------------------DTSGAY---------------------------------GKSMDHHGKHPHKKLAQNNDISIHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M++LIPVINKL DVF+++  E I+LPQIVV+G+QS+GKSSVLEN+VG DFLPRG GIVTR P++LQLI+             DG  +E+  FLHTK K++ DF+E++ EI+ +T+ +AG+GK V  +PINLKIFS +VLNLTLVDLPGITK+PV DQPEDIE  I +LC+ Y    NSI+L+V+ AN D+A SE LKLA ++DPDG RT CILTKLDLMD GTDA D+L G   +   KLG+IGVVNRSQADI   K+I E+L+ EA F ++ YPSLA +NGTP+L++ LN LLM HI+  LP+LKT +N+   Q    L  +G+E++++ +LL++IIT FN AYCN IDG +K+I T+ELCGGARI YIF+  F++T+ +ID LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+CG  +E+ RFPKL E+I++VVT++LRQR +PTN+MV+NLV +ELA+IN +HPDF                        T G++                                 G S D + ++ H  L+   DI     +H      +   +  DC++I  LI+SYF +VRK I+D VPK IM FLVN++K+NLQ +LV ++  + + + LL+E+   AQRR+E  ++L+ L+KA+ II EIRET L
Sbjct:    1 MESLIPVINKLQDVFNTVGSETIQLPQIVVLGTQSSGKSSVLENLVGRDFLPRGHGIVTRRPLVLQLIHVDESDHATRVAEGDGTSTEWATFLHTK-KIYRDFDEVRNEIKSETDRVAGAGKAVSSEPINLKIFSPRVLNLTLVDLPGITKVPVGDQPEDIETLINDLCLHYINNPNSIILAVTPANADMATSEGLKLAKTIDPDGRRTLCILTKLDLMDHGTDAHDLLLGR--VVPVKLGIIGVVNRSQADIKAGKNIDEALQDEASFLQRRYPSLASRNGTPFLARTLNRLLMHHIRDCLPDLKTRVNVMAAQFQNLLNTFGDEIEDRGQLLLQIITKFNTAYCNTIDGVAKDIETTELCGGARICYIFHETFYRTLSKIDPLGGLSTLDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELVHEEMQRIIQHCGAQQELLRFPKLHERIVDVVTSVLRQRLQPTNQMVTNLVAVELAYINTRHPDFLEALSTHRQQAPGLENLSLNDQPATQGSFSGSSLRTITASHLTRRLPGTLQHEEQPGSLNINGPSSDQNPENLHIGLSLTPDIQTEVQQH-----KLTPNERHDCEVIGKLIRSYFLIVRKNIQDTVPKAIMHFLVNFVKDNLQSELVGKLYKQDEYNTLLQESERVAQRRREASEMLKALQKASMIIGEIRETHL 688          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: A0A3R7DMF2 (Dynamin-1-like protein OS=Clonorchis sinensis OX=79923 GN=DNM1L PE=3 SV=1)

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 356/693 (51.37%), Postives = 473/693 (68.25%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTP--------INNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFD-------------------TSGAYGKSMDHHGKHPHKKLAQN--NDISIHED--------------------------------EHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M++LIPVINKL DVF+++  E I LPQI V+G+QS+GKSSVLEN+VG DFLPRGPGIVTR P++LQL+Y           + DG   E+ +FLH K+ +F +F ++++EI+ +T+  AGSGK +  +PINLKI+S KVLNLTLVDLPGITK+PV DQPEDIE  I  LCI+Y +  N I+L+V+ AN D+A SE LKLA  +DPDG RT CILTKLDLMD GTDA D+L G   +   KLG+IGVVNRSQADIN+ K+I E+L+SEA F ++ YPSLA +NGT  L++ LN LLM HI+  LP LKT +N+   Q    L  +G+EV++K +LL++IIT FN AYCN IDG +K+I T+ELCGGARI YIF+  F++T+  ID LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+CG  +E+ RFPKL E+I++VVT++LR R +PTN+MV+NLV IELA++N +HPDF                     S  +   ++H   +PH+ +  N   D+S                                    +   +   +   +  DC++I +LI+SYF +VRK I+D VPK IM FLVNY+K+NLQ +LV ++  +   D LL+E+   AQRR+E  D+L+ L+KA+ II EIRET L
Sbjct:    1 MESLIPVINKLQDVFNTVGTETIHLPQIAVLGTQSSGKSSVLENLVGRDFLPRGPGIVTRRPLVLQLVYVDESDTNTRIADGDGKSLEWARFLHRKD-IFTNFEDVRKEIKEETDSAAGSGKGISSEPINLKIYSPKVLNLTLVDLPGITKVPVADQPEDIETLINQLCIQYVQNPNCIILAVTPANTDMATSEGLKLAKMVDPDGRRTLCILTKLDLMDQGTDAHDLLLGR--VVPVKLGIIGVVNRSQADINSGKTIEEALQSEASFLQRRYPSLASRNGTQCLARTLNRLLMHHIRDCLPELKTRVNVMAAQFQNLLNTFGDEVEDKGQLLLQIITKFNTAYCNTIDGVAKDIETTELCGGARICYIFHKTFYRTLSRIDPLGGLSTLDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELVHEEMQRIIQHCGAQQELLRFPKLHERIVDVVTSVLRHRLQPTNQMVTNLVSIELAYVNTRHPDFSDVLSLHRLQSPRMDNLAIGDSTPFSGPLNHSAPNPHRPVGANPQADLSAQSSLNGPLTADTRMSSPSCDASGDVQKGLVLTPDIQTEVQQHKLTPNERHDCEVIGSLIRSYFLIVRKNIQDTVPKAIMHFLVNYVKDNLQSELVSKLYRQDQYDILLQESDRVAQRRREAADMLKALQKASQIIGEIRETHL 690          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: H2KT11 (Dynamin GTPase OS=Clonorchis sinensis OX=79923 GN=CLF_111236 PE=3 SV=1)

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 356/693 (51.37%), Postives = 473/693 (68.25%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTP--------INNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFD-------------------TSGAYGKSMDHHGKHPHKKLAQN--NDISIHED--------------------------------EHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M++LIPVINKL DVF+++  E I LPQI V+G+QS+GKSSVLEN+VG DFLPRGPGIVTR P++LQL+Y           + DG   E+ +FLH K+ +F +F ++++EI+ +T+  AGSGK +  +PINLKI+S KVLNLTLVDLPGITK+PV DQPEDIE  I  LCI+Y +  N I+L+V+ AN D+A SE LKLA  +DPDG RT CILTKLDLMD GTDA D+L G   +   KLG+IGVVNRSQADIN+ K+I E+L+SEA F ++ YPSLA +NGT  L++ LN LLM HI+  LP LKT +N+   Q    L  +G+EV++K +LL++IIT FN AYCN IDG +K+I T+ELCGGARI YIF+  F++T+  ID LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+CG  +E+ RFPKL E+I++VVT++LR R +PTN+MV+NLV IELA++N +HPDF                     S  +   ++H   +PH+ +  N   D+S                                    +   +   +   +  DC++I +LI+SYF +VRK I+D VPK IM FLVNY+K+NLQ +LV ++  +   D LL+E+   AQRR+E  D+L+ L+KA+ II EIRET L
Sbjct:    1 MESLIPVINKLQDVFNTVGTETIHLPQIAVLGTQSSGKSSVLENLVGRDFLPRGPGIVTRRPLVLQLVYVDESDTNTRIADGDGKSLEWARFLHRKD-IFTNFEDVRKEIKEETDRAAGSGKGISSEPINLKIYSPKVLNLTLVDLPGITKVPVADQPEDIETLINQLCIQYVQNPNCIILAVTPANTDMATSEGLKLAKMVDPDGRRTLCILTKLDLMDQGTDAHDLLLGR--VVPVKLGIIGVVNRSQADINSGKTIEEALQSEASFLQRRYPSLASRNGTQCLARTLNRLLMHHIRDCLPELKTRVNVMAAQFQNLLNTFGDEVEDKGQLLLQIITKFNTAYCNTIDGVAKDIETTELCGGARICYIFHKTFYRTLSRIDPLGGLSTLDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELVHEEMQRIIQHCGAQQELLRFPKLHERIVDVVTSVLRHRLQPTNQMVTNLVSIELAYVNTRHPDFSDVLSLHRLQSPRMDNLAIGDSTPFSGPLNHSAPNPHRPVGANPQADLSAQSSLNGPLTADTRMSSPSCDASGDVQKGLVLTPDIQTEVQQHKLTPNERHDCEVIGSLIRSYFLIVRKNIQDTVPKAIMHFLVNYVKDNLQSELVSKLYRQDQYDILLQESDRVAQRRREAADMLKALQKASQIIGEIRETHL 690          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: W6UQ74 (Dynamin-1-like protein OS=Echinococcus granulosus OX=6210 GN=EGR_01889 PE=3 SV=1)

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 361/682 (52.93%), Postives = 468/682 (68.62%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYT--------PINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-------------------------DTSGAYGKSMDHHGKHPHKKLAQNNDISIHEDE----------HAR-------RYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIPVINKL DVF+++  E ++LPQIVVIGSQS+GKSSVLENIVG DFLPRG GIVTR P++LQL++             DG  +E+ KFLH K ++F DF+ ++EEI ++T  + G+GK V  + I+LKI+S KVLNLTLVDLPGITK+PV DQPEDIE++I  LC+ Y    N I+L+V+ AN D+A SESLKLA  +DP+G RT C+LTKLDLMD GTDA D+L     +   KLG+IGVVNRSQADIN +KSI ++L  EA F ++ YPSLA +NGT YL+K LN LLM HI+  LP LKT +N+   Q    L ++G EV++K +LL++IIT FN AYCN IDG SK+I TSELCGGARI YIF+ +F  T+  ID LG L    ILTAI+N++GPR +LFVPE+ FELLVK QI RLEEPSL C++LV +EMQRIIQ+CGT +EM RFP L E+I++VVT+LLR+R +PTNEMV+NLV IELA+IN +HPDF                          T  A        G+ P+   AQ ++ ++ E +          HA        +   +   + RDC LI  LI+SYF +VRK I D VPK IM FLVNY+K+NLQ +LV  +    + D LL+E+ + AQRR+E  ++L+ L++AN IISE+RE  +
Sbjct:    1 METLIPVINKLQDVFNTVGSEALQLPQIVVIGSQSSGKSSVLENIVGRDFLPRGSGIVTRRPLVLQLVHVNEGEDVVRKEEGDGVSTEWAKFLHKKNEIFVDFDLVREEIMKETARLVGNGKMVSSEAIHLKIYSPKVLNLTLVDLPGITKVPVGDQPEDIENQINALCLHYICNPNCIILAVTPANADMATSESLKLAKEVDPEGRRTLCVLTKLDLMDHGTDAHDLLMNR--VVPVKLGIIGVVNRSQADINAKKSIIDALTYEASFLQRRYPSLASRNGTIYLTKTLNRLLMHHIRDCLPELKTRVNVMTAQFQTLLNSFGTEVEDKGQLLLQIITRFNTAYCNTIDGVSKDIETSELCGGARICYIFHEIFCSTLGRIDPLGGLNTLDILTAIRNSTGPRPALFVPEVAFELLVKRQIRRLEEPSLRCVELVHEEMQRIIQHCGTQQEMYRFPNLHERIVDVVTSLLRRRLQPTNEMVTNLVAIELAYINTRHPDFTEELMLHRQQAPPGLNNLALSDGPSQTQAARRTQQSAAGRRPNAVPAQRSNDALQEADSSDSANFSGFHAAPDIQTQVQQHQLTATEKRDCDLISQLIRSYFQIVRKNILDSVPKAIMNFLVNYVKDNLQSELVSSLYKIDEYDGLLKESENVAQRRREASEMLKGLQRANQIISEVREAPM 680          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: A0A267FQS5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006466g1 PE=3 SV=1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 365/683 (53.44%), Postives = 476/683 (69.69%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPIN--NDGG--PS----EYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKS------MDHH-GKH---------------------------PHKKLAQNN---------DISIHEDEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIPVINKL DVF+++  E I+LPQIVVIG+QS+GKSSVLE++VG DFLPRG GIVTR P++LQL++   +  ++ G  P+    E+GKFLHTK K++ DFNEI++EI R+T+ IAGSGKCV  DPINLKI+S  V++LTLVDLPGITK+PV DQPEDIE +IR LCI+Y K  NSI+L+V+ AN D+A SESLKLA  +DP G RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQADI N+K + E++  E+ F ++ YPSLA +NGTPYL++ LN LLM HI+  LP LKT +N+   Q    L ++G EV +K  LL++IIT F +AYC+ IDG SKNI  +ELCGGAR+ YIF+  F++T+ +ID +  L    ILTAI+N++GPR +LFVPE++FELLVK QI RLEEP L C++LV +E+QRIIQ+C + +EM RFPKL E+I++VVT+LLR R  PTN MV NLV +ELA+IN +HPDF  +    KS      +DH  GK                            P    A ++         DI  +    A R   ++ ++ RDC +IE LIKSYF +VRK I+D VPK IM FLVNY K+NLQ +LV ++     VD LL+E+   AQ R+E  D+L  L++A+ IISEIRETQL
Sbjct:    1 MEALIPVINKLQDVFNTVGSEAIQLPQIVVIGTQSSGKSSVLESLVGRDFLPRGTGIVTRRPLVLQLVHLEADEKDEAGDRPAAEEEEWGKFLHTKGKIYTDFNEIRDEIARETDRIAGSGKCVSIDPINLKIYSPHVVSLTLVDLPGITKVPVADQPEDIEVQIRALCIEYIKNPNSIILAVTPANTDMATSESLKLAKEVDPQGKRTLAVITKLDLMDAGTDAHDLLLGR--VIPVKLGIIGVVNRSQADIKNQKQVKEAVRDESSFLQRRYPSLASRNGTPYLARTLNRLLMHHIRDCLPELKTRVNVMAAQHQALLNSFGEEVADKGHLLLQIITRFASAYCSTIDGVSKNIEIAELCGGARVSYIFHETFYRTLSKIDPMQGLTTLEILTAIRNSTGPRPALFVPEISFELLVKRQIKRLEEPCLRCVELVHEELQRIIQHCSSQQEMLRFPKLYERIMDVVTSLLRTRLGPTNSMVQNLVAVELAYINTRHPDFTEAANLHKSISESLLLDHGPGKDGLVQQQQQQTPVHSVGSSASLAGVANGPGSGAASSDEAPGLNLLGDIPSNLTGAAVR---LSPREKRDCNIIERLIKSYFLIVRKNIQDSVPKAIMHFLVNYAKDNLQSELVSKLYKSEQVDSLLQESEHIAQSRQEAADMLAALQRASLIISEIRETQL 678          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: dnm1l (dynamin 1 like [Source:NCBI gene;Acc:103030788])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 348/703 (49.50%), Postives = 466/703 (66.29%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY--------TPINNDGGP------------SEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSG-------------------------AYGKSMDHHG--------------KHPHKKLAQNNDISIHEDE-HARRY--------ENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIPVINKL DVF+++  +II+LPQI V+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++        T   ND                E+GKFLHTK K++ DF+EI++EIE +TE ++G+ K + D+PI+LKIFS  V+NLTLVDLPGITK+PV DQP+DIE +IR L +KY    N I+L+V++AN D+A SE+LK+A  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DIN +KS+++++  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F A YCN I+G +K I T+ELCGGARI YIF+  F +T++ +D LG L    +LTAI+NA+GPR +LFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF D  G                         A G   D                   P  K  Q   +     + HA             ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K++LQ +LV ++   + +D+LL E+ D AQRR E  D+L+ L+KA+ +I+EIRET L
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSDENDPNAWKNGRLYKGVDGEEWGKFLHTKNKIYTDFDEIRQEIEAETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIEIQIRELILKYISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGR--VIPVKLGLIGVVNRSQLDINTKKSVADAIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLSSYGEPVDDKSATLLQLITKFAAEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPSAVPRDKAVGAQGDQEAGTGNWRGMLKKGEEGQPEDKFKQQGPLPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETHL 701          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: si:dkey-32e23.4 (dynamin-1-like protein [Source:NCBI gene;Acc:103036512])

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 325/660 (49.24%), Postives = 457/660 (69.24%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPI-----NNDGG--PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYG--------KSMDHHGKHPHKKLAQNNDISIHEDEHARRYENMND-----------KDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIP+IN+L +VF ++  EII+LPQIVV+GSQS+GKSSVLE++VG DFLPRG GIVTR P++LQL+  P       ++ G    E+G FLH K ++F DF+EI+ EIE +T+ +  + K +  +PI+LKIFS  VLNLTLVDLPGITK+PV DQPEDIE +++ + + +    NS++L VS AN+DLA S++LKLA  +DPDG R+  +++KLDLMD GTDA ++L G   +   +LG+IGVVNRSQ D+N +K++ ++   E  F +++YPSLA + G+ YL++ L+ LLM HI+  LP LKT + +   Q    L +YG  V++    L++I+T F + YCN I+G +++I TSELCGGARI YIF+  F +T+  ID LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +E+QRIIQ+C ++  +E+ RFPKL + I+ VVT LLR+R   TN+MV NLV+IELA+IN KHPDF  +            +S+D   K  ++K+   +   +       +  N+ D           ++ RDC++I+ LIK YF +VRK I+D VPKT+M FLVN++KE LQ +LV ++  +  + +LL E+ D AQ+R E+  +LE L+KAN IISEIRET L
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKHEHGIKAEEWGTFLHCKNQIFTDFSEIRSEIEAETDRVTNN-KGISPEPIHLKIFSPNVLNLTLVDLPGITKVPVGDQPEDIETQVQEMILSFISNPNSLILCVSPANSDLATSDALKLAREVDPDGRRSLLVVSKLDLMDAGTDALEVLLGR--VIPVRLGIIGVVNRSQHDLNTQKTVEDAARDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLPELKTRVTVLSAQYQTRLSSYGQPVEDHSATLLQIVTKFASDYCNTIEGTARHIQTSELCGGARICYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEELQRIIQHCSSYSTQELLRFPKLHDSIVEVVTTLLRKRLPITNDMVHNLVQIELAYINTKHPDFTDAAQVSASVNSQQTESLDGGRKWKNEKIPSEDKGPVPGFGSPSKAVNLLDTAVPISRKLSTREQRDCEVIQRLIKCYFLIVRKNIQDSVPKTVMHFLVNFVKERLQSELVGQLYKQPLLQDLLIESQDTAQQRTEVSQMLEALKKANNIISEIRETHL 657          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: si:dkey-32e23.4 (dynamin-1-like protein [Source:NCBI gene;Acc:103036512])

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 325/673 (48.29%), Postives = 458/673 (68.05%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPI--------NNDGGPS------------EYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYG--------KSMDHHGKHPHKKLAQNNDISIHEDEHARRYENMND-----------KDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIP+IN+L +VF ++  EII+LPQIVV+GSQS+GKSSVLE++VG DFLPRG GIVTR P++LQL+  P         + +G  +            E+G FLH K ++F DF+EI+ EIE +T+ +  + K +  +PI+LKIFS  VLNLTLVDLPGITK+PV DQPEDIE +++ + + +    NS++L VS AN+DLA S++LKLA  +DPDG R+  +++KLDLMD GTDA ++L G   +   +LG+IGVVNRSQ D+N +K++ ++   E  F +++YPSLA + G+ YL++ L+ LLM HI+  LP LKT + +   Q    L +YG  V++    L++I+T F + YCN I+G +++I TSELCGGARI YIF+  F +T+  ID LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +E+QRIIQ+C ++  +E+ RFPKL + I+ VVT LLR+R   TN+MV NLV+IELA+IN KHPDF  +            +S+D   K  ++K+   +   +       +  N+ D           ++ RDC++I+ LIK YF +VRK I+D VPKT+M FLVN++KE LQ +LV ++  +  + +LL E+ D AQ+R E+  +LE L+KAN IISEIRET L
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKHEHGNGTKANSQSSYPGIKAEEWGTFLHCKNQIFTDFSEIRSEIEAETDRVTNN-KGISPEPIHLKIFSPNVLNLTLVDLPGITKVPVGDQPEDIETQVQEMILSFISNPNSLILCVSPANSDLATSDALKLAREVDPDGRRSLLVVSKLDLMDAGTDALEVLLGR--VIPVRLGIIGVVNRSQHDLNTQKTVEDAARDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLPELKTRVTVLSAQYQTRLSSYGQPVEDHSATLLQIVTKFASDYCNTIEGTARHIQTSELCGGARICYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEELQRIIQHCSSYSTQELLRFPKLHDSIVEVVTTLLRKRLPITNDMVHNLVQIELAYINTKHPDFTDAAQVSASVNSQQTESLDGGRKWKNEKIPSEDKGPVPGFGSPSKAVNLLDTAVPISRKLSTREQRDCEVIQRLIKCYFLIVRKNIQDSVPKTVMHFLVNFVKERLQSELVGQLYKQPLLQDLLIESQDTAQQRTEVSQMLEALKKANNIISEIRETHL 670          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: si:dkey-32e23.4 (dynamin-1-like protein [Source:NCBI gene;Acc:103036512])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 315/669 (47.09%), Postives = 442/669 (66.07%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDG----------------GPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYG--------KSMDHHGKHPHKKLAQNNDISIHEDEHARRYENMND-----------KDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIP+IN+L +VF ++  EII+LPQIVV+GSQS+GKSSVLE++VG DFLPRG GIVTR P++LQL+  P   +                    E+G FLH K ++F             +  +      +  +PI+LKIFS  VLNLTLVDLPGITK+PV DQPEDIE +++ + + +    NS++L VS AN+DLA S++LKLA  +DPDG R+  +++KLDLMD GTDA ++L G   +   +LG+IGVVNRSQ D+N +K++ ++   E  F +++YPSLA + G+ YL++ L+ LLM HI+  LP LKT + +   Q    L +YG  V++    L++I+T F + YCN I+G +++I TSELCGGARI YIF+  F +T+  ID LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +E+QRIIQ+C ++  +E+ RFPKL + I+ VVT LLR+R   TN+MV NLV+IELA+IN KHPDF  +            +S+D   K  ++K+   +   +       +  N+ D           ++ RDC++I+ LIK YF +VRK I+D VPKT+M FLVN++KE LQ +LV ++  +  + +LL E+ D AQ+R E+  +LE L+KAN IISEIRET L
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKHEHVLFFTFCLQGIKAEEWGTFLHCKNQVF-----------IYSLMLTIRSFGISPEPIHLKIFSPNVLNLTLVDLPGITKVPVGDQPEDIETQVQEMILSFISNPNSLILCVSPANSDLATSDALKLAREVDPDGRRSLLVVSKLDLMDAGTDALEVLLGR--VIPVRLGIIGVVNRSQHDLNTQKTVEDAARDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLPELKTRVTVLSAQYQTRLSSYGQPVEDHSATLLQIVTKFASDYCNTIEGTARHIQTSELCGGARICYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEELQRIIQHCSSYSTQELLRFPKLHDSIVEVVTTLLRKRLPITNDMVHNLVQIELAYINTKHPDFTDAAQVSASVNSQQTESLDGGRKWKNEKIPSEDKGPVPGFGSPSKAVNLLDTAVPISRKLSTREQRDCEVIQRLIKCYFLIVRKNIQDSVPKTVMHFLVNFVKERLQSELVGQLYKQPLLQDLLIESQDTAQQRTEVSQMLEALKKANNIISEIRETHL 656          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: dnm1l (dynamin 1 like [Source:NCBI gene;Acc:103030788])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 289/524 (55.15%), Postives = 386/524 (73.66%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIY--------TPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF-DTSGAYGKSMDHHGKHPHKKL 1614
            M+ LIPVINKL DVF+++  +II+LPQI V+G+QS+GKSSVLE++VG D LPRG GIVTR P+ILQL++        T   N     E+GKFLHTK K++ DF+EI++EIE +TE ++G+ K + D+PI+LKIFS  V+NLTLVDLPGITK+PV DQP+DIE +IR L +KY    N I+L+V++AN D+A SE+LK+A  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DIN +KS+++++  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YG  V +K   L+++IT F A YCN I+G +K I T+ELCGGARI YIF+  F +T++ +D LG L    +LTAI+NA+GPR +LFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF D  G    +++   ++  ++L
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSDENGVDGEEWGKFLHTKNKIYTDFDEIRQEIEAETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIEIQIRELILKYISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGR--VIPVKLGLIGVVNRSQLDINTKKSVADAIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLSSYGEPVDDKSATLLQLITKFAAEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMREL 522          

HSP 2 Score: 106.301 bits (264), Expect = 2.010e-23
Identity = 51/100 (51.00%), Postives = 77/100 (77.00%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K++LQ +LV ++   + +D+LL E+ D AQRR E  D+L+ L+KA+ +I+EIRET L
Sbjct:  614 LSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETHL 713          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002816.1 (pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-1 gene:ENSPMAG00000002541.1 transcript:ENSPMAT00000002816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 291/516 (56.40%), Postives = 375/516 (72.67%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYT-------PINNDGGPS---------------EYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIPVINKL DVF+++  E I+LPQIVV+G+QS+GKSSVLE++VG DFLPRG GIVTR P++LQL++        P   + G +               E+GKFLHTK K++ DFNEI++EIE +TE I G+ K +  + I+LKIFS  VLNLTLVDLPGITK+PV DQP DIE +IR L IK+    NSI+L+V++AN DLA SE+LK+A  +D DG RT  ++TKLDLMD GTDA DILTG   +   KLG+IGVVNRSQ DIN +K+I ++++ E  F +K YPSLA++NGT +L K LN LLM HI+  LP LKT +N+   Q    L  YGN V +K   L++++T F A YCN I+G +K+I TSELCGGARI YIF+  F +T++ +D LG L    +LTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + I+ VVT LLR+R   +NEMV NLV IELA+IN KHPDF
Sbjct:    1 MEALIPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLESLVGRDFLPRGTGIVTRRPLVLQLVHVIPDERIRPGGEENGTASTAARLILFAGVEAEEWGKFLHTKNKVYSDFNEIRQEIENETERITGTNKGISSEAIHLKIFSPHVLNLTLVDLPGITKVPVGDQPVDIEQQIRELIIKFIGNPNSIILAVTAANTDLATSEALKIAREVDTDGRRTLAVITKLDLMDAGTDAMDILTGR--VIPVKLGIIGVVNRSQLDINTKKTILDAMQDEQSFMQKKYPSLANRNGTKFLGKTLNRLLMHHIRDCLPELKTRVNVMAAQYQSLLGGYGNPVDDKNATLLQLVTKFAAEYCNTIEGTAKHIETSELCGGARICYIFHETFGRTLESVDPLGGLTTLDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRRRLPVSNEMVHNLVAIELAYINTKHPDF 514          

HSP 2 Score: 93.9745 bits (232), Expect = 3.750e-20
Identity = 44/83 (53.01%), Postives = 64/83 (77.11%), Query Frame = 1
Query: 1672 MNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLE 1920
            ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+NLQ +LV ++  +  +DELL E+ D AQRRKE  D+L+
Sbjct:  664 LSAREQRDCEVIEKLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDNLQSELVGQLYKQQLLDELLTESEDMAQRRKEASDMLK 746          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006976.1 (pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1 gene:ENSPMAG00000006300.1 transcript:ENSPMAT00000006976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 345.51 bits (885), Expect = 8.333e-112
Identity = 191/451 (42.35%), Postives = 287/451 (63.64%), Query Frame = 1
Query:  217 HDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGN----EVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
             DFLPRG GIVTR P+ILQL++         +EY +FLH K K F DF E++ EIE +T+ + GS K +   PINL+++S  VLNLTL+DLPG+TK+PV DQP DIE +IR + +++  ++N ++L+VS AN DLANS++LK+A  +DP G+RT  ++TKLDLMDDGTDA+DIL     +   + G IGVVNRSQ DI+ RK I+ ++ +E +FF  +  Y  +A + GTPYL K LN+ L  HI+ +LP L+ ++  ++     E++ Y N    +   K + L++++  F   +   I+G+   I+T EL GGARI  IF+  F   + +++       + I  AI+N +G R  LF P+L FE +VK QI +L+EP L C+DLV+ E+  +I+ C    ++  +P+L +    +VT  +R+R   T + V  L+ I+LA++N  H DF
Sbjct:    1 RDFLPRGSGIVTRRPLILQLMFCK-------AEYAEFLHCKGKKFTDFEEVRAEIEAETDRLTGSNKGISPIPINLRVYSPHVLNLTLIDLPGMTKVPVGDQPVDIEYQIREMLMQFVTKENCLILAVSPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDDGTDARDIL--ENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLSHPSYRHMADRMGTPYLQKTLNQQLTNHIRDTLPALRNKLQGQMLSMEKEVEEYKNFRPDDPTRKTKALLQMVQQFAFDFEKRIEGSGDQIDTVELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIRNINGIRTGLFTPDLAFEAIVKKQIQKLKEPCLKCVDLVVGELTNVIRKCS--EKLGSYPRLRDDTDRIVTTYIREREGRTKDQVLLLIDIQLAYMNTNHEDF 440          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007915.1 (pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene:ENSPMAG00000007153.1 transcript:ENSPMAT00000007915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 326.25 bits (835), Expect = 5.986e-107
Identity = 161/297 (54.21%), Postives = 212/297 (71.38%), Query Frame = 1
Query:  667 GVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            G RT  +++KLDLMD GTDA D+L G   +   KLG++GVVNRSQ DIN  KS+S+SL  E  F ++ YP+LA+++GT  L+K LN LLM HI+  LP LK  +N+ + Q    L  YG  V +    L+ I+T F + YC+ I+G SK+I TSELCGGARI YIF+  F +T++ +  LG L    +LTAI+NA+GPR +LFVPE++FELLVK QI RLEEP L C++LV +EMQRI+Q+C  +  +E+ RFPKL + I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF
Sbjct:   10 GRRTLAVVSKLDLMDAGTDATDVLLGR--VVPVKLGIVGVVNRSQLDINKNKSVSDSLRDEDVFLQRKYPALANRSGTKNLAKTLNRLLMHHIRDCLPELKARVNMLVAQYQSLLSGYGEMVDDPSATLLSIVTKFASEYCHTIEGTSKHIETSELCGGARICYIFHETFGRTLESLHPLGGLTTMDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPGLRCVELVHEEMQRIVQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPFTNEMVHNLVAIELAYINTKHPDF 304          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 192.2 bits (487), Expect = 6.217e-53
Identity = 169/635 (26.61%), Postives = 297/635 (46.77%), Query Frame = 1
Query:  142 IKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSE-------YGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAH-QNG-----TPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDE--------IDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARF-PKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKSMDHHGKHPHKKLAQNNDISIHEDEH-----------ARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCII 1947
            + LP + VIG QS+GKSSVLE + G   LPRG GIVTRCP+ L+L   P     GP          G+ ++TK    E   +   + + +     G    V    I L++ S  V +LTL+DLPGI ++ +  Q  DIE +I++L   +  +Q +I L V   N D+A +E+LK+A ++DP GVRT  +LTK DLMD+GT+   +      +     G + V  RSQ D+   ++++E+   EA FF+K +P   H  NG     T  L+ +L E L+ +IK +LP L+ ++  K+++   EL++ G  + +      + I      Y + + G ++   +  L     +  +    F   + +        ++ L NL    I   I N SG     FV    FE L +  + RLE+P+L  + +   ++  +        ++ +F P+ +  +   V   ++ + +    ++  L ++E             S  Y + M          L QN+    H+ +H           +  + N+++    D  ++   ++SYF +    + D+VP  +   +++ +   L  +L   +  E ++ ELL E+ D  ++R+ + + +E L KA   I
Sbjct:   46 VGLPAVAVIGDQSSGKSSVLEALSGVQ-LPRGSGIVTRCPLALKLKRAP-----GPWHGRIKYRVQGRTINTKLDTPESVGDAVLQAQSEL---TGDDLGVSKSLIELEVTSDSVPDLTLIDLPGIARVALAGQAVDIETQIKDLIRDHIGRQETINLVVIPCNVDIATTEALKMAQAVDPTGVRTLGVLTKPDLMDEGTERNALRILQNQVFPLSKGYVLVKCRSQRDVEAHQTLAEASRVEAAFFKK-HPVFCHVHNGGKLTTTTVLAAKLTEELVDNIKRTLPKLRKDLAEKLREACAELESQGESIPDDARAKQQFINARVMRYNDDVRGLARGEPSRNLPRNMMLYTLVREHFRTWLKDLKRAQDAWLEELDNL----IREYIDNRSGRELPGFVSYHAFENLARVHVQRLEKPALNVLAVTCSKLSDVFMRLAD--DVFKFLPEFNRLVKAKVGAQVQGQEQKARVLIVTLFRME-------------SMVYTQDM----------LYQNSLREEHQQDHEVTEVTPFIFNSNNHPNLDE----DLDVMNKHLRSYFKIALMRLMDMVPMVVRFNMLDELVVALGAELT-ALAQEGNLAELLCEDEDAMEKRRMVMERVERLHKACATI 636          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 93.5893 bits (231), Expect = 5.373e-20
Identity = 79/277 (28.52%), Postives = 132/277 (47.65%), Query Frame = 1
Query:  145 KLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPG-IVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSL-----AHQNGTPYLSKRLNELLMKHIKSSL 957
            +LP++VV+G QS+GK+SVLE I      PRG G ++TR P+ + L   P +         +F  TKE   +D   +++EIE + ++    G  V  + I+L +    +  + LVDLPG+          D +D I  +   Y +  N+I+L +   + D   S    L  ++DP G RT  +LTK+DL +    + + +    + K F +  +G         N  +SI    + E +FF+K          AHQ  T  LS  +++   K ++ S+
Sbjct:  219 QLPRVVVVGDQSSGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVAIFKDSSREFDLTKE---DDLAALRKEIEIRMKKSVKEGHTVSAETISLSVKGPGLQRMVLVDLPGVISTMTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVDLAEKNLASPNRIQQILDGKLFPMKALGYFAVVTGKGNRDESIESIKDYEEEFFQKSKLCRSGMLKAHQVTTKNLSLAVSDCFWKMVRESV 492          
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Match: VPS1 (Dynamin-like GTPase required for vacuolar sorting; also involved in actin cytoskeleton organization, endocytosis, late Golgi-retention of some proteins, regulation of peroxisome biogenesis [Source:SGD;Acc:S000001709])

HSP 1 Score: 453.751 bits (1166), Expect = 2.414e-151
Identity = 271/705 (38.44%), Postives = 405/705 (57.45%), Query Frame = 1
Query:   79 DNLIPVINKLHDVFSSI---EKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLI--------YTPIN-------------------------NDG----GPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNE-VKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKSMDHHGKHPHK------------KLAQNNDISIHEDEHA------------------------RRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            ++LI  INKL D  + +    +  I LPQI V+GSQS+GKSSVLENIVG DFLPRG GIVTR P++LQLI        +  +N                         N+G       E+G+FLH   K F +F+EI++EI ++T+++ G+   +   PINL+I+S  VL LTLVDLPG+TK+PV DQP DIE +I+++ +KY  + N+I+LSV++AN DLANS+ LKLA  +DP+G RT  +LTK+DLMD GTD  DIL G   +   + G I V+NR Q DI ++K+I E+LE+E +FF  +  Y S AH  GTPYL+K+LN +L+ HI+ +LP +K +I   +K+   EL   G E + +   +++ +IT F+  Y   +DG +K +++ EL GGARI Y+F+  F   +D +D    +K   I T + N+SG   SLFV    FE+LVK QI R EEPSL  + LV DE+ R+++   +  + +R+P L E I N     L+    PTNE V +++K E  +IN  HPD    G+    M     HP +                ++   + E++                          +    M +++  + ++I+ LI SYF +V++TI D++PK +M  L+   K ++Q  L+ ++  + D++EL +EN    QRRKE K ++E LR A+ I+S +
Sbjct:    3 EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAG--RVIPLRYGYIPVINRGQKDIEHKKTIREALENERKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLKKYQNELINLGPETMDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVFHETFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPDL-LKGSQAMVMVEEKLHPRQVAVDPKTGKPLPTQPSSSKAPVMEEKSGFFGGFFSTKNKKKLAALESPPPVLKATGQMTERETMETEVIKLLISSYFSIVKRTIADIIPKALMLKLIVKSKTDIQKVLLEKLYGKQDIEELTKENDITIQRRKECKKMVEILRNASQIVSSV 704          
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Match: DNM1 (Dynamin-related GTPase involved in mitochondrial organization; required for mitochondrial fission and inheritance; self assembles on the cytoplasmic face of mitochondrial tubules at sites where division will occur; participates in endocytosis and regulates peroxisome fission along with Vps1p; mutants in the human ortholog DNM1L, which mediates mitochondrial fission, peroxisomal division, autophagy, and mitophagy, are associated with slowly progressive infantile encephalopathy [Source:SGD;Acc:S000003924])

HSP 1 Score: 437.573 bits (1124), Expect = 2.004e-144
Identity = 246/533 (46.15%), Postives = 343/533 (64.35%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQL----IYTPI----NNDGGP---------------------------SEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYG----NEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            +++LIP +NKL DV      + + LP + V+GSQS+GKSS+LE +VG DFLPRG GIVTR P++LQL      +P+    +N   P                            E+G+FLH   K F DF++IK EIE +T  IAG  K +   PINLK+FS  VLNLTLVDLPGITK+P+ +QP DIE +I+NL + Y    N ++L+VS AN DL NSESLKLA  +DP G RT  ++TKLDLMD GT+A DIL+G   +   KLG +GVVNRSQ DI   K++ ESL+ E  +FRK+  Y +++ + GT YL+K LN+ L+ HI+  LP++KT++N  I Q   EL  YG       +++  L+++++  F+  + ++IDG S +INT ELCGGARI YI+ ++F  ++  ID   NL    + TAI+N++GPR +LFVPEL F+LLVK QI  L EPS  C++LV +E+ +I   CG+  E+AR+PKL   +I V++ LLR+R +PT   V +L+ I  A+IN  HP+F
Sbjct:    4 LEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSG--KMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHKCGSA-ELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNF 533          

HSP 2 Score: 76.6406 bits (187), Expect = 6.235e-15
Identity = 49/140 (35.00%), Postives = 80/140 (57.14%), Query Frame = 1
Query: 1540 HPDFDTSGAYGKSMDHHGKHPHKKLAQNNDISIHE-DEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
             P FD S    +S+   G     +  Q +D S+ + D+       + +++  +C+LI+ LI SYFD++R+ I+D VPK +MC LVNY K+++Q +LV ++  E+  +ELL E+   AQ R+     L   +KA  +IS I
Sbjct:  618 QPVFDASDK-KRSIAGDGNIEDFRNLQISDFSLGDIDDLENAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSLGVYKKAATLISNI 756          
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Match: MGM1 (Mitochondrial GTPase, present in complex with Ugo1p and Fzo1p; required for mitochondrial morphology, fusion, and genome maintenance; promotes membrane bending; exists as long and short form with different distributions; ratio of long to short forms is regulated by Psd1p; homolog of human OPA1 involved in autosomal dominant optic atrophy [Source:SGD;Acc:S000005737])

HSP 1 Score: 153.68 bits (387), Expect = 2.801e-39
Identity = 100/255 (39.22%), Postives = 155/255 (60.78%), Query Frame = 1
Query:   61 TFKDIMDNLIPVINKLHDVFSSIEKEI--IKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNR 819
            T +D M NL   + ++  + + ++     + LP IVVIGSQS+GKSSVLE+IVG +FLP+G  +VTR PI L L+ TP +N+        F   +    +DF E+K  +      +  S + V ++PI L I S +V +L+LVDLPG  ++   DQP +++ +IR+LC KY    N I+L++S+A+ DLANS +LK + + DP G+RT  ++TKLDL+ D   A+ IL  N       +G +GV+ ++ + IN +
Sbjct:  179 TTQDEMLNLTKQMIEIRTILNKVDSSSAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNVT----ADFPSMRLYNIKDFKEVKRMLMELNMAVPTS-EAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLV-DPEKARSIL--NNKKYPLSMGYVGVITKTPSSINRK 424          
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Match: EDO34895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN34])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 298/516 (57.75%), Postives = 381/516 (73.84%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTP-------IN-----------NDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH-REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGA 1566
            M+ LIPVINKL DVF+++  E I+LPQIVV+G+QS+GKSSVLEN+VG DFLPRG G+VTR P+ILQL++ P       IN           +D  P+E+GKFLH KEK+F DFN I+EEIER+T+ + GS K +  +PINLKI+S KVLNLTLVDLPG+TK+PV DQP DIE +IR+L ++Y    NSI+L+V+ AN DLA SE+LK+A  +DPDG RT  + TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINNRKSI  +L  EA FF + YP++A +NGTPYL+K LN+LLM HI++ LP LK+ +N    Q    LQ+YG  V +K   L+++IT F A YC+ I+G +  I TSELCGGARI YIF+ +F +T+  +D++  L  + ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL CI+LV +EMQRIIQ+      E+ RFP+L E I++V+ NLL++R  P NEMV NLV IELA+IN  HPDF T GA
Sbjct:    1 MEQLIPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLENLVGRDFLPRGSGVVTRRPLILQLVHVPPRAKEKKINELPDKKEAAEDHDAEPAEWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLPGVTKVPVGDQPLDIEQQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHGTDAMDVLYGR--VIPVKLGIIGVVNRSQLDINNRKSIENALRDEADFFARNYPTVASRNGTPYLAKTLNKLLMHHIRNCLPELKSRVNSMTSQYHHLLQSYGEPVMDKGPYLLQMITRFAATYCSIIEGTAHEIETSELCGGARICYIFHDIFGRTLTIMDAMEGLSTRDILTAIRNATGPRPALFVPEISFELLVKRQIRRLEEPSLRCIELVHEEMQRIIQHSFDQVMEIKRFPRLHESIVDVIINLLQRRLMPCNEMVENLVAIELAYINTNHPDF-TDGA 513          

HSP 2 Score: 88.9669 bits (219), Expect = 2.063e-18
Identity = 43/101 (42.57%), Postives = 68/101 (67.33%), Query Frame = 1
Query: 1669 NMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
             + +++  D  +I  LIKSYF +VRK+I+D VPK IM FLVNY+KE +Q +LV ++      + LL+E+     +RKE  ++L+ L++A  IISE+R+T +
Sbjct:  617 GLTEREQMDSDIIRKLIKSYFVIVRKSIQDSVPKAIMAFLVNYVKERIQSELVEKLYKSERFETLLQESEHMHIKRKEAAEMLKALQRAGQIISEVRDTHI 717          
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Match: EDO32191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT4])

HSP 1 Score: 416.001 bits (1068), Expect = 5.822e-139
Identity = 222/499 (44.49%), Postives = 330/499 (66.13%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIE-KEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFF--RKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGN----EVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M++LIP++NK+ D F+SI    +I LPQI V+GSQSAGKSSVLEN VG DFLPRG GIVTR P+ILQL           SEY +FLH + K F DF E+++EI  +T+ + G  K + + PINL+++S  VL+LTLVDLPG+TK+PV DQP DIE +IR++ +++  ++N ++L+VS AN+DLANS++LK+A  +DP G RT  ++TKLDLMD+GTDA+DIL     +   + G IG+VNRSQADI+ RK I  +L +E +FF     Y  +A + GT YL K LN+ L  HIK +LP L++++   +     E++ Y N    ++  + + LM+++  F+A +  AI+G+  +INT EL GGA+I  IF+  F   + +++       + I+ AI+N  G R  LF P++ FE +VK QI +L  P++ C+D+V+ E+  +IQ C T  +MA++P L +++  +V + +R     T E V   +++ELA+IN  HPDF
Sbjct:    6 MEDLIPIVNKIQDAFASIGYSSMIDLPQIAVVGSQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQL-------QPSKSEYAEFLHCRNKKFTDFGEVQKEIVAETDRVTGGNKGISNIPINLRVYSPSVLSLTLVDLPGMTKVPVGDQPADIEFQIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMDEGTDARDIL--ENRVLPLRRGYIGIVNRSQADIDGRKDIRAALAAERKFFLSNPSYRHMADKMGTQYLQKVLNQQLTNHIKDTLPALRSKLQDNLLALEKEVKGYENYNPRDLSVRTKALMQMMQTFSADFEKAIEGSGDSINTVELSGGAKINRIFHERFPYELVKMEFDEKQLRREIMFAIKNIHGIRVGLFTPDMAFEAIVKRQIDKLRSPAIKCVDMVMTELTSVIQKCAT--QMAKYPLLRDQVERIVIDHIRSNEVTTKEQVQTFIELELAYINTNHPDF 493          
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Match: EDO40359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A7])

HSP 1 Score: 98.9821 bits (245), Expect = 1.412e-21
Identity = 84/280 (30.00%), Postives = 130/280 (46.43%), Query Frame = 1
Query:  148 LPQIVVIGSQSAGKSSVLENIVGHDFLPRGPG-IVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDA----KDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFR--KYYPS---LAHQNGTPYLSKRLNELLMKHIKSSL 957
            LP++VV+G QSAGK+SVLE I      PRG G ++TR P+++ L   P +         +F  T+EK  +D     E   +++      G+ V  + I++ +    +  + LVDLPGI         E  +  I ++  +Y +  N+I+L +     D   S    L  S+DP G RT  +LTK+DL +    +    K IL GN     F +  +G         N  +SI     SE  FFR  K + S    A Q  T  LS  +++   K ++ S+
Sbjct:   29 LPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGQMMTRSPVMVTLSEGPNHIAQFKGNSRQFDLTQEKELKDLRHEVELRMKRS---VKQGQTVSPEVISMTVKGPGLHRMVLVDLPGIIGTTTTGMAESTKSDILDISRRYMENPNAIILCIQDGAIDAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQNETSPSRIKQILEGNL----FPMKALGYFAVVTGTGNTSESIETIKTSEEGFFRTSKLFKSGVFKASQMTTQNLSFAVSQCFWKMVRESI 301          
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Match: EDO43348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ55])

HSP 1 Score: 70.8626 bits (172), Expect = 1.929e-13
Identity = 35/89 (39.33%), Postives = 58/89 (65.17%), Query Frame = 1
Query: 1690 RDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            R  + I NL+ SY  +V KTI+DLVPKTIM  ++N IKE +  +L+  +    +V +L+EE+ + AQRR+E+  +  + ++A  I+ +I
Sbjct:  152 RQVETIRNLVDSYIRIVSKTIRDLVPKTIMYMIINNIKEFIAAELLAHLYSSGNVSDLMEESEEEAQRREEMLKMYHSTKEALQIVGDI 240          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: ENSORLT00000013419.2 (dynamin-1-like protein [Source:NCBI gene;Acc:101168415])

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 344/682 (50.44%), Postives = 466/682 (68.33%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPI-----NNDGGP--SEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF----------------------------DTSGAYGKSMDHHGKHPHKKLAQNNDISIHE-------------DEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIPVINKL DVF+++  +II+LPQI V+G+QS+GKSSVLE++VG D LPRG G+VTR P+ILQL++        N DGG    E+GKFLHTK K+F DF+EI+ EIE++TE I+G+ K + ++PI+LKIFS  V+NLTLVDLPGITK+PV DQP+DIE +IR+L +K+    N I+L+V++AN D+A SE+LK+A  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+K +++++  E  F +K YPSLA++NGT YL+K LN LLM HI+  LP LKT IN+   Q    L +YG  V++    L+++IT F   YCN I+G +K I T+ELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR SLFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL E I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF                            D + A G   +  G    + + +  + +                D        ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K++LQ +LV ++     + +LL E+ D AQRRKE  D+L+ L++A+ +I+EIRET L
Sbjct:    1 METLIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVDAGDARNNEDGGKEVQEWGKFLHTKSKIFTDFDEIRLEIEQETERISGNNKGISEEPIHLKIFSPFVVNLTLVDLPGITKVPVGDQPQDIEIQIRDLILKHISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGR--VIPVKLGLIGVVNRSQLDINNKKCVADAIRDEQAFLQKKYPSLANRNGTKYLAKTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLSSYGEPVEDASATLLQLITKFATEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPSLFVPEISFELLVKKQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELQRFPKLHEAIVEVVTSLLRKRLPITNEMVHNLVAIELAYINTKHPDFADACGVMNNNIEEQRRNRMRELPAAVPRDKAPAAGPQGEQDGTGNWRGMLKKGEEAPASGPGTPLKGAVNLLDVPVPVARKLSSREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSGLLTDLLTESEDMAQRRKEAADMLQALQRASQVIAEIRETHL 680          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: si:dkey-32e23.4 (dynamin-1-like protein [Source:NCBI gene;Acc:101169210])

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 330/661 (49.92%), Postives = 457/661 (69.14%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTP-----INNDGG--PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKSMDHH-------GKHPHKKLAQNNDISIHEDEHARRYENMN-------------DKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIP IN+L +VF ++  EII+LPQIVV+G+QS+GKSSVLE++VG DFLPRG GIVTR P++LQL+        + N+ G    E+G FLH K ++F DF EI++EIE +TE  +G  K +  +PI LKIFS KVLNLTLVDLPGI K+PV DQPE+IE +++ + + +    NS++L+VS AN+DLA S++LKLA  +DPDG RT  +++KLDLMD GTDA ++L G   +   +LG+IGVVNRSQ DIN +KS+ +S++ E  F +++YPSL  + G+ YL+K L++LLM HI+  LP LKT + + I Q    L +YG  V++    L++I+T F   YCN I+G +++I TSELCGGARI YIF+  F +T+  ID LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPS+ C++LV +E+QRIIQ+C ++  +E+ RFPKL + I+ VVT LLR+R   TNEMV NL+ IELA+IN KHPDF  +     S++         GKH   +    N   +       + + +N              K+ RDC++I+ LI SYF +VRK+I+D VPKT+M FLVN++KE+LQ +LV ++  +  + ELL E+ + AQ+R E+  +LE L+KAN IISEIRET L
Sbjct:   20 METLIPTINRLQEVFQTVGTEIIQLPQIVVVGTQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVAPQQERLKNEHGVKAEEWGTFLHCKNQIFTDFLEIRKEIEAETERTSGDNKGITCEPIYLKIFSPKVLNLTLVDLPGIIKVPVGDQPENIEAQVQEMILSFISNPNSLILAVSPANSDLATSDALKLAREVDPDGRRTLLVVSKLDLMDAGTDALEVLLGR--VIPVRLGIIGVVNRSQHDINTQKSLEDSIKDEHVFLQRHYPSLVSRAGSRYLAKTLSKLLMHHIRDCLPELKTRVTVLISQYQARLNSYGQPVEDHSATLLQIVTKFATDYCNTIEGTARHIQTSELCGGARICYIFHETFGRTLQSIDPLGGLTDLDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSMRCVELVHEELQRIIQHCSSYSTQELLRFPKLHDSIVEVVTGLLRKRLPITNEMVHNLISIELAYINTKHPDFTDAAQVSASVNSQQADTLDGGKHWKTEKTVENKAQVPGFGSPSKTQAVNLLDTAVPISRKLSAKEQRDCEIIQRLINSYFLIVRKSIQDSVPKTVMHFLVNFVKEHLQSELVGQLYKQGLLQELLIESQETAQQRTEVAQMLEALKKANNIISEIRETHL 678          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: ENSORLT00000042041.1 (dynamin-1-like protein [Source:NCBI gene;Acc:101168415])

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 335/665 (50.38%), Postives = 452/665 (67.97%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPI-----NNDGGP--SEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF----------------------------DTSGAYGKSMDHHGKHPHKKLAQNNDISIHE-------------DEHARRYENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLE 1920
            M+ LIPVINKL DVF+++  +II+LPQI V+G+QS+GKSSVLE++VG D LPRG G+VTR P+ILQL++        N DGG    E+GKFLHTK K+F DF+EI+ EIE++TE I+G+ K + ++PI+LKIFS  V+NLTLVDLPGITK+PV DQP+DIE +IR+L +K+    N I+L+V++AN D+A SE+LK+A  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DINN+K +++++  E  F +K YPSLA++NGT YL+K LN LLM HI+  LP LKT IN+   Q    L +YG  V++    L+++IT F   YCN I+G +K I T+ELCGGARI YIF+  F +T++ +D LG L    ILTAI+NA+GPR SLFVPE++FELLVK Q+ RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL E I+ VVT+LLR+R   TNEMV NLV IELA+IN KHPDF                            D + A G   +  G    + + +  + +                D        ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K++LQ +LV ++     + +LL E+ D AQRRKE  D+L+
Sbjct:    1 METLIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVDAGDARNNEDGGKEVQEWGKFLHTKSKIFTDFDEIRLEIEQETERISGNNKGISEEPIHLKIFSPFVVNLTLVDLPGITKVPVGDQPQDIEIQIRDLILKHISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGR--VIPVKLGLIGVVNRSQLDINNKKCVADAIRDEQAFLQKKYPSLANRNGTKYLAKTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLSSYGEPVEDASATLLQLITKFATEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPSLFVPEISFELLVKKQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELQRFPKLHEAIVEVVTSLLRKRLPITNEMVHNLVAIELAYINTKHPDFADACGVMNNNIEEQRRNRMRELPAAVPRDKAPAAGPQGEQDGTGNWRGMLKKGEEAPASGPGTPLKGAVNLLDVPVPVARKLSSREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSGLLTDLLTESEDMAQRRKEAADMLQ 663          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: si:dkey-32e23.4 (dynamin-1-like protein [Source:NCBI gene;Acc:101169210])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 330/674 (48.96%), Postives = 457/674 (67.80%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTP-----INNDGG---------------PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGKSMDHH-------GKHPHKKLAQNNDISIHEDEHARRYENMN-------------DKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIP IN+L +VF ++  EII+LPQIVV+G+QS+GKSSVLE++VG DFLPRG GIVTR P++LQL+        + N+ G                 E+G FLH K ++F DF EI++EIE +TE  +G  K +  +PI LKIFS KVLNLTLVDLPGI K+PV DQPE+IE +++ + + +    NS++L+VS AN+DLA S++LKLA  +DPDG RT  +++KLDLMD GTDA ++L G   +   +LG+IGVVNRSQ DIN +KS+ +S++ E  F +++YPSL  + G+ YL+K L++LLM HI+  LP LKT + + I Q    L +YG  V++    L++I+T F   YCN I+G +++I TSELCGGARI YIF+  F +T+  ID LG L    ILTAI+NA+GPR +LFVPE++FELLVK QI RLEEPS+ C++LV +E+QRIIQ+C ++  +E+ RFPKL + I+ VVT LLR+R   TNEMV NL+ IELA+IN KHPDF  +     S++         GKH   +    N   +       + + +N              K+ RDC++I+ LI SYF +VRK+I+D VPKT+M FLVN++KE+LQ +LV ++  +  + ELL E+ + AQ+R E+  +LE L+KAN IISEIRET L
Sbjct:   20 METLIPTINRLQEVFQTVGTEIIQLPQIVVVGTQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVAPQQERLKNEHGNGLKQNIQNSYTGVKAEEWGTFLHCKNQIFTDFLEIRKEIEAETERTSGDNKGITCEPIYLKIFSPKVLNLTLVDLPGIIKVPVGDQPENIEAQVQEMILSFISNPNSLILAVSPANSDLATSDALKLAREVDPDGRRTLLVVSKLDLMDAGTDALEVLLGR--VIPVRLGIIGVVNRSQHDINTQKSLEDSIKDEHVFLQRHYPSLVSRAGSRYLAKTLSKLLMHHIRDCLPELKTRVTVLISQYQARLNSYGQPVEDHSATLLQIVTKFATDYCNTIEGTARHIQTSELCGGARICYIFHETFGRTLQSIDPLGGLTDLDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSMRCVELVHEELQRIIQHCSSYSTQELLRFPKLHDSIVEVVTGLLRKRLPITNEMVHNLISIELAYINTKHPDFTDAAQVSASVNSQQADTLDGGKHWKTEKTVENKAQVPGFGSPSKTQAVNLLDTAVPISRKLSAKEQRDCEIIQRLINSYFLIVRKSIQDSVPKTVMHFLVNFVKEHLQSELVGQLYKQGLLQELLIESQETAQQRTEVAQMLEALKKANNIISEIRETHL 691          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: DNM1L (dynamin-1-like protein [Source:NCBI gene;Acc:101160650])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 339/698 (48.57%), Postives = 462/698 (66.19%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYT------PINNDGG--PSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTH--REMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFIN----------------------------------NKHPDFDTSGAYGKSMDHHGKHPHKKLAQNND-------ISIH-------EDEHARRY--------ENMNDKDMRDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEIRETQL 1971
            M+ LIPVINKL DVF+++  +I++LPQIVV+G+QS+GKSSVLE++VG D LPRG G+VTR P+ILQL++         N + G    E+GKFLHTK K++ DF EI+ EIE +TE I+G+ K + D+PI+LKIFS  V+NLTLVDLPGITK+PV DQP DIE +I+ L +KY    NSI+L+V++AN D+A SE+LK+A  +DPDG RT  ++TKLDLMD GTDA D+L G   +   KLG+IGVVNRSQ DIN +K + +S+  E  F +K YPSLA++NGT YL++ LN LLM HI+  LP LKT IN+   Q    L +YGN V +K   L+++IT F A YCN I+G +K I T+ELCGGARI YIF+  F +T++ +D LG L    +LTAI+NA+GPR +LFVPE++FELLVK QI RLEEPSL C++LV +EMQRIIQ+C  +  +E+ RFPKL + ++ VVT+LLR+R   TNEMV NLV IELA+IN                                  +K P   +  A        G    + + +  D       +++H       +  HA             ++ ++ RDC++IE LIKSYF +VRK I+D VPK +M FLVN++K+ LQ +LV ++     +D+LL E+ D AQRR E  D+L+ L+K++ +I+EIRET +
Sbjct:    1 MEALIPVINKLQDVFNTVGADIMQLPQIVVVGTQSSGKSSVLESLVGRDILPRGTGVVTRRPLILQLVHIDPEDRRKTNEENGIDGEEWGKFLHTKNKIYTDFEEIRAEIEAETERISGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPRDIEIQIKELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGR--VIPVKLGIIGVVNRSQLDINQKKLVVDSIRDEHAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGNPVDDKNSTLLQLITKFAAEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTMDVLTAIRNATGPRPALFVPEISFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLIDAVVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACSLINNNLDEQRRHRLKEMPAGVPRDKAPAGGSQSAPAGEQTEGGTGSWRGMLRRGDEGSSGDRVALHTQIPPSPQRSHAVNLLDVPVPVTRKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDCLQSELVGQLYKGPLLDDLLIESEDMAQRRTEAADMLKALQKSSQVIAEIRETHM 696          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000058940.1 (SMESG000058940.1)

HSP 1 Score: 411.379 bits (1056), Expect = 8.509e-134
Identity = 234/493 (47.46%), Postives = 321/493 (65.11%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFD 1554
            MD LIP+IN+L D +S +    I LPQIV+IGSQSAGKSSVLENIV  +FLPRG GIVTRCP++L L++ P   DG     G+FLHT +K + DF++IKEEI R+T+ +AG  K + D PI LKI+SH+  NLTL+DLPG+TK+ V+ QP+DI+ +I+N C+++ +++NSI+L++S+AN DLANS+SL+ A  LDP+G RT C++TKLDLMD GT A+DIL G    K  +LG IGVV+RSQ DI   K I ESL  E QFF K+Y  +A +NGT +L++ LN LL KHIK  LPNLK  I  KI+    +L   G E+K+K+ L+ E +T F+ AY    DG     N +++ GGA I  I Y  F   + +ID    L    I+T I+N  GP    F  +  F  LVK QI +L  PS  CID V D +Q  +Q       +  FP L ++I+     L++Q ++ T  ++ NL+K E + I   HP+++
Sbjct:    1 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP---DGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPK--QLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNNCIDDVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYE 487          

HSP 2 Score: 55.0694 bits (131), Expect = 1.542e-7
Identity = 32/85 (37.65%), Postives = 52/85 (61.18%), Query Frame = 1
Query: 1702 LIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            ++  L+  YF++VR+ I   +PK I  FLV +IKENL  +L   +    D+D LL+E+ D +++RK  K+L+E+L      I +I
Sbjct:  638 ILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRLQ-NIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDI 721          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.338e-125
Identity = 220/499 (44.09%), Postives = 321/499 (64.33%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEI-IKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGN----EVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIP++NKL D FSSI   I + LPQI V+GSQSAGKSSVLEN VG DFLPRG GIVTR P++LQL ++        SEY +F+H K K F DF+E+++EIE +T+ + GS K +   PINL+++S  VLNLTL+DLPG+TK+ V DQP DIE +IR++ +++   +N ++L+VS AN+D+ANS++LKLA  +DP G+RT  ++TKLDLMD+GTDA++IL     +   + G IGVVNRSQ DI+ +K I  +L SE +FF  +  Y  +A + GT YL K LN+ L  HI+ +LP L+  +  ++     E+  Y N    +   K + L+  +  F   +C AIDG    I+T  L GGA I  IF+  F   + +I+         I  AI+N  G R  LF P++ FE +V+ QI +L+ P++ CIDLV+ E+ +++ +C    +M  FP+L E+I  +VT  L+++   T + +  LV I+L+++N  H DF
Sbjct:    7 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSN-------SEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREIL--ENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTA--KMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF 494          

HSP 2 Score: 67.0106 bits (162), Expect = 3.761e-11
Identity = 34/89 (38.20%), Postives = 58/89 (65.17%), Query Frame = 1
Query: 1690 RDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            R  + I NL++SY  ++ KT +DLVPKTIM  +VN +K+  +G L+  +    D   L+EE+A+  Q+R+E+  + + +++A  IISE+
Sbjct:  647 RQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEV 735          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 391.349 bits (1004), Expect = 5.202e-125
Identity = 220/499 (44.09%), Postives = 321/499 (64.33%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEI-IKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGN----EVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIP++NKL D FSSI   I + LPQI V+GSQSAGKSSVLEN VG DFLPRG GIVTR P++LQL ++        SEY +F+H K K F DF+E+++EIE +T+ + GS K +   PINL+++S  VLNLTL+DLPG+TK+ V DQP DIE +IR++ +++   +N ++L+VS AN+D+ANS++LKLA  +DP G+RT  ++TKLDLMD+GTDA++IL     +   + G IGVVNRSQ DI+ +K I  +L SE +FF  +  Y  +A + GT YL K LN+ L  HI+ +LP L+  +  ++     E+  Y N    +   K + L+  +  F   +C AIDG    I+T  L GGA I  IF+  F   + +I+         I  AI+N  G R  LF P++ FE +V+ QI +L+ P++ CIDLV+ E+ +++ +C    +M  FP+L E+I  +VT  L+++   T + +  LV I+L+++N  H DF
Sbjct:    7 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSN-------SEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREIL--ENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTA--KMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF 494          

HSP 2 Score: 67.0106 bits (162), Expect = 3.388e-11
Identity = 34/89 (38.20%), Postives = 58/89 (65.17%), Query Frame = 1
Query: 1690 RDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            R  + I NL++SY  ++ KT +DLVPKTIM  +VN +K+  +G L+  +    D   L+EE+A+  Q+R+E+  + + +++A  IISE+
Sbjct:  659 RQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEV 747          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 390.963 bits (1003), Expect = 6.456e-125
Identity = 220/499 (44.09%), Postives = 321/499 (64.33%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEI-IKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGN----EVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIP++NKL D FSSI   I + LPQI V+GSQSAGKSSVLEN VG DFLPRG GIVTR P++LQL ++        SEY +F+H K K F DF+E+++EIE +T+ + GS K +   PINL+++S  VLNLTL+DLPG+TK+ V DQP DIE +IR++ +++   +N ++L+VS AN+D+ANS++LKLA  +DP G+RT  ++TKLDLMD+GTDA++IL     +   + G IGVVNRSQ DI+ +K I  +L SE +FF  +  Y  +A + GT YL K LN+ L  HI+ +LP L+  +  ++     E+  Y N    +   K + L+  +  F   +C AIDG    I+T  L GGA I  IF+  F   + +I+         I  AI+N  G R  LF P++ FE +V+ QI +L+ P++ CIDLV+ E+ +++ +C    +M  FP+L E+I  +VT  L+++   T + +  LV I+L+++N  H DF
Sbjct:    7 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSN-------SEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREIL--ENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTA--KMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF 494          

HSP 2 Score: 66.6254 bits (161), Expect = 3.956e-11
Identity = 34/89 (38.20%), Postives = 58/89 (65.17%), Query Frame = 1
Query: 1690 RDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            R  + I NL++SY  ++ KT +DLVPKTIM  +VN +K+  +G L+  +    D   L+EE+A+  Q+R+E+  + + +++A  IISE+
Sbjct:  647 RQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEV 735          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 390.578 bits (1002), Expect = 9.462e-125
Identity = 220/499 (44.09%), Postives = 321/499 (64.33%), Query Frame = 1
Query:   76 MDNLIPVINKLHDVFSSIEKEI-IKLPQIVVIGSQSAGKSSVLENIVGHDFLPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNXXXXXXXXXXXXXAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQPEDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVRTFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKSISESLESEAQFFRKY--YPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTEINIKIKQCLLELQAYGN----EVKNKKELLMEIITHFNAAYCNAIDGNSKNINTSELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLFVPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPKLSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDF 1551
            M+ LIP++NKL D FSSI   I + LPQI V+GSQSAGKSSVLEN VG DFLPRG GIVTR P++LQL ++        SEY +F+H K K F DF+E+++EIE +T+ + GS K +   PINL+++S  VLNLTL+DLPG+TK+ V DQP DIE +IR++ +++   +N ++L+VS AN+D+ANS++LKLA  +DP G+RT  ++TKLDLMD+GTDA++IL     +   + G IGVVNRSQ DI+ +K I  +L SE +FF  +  Y  +A + GT YL K LN+ L  HI+ +LP L+  +  ++     E+  Y N    +   K + L+  +  F   +C AIDG    I+T  L GGA I  IF+  F   + +I+         I  AI+N  G R  LF P++ FE +V+ QI +L+ P++ CIDLV+ E+ +++ +C    +M  FP+L E+I  +VT  L+++   T + +  LV I+L+++N  H DF
Sbjct:    7 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSN-------SEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREIL--ENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTA--KMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF 494          

HSP 2 Score: 67.0106 bits (162), Expect = 3.425e-11
Identity = 34/89 (38.20%), Postives = 58/89 (65.17%), Query Frame = 1
Query: 1690 RDCKLIENLIKSYFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEENADYAQRRKELKDLLENLRKANCIISEI 1956
            R  + I NL++SY  ++ KT +DLVPKTIM  +VN +K+  +G L+  +    D   L+EE+A+  Q+R+E+  + + +++A  IISE+
Sbjct:  647 RQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEV 735          
The following BLAST results are available for this feature:
BLAST of Dynamin-1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNM1L1.651e-2354.63dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L1.674e-2354.63dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L2.077e-2354.92dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L2.303e-2356.15dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L1.559e-2353.53dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drp-10.000e+045.42Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-10.000e+045.42Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-10.000e+045.42Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-13.277e-18049.46Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-13.277e-18049.46Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drp14.129e-2456.49gene:FBgn0026479 transcript:FBtr0077744[more]
Drp14.129e-2456.49gene:FBgn0026479 transcript:FBtr0335173[more]
shi2.441e-12343.45gene:FBgn0003392 transcript:FBtr0301597[more]
shi3.467e-12343.45gene:FBgn0003392 transcript:FBtr0074122[more]
shi3.467e-12343.45gene:FBgn0003392 transcript:FBtr0074121[more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1l0.000e+050.00dynamin 1-like [Source:NCBI gene;Acc:393896][more]
si:dkey-32e23.40.000e+048.44si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-4... [more]
si:dkey-32e23.40.000e+048.44si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-4... [more]
dnm1l2.505e-2355.34dynamin 1-like [Source:NCBI gene;Acc:393896][more]
dnm1a2.932e-12944.49dynamin 1a [Source:NCBI gene;Acc:100307098][more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1l0.000e+050.54dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l0.000e+045.93dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l5.171e-1857.06dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l3.529e-1756.78dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l6.604e-2355.92dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnm1l1.250e-2357.26dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
Dnm1l1.380e-2354.94dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
Dnm1l1.275e-2356.01dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
Dnm1l3.542e-14955.34dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
Dnm1l6.743e-13456.55dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
back to top
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SXN5|DNM1L_DANRE0.000e+050.00Dynamin-1-like protein OS=Danio rerio OX=7955 GN=d... [more]
sp|O00429|DNM1L_HUMAN7.930e-2354.63Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=... [more]
sp|Q2KIA5|DNM1L_BOVIN6.303e-2353.53Dynamin-1-like protein OS=Bos taurus OX=9913 GN=DN... [more]
sp|Q8K1M6|DNM1L_MOUSE7.221e-2356.39Dynamin-1-like protein OS=Mus musculus OX=10090 GN... [more]
sp|O35303|DNM1L_RAT7.524e-2353.16Dynamin-1-like protein OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of Dynamin-1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095ALR20.000e+051.29Dynamin-1-like protein OS=Schistosoma haematobium ... [more]
A0A3R7DMF20.000e+051.37Dynamin-1-like protein OS=Clonorchis sinensis OX=7... [more]
H2KT110.000e+051.37Dynamin GTPase OS=Clonorchis sinensis OX=79923 GN=... [more]
W6UQ740.000e+052.93Dynamin-1-like protein OS=Echinococcus granulosus ... [more]
A0A267FQS50.000e+053.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1l0.000e+049.50dynamin 1 like [Source:NCBI gene;Acc:103030788][more]
si:dkey-32e23.40.000e+049.24dynamin-1-like protein [Source:NCBI gene;Acc:10303... [more]
si:dkey-32e23.40.000e+048.29dynamin-1-like protein [Source:NCBI gene;Acc:10303... [more]
si:dkey-32e23.40.000e+047.09dynamin-1-like protein [Source:NCBI gene;Acc:10303... [more]
dnm1l2.010e-2355.15dynamin 1 like [Source:NCBI gene;Acc:103030788][more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002816.13.750e-2056.40pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-... [more]
ENSPMAT00000006976.18.333e-11242.35pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1... [more]
ENSPMAT00000007915.15.986e-10754.21pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene... [more]
mxb6.217e-5326.61myxovirus (influenza) resistance B [Source:NCBI ge... [more]
opa15.373e-2028.52OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
VPS12.414e-15138.44Dynamin-like GTPase required for vacuolar sorting;... [more]
DNM12.004e-14446.15Dynamin-related GTPase involved in mitochondrial o... [more]
MGM12.801e-3939.22Mitochondrial GTPase, present in complex with Ugo1... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO348952.063e-1857.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321915.822e-13944.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403591.412e-2130.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433481.929e-1339.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000013419.20.000e+050.44dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
si:dkey-32e23.40.000e+049.92dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000042041.10.000e+050.38dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
si:dkey-32e23.40.000e+048.96dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
DNM1L0.000e+048.57dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058940.18.509e-13447.46SMESG000058940.1[more]
SMESG000067156.12.338e-12544.09SMESG000067156.1[more]
SMESG000067156.15.202e-12544.09SMESG000067156.1[more]
SMESG000067156.16.456e-12544.09SMESG000067156.1[more]
SMESG000067156.19.462e-12544.09SMESG000067156.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027152 ID=SMED30027152|Name=Dynamin-1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2058bp
CGGAGATGTTGATTATAGGACATTGTTTAAATATTGCCTAAATACTAGAA
TTATAACTATACTTTTAAGGACATTATGGATAACCTTATTCCAGTTATAA
ATAAATTACACGATGTATTTAGCAGTATTGAAAAAGAAATTATTAAATTA
CCACAAATTGTAGTAATTGGCTCTCAAAGTGCAGGAAAAAGTTCAGTTTT
GGAAAATATTGTAGGGCATGATTTCCTTCCAAGAGGTCCAGGAATAGTTA
CACGATGTCCAATTATATTACAACTTATATATACTCCTATTAATAATGAT
GGTGGACCATCTGAATACGGAAAGTTTCTGCACACAAAAGAAAAATTATT
TGAAGATTTCAATGAGATTAAAGAAGAAATAGAAAGGAAAACAGAAGAAA
TTGCTGGAAGTGGAAAATGTGTTGTAGATGATCCAATAAATTTGAAAATA
TTTAGTCATAAAGTTTTAAATTTAACTTTAGTCGACTTACCTGGAATCAC
TAAATTACCAGTTCAAGATCAACCTGAAGATATCGAAGATAGAATTCGAA
ATTTGTGCATTAAATATGGAAAACAACAAAATTCTATTTTGCTATCGGTT
TCAAGTGCAAATAATGATTTAGCAAATAGCGAGTCATTGAAGTTAGCGAT
GAGCTTAGATCCAGATGGTGTTAGAACGTTTTGTATATTGACAAAACTTG
ATTTAATGGATGATGGGACTGACGCTAAAGATATTTTAACTGGAAATACT
AATATAAAAAATTTTAAATTAGGCGTTATTGGAGTTGTCAATAGATCTCA
AGCTGATATAAACAATCGTAAATCTATATCAGAATCTCTTGAGAGTGAAG
CACAATTTTTTAGAAAATATTACCCATCGTTAGCACATCAAAATGGAACT
CCCTATTTATCCAAAAGATTGAATGAGCTACTGATGAAACATATTAAATC
ATCGTTACCAAATCTTAAAACTGAAATCAATATTAAAATTAAGCAATGTT
TGCTTGAATTACAAGCTTATGGCAACGAAGTTAAAAATAAAAAAGAGTTA
TTGATGGAAATTATCACTCATTTTAATGCTGCTTACTGTAATGCTATCGA
TGGAAATTCCAAAAACATAAACACTTCTGAATTGTGCGGCGGGGCGAGAA
TTGGATATATATTTTATTCCATGTTCCATAAAACCATTGATGAAATCGAT
TCTTTGGGAAACTTGAAGCCAAAAGCCATTCTGACTGCTATTCAAAACGC
CAGTGGTCCTCGGTGTTCTCTGTTCGTACCGGAATTGACCTTTGAACTGC
TCGTTAAAAATCAAATTTCCCGATTGGAAGAGCCAAGCTTGATTTGCATT
GATTTAGTTCTAGATGAAATGCAGCGCATAATTCAAAACTGTGGAACCCA
TAGAGAAATGGCGAGGTTTCCTAAATTGAGCGAGAAAATCATAAATGTTG
TGACGAATTTACTGAGACAGAGGCATGAACCGACTAATGAAATGGTTTCT
AATCTCGTTAAAATCGAGTTGGCCTTCATCAATAACAAACATCCGGATTT
TGACACTTCCGGAGCCTATGGGAAATCCATGGATCACCATGGAAAACATC
CGCATAAAAAGCTGGCTCAGAATAATGACATTAGCATTCATGAAGATGAG
CATGCGCGCCGCTATGAGAATATGAATGATAAAGACATGAGAGATTGCAA
ATTGATAGAAAATTTAATCAAAAGCTATTTCGATCTGGTGCGGAAAACAA
TAAAAGATCTAGTCCCGAAAACTATCATGTGTTTTTTAGTGAATTATATT
AAGGAGAATTTACAAGGGAAATTAGTATTGGAAGTTCTACACGAATCAGA
CGTTGACGAACTGTTAGAGGAAAATGCTGACTATGCCCAGCGCCGAAAAG
AATTGAAGGATTTATTAGAAAATCTTCGTAAAGCAAATTGCATCATCAGC
GAGATTCGTGAAACTCAATTACGATAGCATCAAGCAATATTATTATTATT
TAGTAACTAAATAATCGTTTCAATATATATTGTTTTTAATACAAATTTTC
AATATTTG
back to top

protein sequence of SMED30027152-orf-1

>SMED30027152-orf-1 ID=SMED30027152-orf-1|Name=SMED30027152-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=634bp
MDNLIPVINKLHDVFSSIEKEIIKLPQIVVIGSQSAGKSSVLENIVGHDF
LPRGPGIVTRCPIILQLIYTPINNDGGPSEYGKFLHTKEKLFEDFNEIKE
EIERKTEEIAGSGKCVVDDPINLKIFSHKVLNLTLVDLPGITKLPVQDQP
EDIEDRIRNLCIKYGKQQNSILLSVSSANNDLANSESLKLAMSLDPDGVR
TFCILTKLDLMDDGTDAKDILTGNTNIKNFKLGVIGVVNRSQADINNRKS
ISESLESEAQFFRKYYPSLAHQNGTPYLSKRLNELLMKHIKSSLPNLKTE
INIKIKQCLLELQAYGNEVKNKKELLMEIITHFNAAYCNAIDGNSKNINT
SELCGGARIGYIFYSMFHKTIDEIDSLGNLKPKAILTAIQNASGPRCSLF
VPELTFELLVKNQISRLEEPSLICIDLVLDEMQRIIQNCGTHREMARFPK
LSEKIINVVTNLLRQRHEPTNEMVSNLVKIELAFINNKHPDFDTSGAYGK
SMDHHGKHPHKKLAQNNDISIHEDEHARRYENMNDKDMRDCKLIENLIKS
YFDLVRKTIKDLVPKTIMCFLVNYIKENLQGKLVLEVLHESDVDELLEEN
ADYAQRRKELKDLLENLRKANCIISEIRETQLR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR022812Dynamin_SF
IPR001401Dynamin_GTPase
IPR003130GED
IPR027417P-loop_NTPase
IPR000375Dynamin_central
IPR030381G_DYNAMIN_dom
IPR020850GED_dom
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0000266mitochondrial fission
GO:0016559peroxisome fission