Ras-related protein Rab-14

Overview
NameRas-related protein Rab-14
Smed IDSMED30027146
Length (bp)1353
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-14 (SMED30027146) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-14 (SMED30027146) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-14 (SMED30027146) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-14 (SMED30027146) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027146

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027146SMESG000078665.1 Contig3296GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30027146SMESG000024495.1 dd_Smed_v4_3164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027146SMESG000024495.1 dd_Smed_v4_3164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027146SMESG000024495.1 dd_Smed_v4_3164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027146SMESG000024495.1 dd_Smed_v4_3164_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-14 vs. Ensembl Human
Match: RAB14 (RAB14, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16524])

HSP 1 Score: 311.997 bits (798), Expect = 6.854e-105
Identity = 143/208 (68.75%), Postives = 174/208 (83.65%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Human
Match: RAB14 (RAB14, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16524])

HSP 1 Score: 296.59 bits (758), Expect = 2.138e-99
Identity = 132/174 (75.86%), Postives = 159/174 (91.38%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNV 641
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSL 181          
BLAST of Ras-related protein Rab-14 vs. Ensembl Human
Match: RAB4A (RAB4A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9781])

HSP 1 Score: 244.973 bits (624), Expect = 1.169e-78
Identity = 115/212 (54.25%), Postives = 151/212 (71.23%), Query Frame = 3
Query:  111 SEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-----VMKRSPTPAKSAQSNQKNCSC 731
            SE Y ++FK+++IG+ G GKSCLLHQF E KF  D  HTIGVEFG+KII V G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDIT + T+N + +WL+DAR L S   V IL GNK DL+ +REV+F +    A+EN + FLE SA TGE+VE+AF++ ARKI   I+ G +D     +G+      +++  +P ++   N + C C
Sbjct:    7 SETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC 218          
BLAST of Ras-related protein Rab-14 vs. Ensembl Human
Match: RAB2A (RAB2A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9763])

HSP 1 Score: 238.81 bits (608), Expect = 2.231e-76
Identity = 110/184 (59.78%), Postives = 144/184 (78.26%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV 668
            AY+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G+++KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  ++   V +LIGNK DL   REV  E+G+  A E+G+ F+E SA+T  +VE+AFI TA++IY+ IQEG  D+N+ +NG+
Sbjct:    2 AYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGI 185          
BLAST of Ras-related protein Rab-14 vs. Ensembl Human
Match: RAB4B (RAB4B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9782])

HSP 1 Score: 235.343 bits (599), Expect = 5.436e-75
Identity = 110/212 (51.89%), Postives = 147/212 (69.34%), Query Frame = 3
Query:  111 SEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-----VMKRSPTPAKSAQSNQKNCSC 731
            +E Y ++FK+++IG  G GKSCLLHQF E+KF  D  HTIGVEFG++++ V G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDIT + T+N + +WL+DAR+L SP  V IL GNK DL+  REV+F +    A+EN + FLE SA TGE+VE+AF++ AR I   I  G +D     +G+      +++   P  +     + C C
Sbjct:    2 AETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDASLRQLRQPRSAQAVAPQPCGC 213          
BLAST of Ras-related protein Rab-14 vs. Ensembl Celegans
Match: rab-14 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874])

HSP 1 Score: 313.538 bits (802), Expect = 5.123e-106
Identity = 141/204 (69.12%), Postives = 176/204 (86.27%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DA+SLT+P T   LIGNK DL + R+V +E+ K  AEENG+ FLECSA+TG +VEDAF+ETA++IYQ+IQ+G++DLN+A  GV  K++  P  +  + +K+C+C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYEEAKAFAEENGLTFLECSAKTGSNVEDAFLETAKQIYQNIQDGSLDLNAADTGVQPKQN-LPRAAENNGKKDCNC 210          
BLAST of Ras-related protein Rab-14 vs. Ensembl Celegans
Match: rab-14 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874])

HSP 1 Score: 313.538 bits (802), Expect = 5.123e-106
Identity = 141/204 (69.12%), Postives = 176/204 (86.27%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DA+SLT+P T   LIGNK DL + R+V +E+ K  AEENG+ FLECSA+TG +VEDAF+ETA++IYQ+IQ+G++DLN+A  GV  K++  P  +  + +K+C+C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYEEAKAFAEENGLTFLECSAKTGSNVEDAFLETAKQIYQNIQDGSLDLNAADTGVQPKQN-LPRAAENNGKKDCNC 210          
BLAST of Ras-related protein Rab-14 vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3824947:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 239.965 bits (611), Expect = 2.930e-77
Identity = 110/193 (56.99%), Postives = 149/193 (77.20%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA 695
            +Y+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG +++ + G+++KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + SWL DAR  ++   V +LIGNK DL   REV  E+G+  A E+G+ F+E SA+T  +VE+AFI+TA++IY+ IQEG  D+N+ +NG+ +    +P+
Sbjct:    2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNEANGIKLGPQHSPS 194          
BLAST of Ras-related protein Rab-14 vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3822883:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 240.35 bits (612), Expect = 3.176e-77
Identity = 112/201 (55.72%), Postives = 153/201 (76.12%), Query Frame = 3
Query:   93 IFDRMHSEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA 695
            ++ RM   +Y+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG +++ + G+++KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + SWL DAR  ++   V +LIGNK DL   REV  E+G+  A E+G+ F+E SA+T  +VE+AFI+TA++IY+ IQEG  D+N+ +NG+ +    +P+
Sbjct:    6 LYGRM---SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNEANGIKLGPQHSPS 203          
BLAST of Ras-related protein Rab-14 vs. Ensembl Celegans
Match: F11A5.3 (pep chromosome:WBcel235:V:16194939:16195544:1 gene:WBGene00008671.1 transcript:F11A5.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F11A5.3)

HSP 1 Score: 183.726 bits (465), Expect = 1.230e-55
Identity = 90/201 (44.78%), Postives = 132/201 (65.67%), Query Frame = 3
Query:  123 SYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKNC 725
             ++FKY+IIGD GVGKS LL +FT+  F P    T+GVEFG K +++   KV+L++WDT GQE FR++ R+YYR A GA+LVYDIT + +F  +  WLSD R    P+ V +LIGNK DL   R+V+ E+G+  A++NG+ F+E SA+  +HVE AF+ TA +IY+ ++ G ++     + V  K+     +S    +K C
Sbjct:    4 DHMFKYVIIGDGGVGKSNLLLRFTDELFDPIHTTTLGVEFGYKDLQIDKYKVRLRVWDTCGQENFRSIIRAYYRNALGALLVYDITCRKSFVHLEQWLSDLRQHGHPEMVIMLIGNKSDLKAVRDVTTEEGEAFAKKNGLTFMETSAKANKHVEKAFVNTAHEIYKKLKLGVIE----DDDVKKKKIGIILRSRSGKEKKC 200          
BLAST of Ras-related protein Rab-14 vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0343678)

HSP 1 Score: 303.523 bits (776), Expect = 7.142e-102
Identity = 139/209 (66.51%), Postives = 174/209 (83.25%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQ-----KNCSC 731
            Y+YIFKYIIIGDMGVGKSCLLHQFTE KF+ +CPHTIGVEFGT+IIEV  +K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+D R+LT+P TV  LIGNK DL   REV++E+ KE A+ENG+ FLE SA TG++VE+AF+ETARKIYQ+IQEG +DLN++ +G V  R   P++++ S++       CSC
Sbjct:    8 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESG-VQHRPSQPSRTSLSSEATGAKDQCSC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0080626)

HSP 1 Score: 303.523 bits (776), Expect = 7.142e-102
Identity = 139/209 (66.51%), Postives = 174/209 (83.25%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQ-----KNCSC 731
            Y+YIFKYIIIGDMGVGKSCLLHQFTE KF+ +CPHTIGVEFGT+IIEV  +K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+D R+LT+P TV  LIGNK DL   REV++E+ KE A+ENG+ FLE SA TG++VE+AF+ETARKIYQ+IQEG +DLN++ +G V  R   P++++ S++       CSC
Sbjct:    8 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESG-VQHRPSQPSRTSLSSEATGAKDQCSC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0080627)

HSP 1 Score: 303.138 bits (775), Expect = 1.959e-101
Identity = 139/209 (66.51%), Postives = 174/209 (83.25%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQ-----KNCSC 731
            Y+YIFKYIIIGDMGVGKSCLLHQFTE KF+ +CPHTIGVEFGT+IIEV  +K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+D R+LT+P TV  LIGNK DL   REV++E+ KE A+ENG+ FLE SA TG++VE+AF+ETARKIYQ+IQEG +DLN++ +G V  R   P++++ S++       CSC
Sbjct:   32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESG-VQHRPSQPSRTSLSSEATGAKDQCSC 239          
BLAST of Ras-related protein Rab-14 vs. Ensembl Fly
Match: Rab2 (gene:FBgn0014009 transcript:FBtr0336658)

HSP 1 Score: 242.662 bits (618), Expect = 3.534e-78
Identity = 116/211 (54.98%), Postives = 154/211 (72.99%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVM--KRSPT----PAKSAQSNQKNCSC 731
            +Y+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G+++KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  ++   V +LIGNK DL+  REV  E+G+  A E+G+ F+E SART  +VE+AFI TA++IY+ IQEG  D+N+ +NG+ +  + SPT    P     +   N  C
Sbjct:    2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNPSLPGAGGAAGAANSGC 212          
BLAST of Ras-related protein Rab-14 vs. Ensembl Fly
Match: Rab2 (gene:FBgn0014009 transcript:FBtr0086124)

HSP 1 Score: 242.662 bits (618), Expect = 3.534e-78
Identity = 116/211 (54.98%), Postives = 154/211 (72.99%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVM--KRSPT----PAKSAQSNQKNCSC 731
            +Y+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G+++KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  ++   V +LIGNK DL+  REV  E+G+  A E+G+ F+E SART  +VE+AFI TA++IY+ IQEG  D+N+ +NG+ +  + SPT    P     +   N  C
Sbjct:    2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNPSLPGAGGAAGAANSGC 212          
BLAST of Ras-related protein Rab-14 vs. Ensembl Zebrafish
Match: rab14 (RAB14, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-030826-20])

HSP 1 Score: 316.235 bits (809), Expect = 9.909e-107
Identity = 147/210 (70.00%), Postives = 178/210 (84.76%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAK------SAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+KVKLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K  PT  +       AQ  ++ CSC
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHK--PTAPQGGRLSSDAQPQKEGCSC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Zebrafish
Match: rab14l (RAB14, member RAS oncogene family, like [Source:ZFIN;Acc:ZDB-GENE-040426-1207])

HSP 1 Score: 311.227 bits (796), Expect = 8.016e-105
Identity = 142/208 (68.27%), Postives = 174/208 (83.65%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+I+EVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIMEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSETQPQREGCGC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Zebrafish
Match: rab4b (RAB4B, member RAS oncogene family [Source:NCBI gene;Acc:445498])

HSP 1 Score: 243.817 bits (621), Expect = 1.527e-78
Identity = 113/212 (53.30%), Postives = 152/212 (71.70%), Query Frame = 3
Query:  111 SEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-----VMKRSPTPAKSAQSNQKNCSC 731
            SE Y ++FK+++IG  G GKSCLLHQF E+KF  D  HTIGVEFG++++ V G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDIT + T+N + +WL+DAR+L SP  V IL GNK DL+ +REV+F +    A+EN + FLE SA TGE+VE+AF++ AR I   I+ G +D     +G+      +++   P  SA   ++ C+C
Sbjct:    2 SETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARTLASPNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARSILNKIESGELDPERMGSGIQYGDASLRQIRQPRGSAAQTKQQCNC 213          
BLAST of Ras-related protein Rab-14 vs. Ensembl Zebrafish
Match: rab4b (RAB4B, member RAS oncogene family [Source:NCBI gene;Acc:445498])

HSP 1 Score: 243.817 bits (621), Expect = 1.527e-78
Identity = 113/212 (53.30%), Postives = 152/212 (71.70%), Query Frame = 3
Query:  111 SEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-----VMKRSPTPAKSAQSNQKNCSC 731
            SE Y ++FK+++IG  G GKSCLLHQF E+KF  D  HTIGVEFG++++ V G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDIT + T+N + +WL+DAR+L SP  V IL GNK DL+ +REV+F +    A+EN + FLE SA TGE+VE+AF++ AR I   I+ G +D     +G+      +++   P  SA   ++ C+C
Sbjct:    2 SETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARTLASPNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARSILNKIESGELDPERMGSGIQYGDASLRQIRQPRGSAAQTKQQCNC 213          
BLAST of Ras-related protein Rab-14 vs. Ensembl Zebrafish
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 238.81 bits (608), Expect = 1.374e-76
Identity = 110/184 (59.78%), Postives = 144/184 (78.26%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV 668
            AY+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G+++KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  ++   V +LIGNK DL   REV  E+G+  A E+G+ F+E SA+T  +VE+AFI TA++IY+ IQEG  D+N+ +NG+
Sbjct:    2 AYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGI 185          
BLAST of Ras-related protein Rab-14 vs. Ensembl Xenopus
Match: rab14 (RAB14, member RAS oncogene family [Source:NCBI gene;Acc:493231])

HSP 1 Score: 261.536 bits (667), Expect = 1.718e-85
Identity = 125/208 (60.10%), Postives = 156/208 (75.00%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIII                   + DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIII------------------VMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 197          
BLAST of Ras-related protein Rab-14 vs. Ensembl Xenopus
Match: rab14 (RAB14, member RAS oncogene family [Source:NCBI gene;Acc:493231])

HSP 1 Score: 258.07 bits (658), Expect = 6.037e-84
Identity = 122/206 (59.22%), Postives = 158/206 (76.70%), Query Frame = 3
Query:  126 YIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            Y +KY + G +   K+ L    +   F+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:   10 YTYKYNMAGTVPEPKA-LEETISPPWFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 214          
BLAST of Ras-related protein Rab-14 vs. Ensembl Xenopus
Match: RAB2A (RAB2A, member RAS oncogene family [Source:NCBI gene;Acc:100038062])

HSP 1 Score: 237.269 bits (604), Expect = 7.954e-76
Identity = 111/193 (57.51%), Postives = 147/193 (76.17%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-VMKRSPTP 692
            AY+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G+++KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  ++   V +LI NK DL   REV  E+G+  A E+G+ F+E SA+T  +VE+AFI TA++IY+ IQEG  D+N+ +NG+ +  +  TP
Sbjct:    2 AYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIANKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHSTP 194          
BLAST of Ras-related protein Rab-14 vs. Ensembl Xenopus
Match: hus1 (HUS1 checkpoint clamp component [Source:Xenbase;Acc:XB-GENE-983295])

HSP 1 Score: 237.269 bits (604), Expect = 9.578e-76
Identity = 110/184 (59.78%), Postives = 145/184 (78.80%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV 668
            +Y+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G+ +KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TF+ + SWL DAR  +S   V ILIGNK DL   R+VS E+G+  A E+G+ F+E SA+T  +VE+AFI+TA++IY+ IQ+G  D+N+ +NG+
Sbjct:    2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGKPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFSHLTSWLEDARQHSSSNMVIILIGNKSDLESRRDVSREEGEAFAREHGLIFMETSAKTAANVEEAFIDTAKEIYKKIQQGLFDVNNEANGI 185          
BLAST of Ras-related protein Rab-14 vs. Ensembl Xenopus
Match: map4 (microtubule associated protein 4 [Source:Xenbase;Acc:XB-GENE-6259104])

HSP 1 Score: 234.572 bits (597), Expect = 8.357e-75
Identity = 111/200 (55.50%), Postives = 145/200 (72.50%), Query Frame = 3
Query:  111 SEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVM-KRSPTPAKSAQ 707
            SE Y ++FK+++IG  G GKSCLLHQF E+KF  D  HTIGVEFG++I+ V G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDI  + T+N + +WL+DAR+L SP  + IL GNK DL+ +REV+F +    A+EN + FLE SA TGE+VE+AF++ AR I   I+ G +D     +G+     SP  AK + 
Sbjct:    2 SETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRIVNVGGKSVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDIASRETYNALTNWLTDARTLASPNIIIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILSKIESGELDPERMWSGIQYGDASPRHAKHSH 201          
BLAST of Ras-related protein Rab-14 vs. Ensembl Mouse
Match: Rab14 (RAB14, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1915615])

HSP 1 Score: 311.997 bits (798), Expect = 4.706e-105
Identity = 143/208 (68.75%), Postives = 174/208 (83.65%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Mouse
Match: Rab14 (RAB14, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1915615])

HSP 1 Score: 261.536 bits (667), Expect = 1.301e-85
Identity = 125/208 (60.10%), Postives = 156/208 (75.00%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIII                   + DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIII------------------VMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 197          
BLAST of Ras-related protein Rab-14 vs. Ensembl Mouse
Match: Rab4a (RAB4A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105069])

HSP 1 Score: 243.047 bits (619), Expect = 4.276e-78
Identity = 114/212 (53.77%), Postives = 151/212 (71.23%), Query Frame = 3
Query:  111 SEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-----VMKRSPTPAKSAQSNQKNCSC 731
            SE Y ++FK+++IG+ G GKSCLLHQF E KF  D  HTIGVEFG+KII V G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDIT + T+N + +WL+DAR L S   V IL GNK DL+ +REV+F +    A+EN + FLE SA TGE+VE+AF++ ARKI   I+ G +D     +G+      +++  +P ++   + + C C
Sbjct:    7 SETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVLILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRTQAPSAQECGC 218          
BLAST of Ras-related protein Rab-14 vs. Ensembl Mouse
Match: Rab4a (RAB4A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105069])

HSP 1 Score: 243.047 bits (619), Expect = 4.276e-78
Identity = 114/212 (53.77%), Postives = 151/212 (71.23%), Query Frame = 3
Query:  111 SEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-----VMKRSPTPAKSAQSNQKNCSC 731
            SE Y ++FK+++IG+ G GKSCLLHQF E KF  D  HTIGVEFG+KII V G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDIT + T+N + +WL+DAR L S   V IL GNK DL+ +REV+F +    A+EN + FLE SA TGE+VE+AF++ ARKI   I+ G +D     +G+      +++  +P ++   + + C C
Sbjct:    7 SETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVLILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRTQAPSAQECGC 218          
BLAST of Ras-related protein Rab-14 vs. Ensembl Mouse
Match: Rab2a (RAB2A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1928750])

HSP 1 Score: 241.506 bits (615), Expect = 1.351e-77
Identity = 115/202 (56.93%), Postives = 151/202 (74.75%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKN 722
            AY+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G+++KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  ++   V +LIGNK DL   REV  E+G+  A E+G+ F+E SA+T  +VE+AFI TA++IY+ IQEG  D+N+ +NG+  K  P  A +  S+  N
Sbjct:    2 AYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGI--KIGPQHAATNASHGSN 201          
BLAST of Ras-related protein Rab-14 vs. UniProt/SwissProt
Match: sp|Q5R8Z8|RAB14_PONAB (Ras-related protein Rab-14 OS=Pongo abelii OX=9601 GN=RAB14 PE=2 SV=3)

HSP 1 Score: 311.997 bits (798), Expect = 3.292e-104
Identity = 143/208 (68.75%), Postives = 174/208 (83.65%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 215          
BLAST of Ras-related protein Rab-14 vs. UniProt/SwissProt
Match: sp|Q91V41|RAB14_MOUSE (Ras-related protein Rab-14 OS=Mus musculus OX=10090 GN=Rab14 PE=1 SV=3)

HSP 1 Score: 311.997 bits (798), Expect = 3.292e-104
Identity = 143/208 (68.75%), Postives = 174/208 (83.65%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 215          
BLAST of Ras-related protein Rab-14 vs. UniProt/SwissProt
Match: sp|P61106|RAB14_HUMAN (Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4)

HSP 1 Score: 311.997 bits (798), Expect = 3.292e-104
Identity = 143/208 (68.75%), Postives = 174/208 (83.65%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 215          
BLAST of Ras-related protein Rab-14 vs. UniProt/SwissProt
Match: sp|Q5ZKU5|RAB14_CHICK (Ras-related protein Rab-14 OS=Gallus gallus OX=9031 GN=RAB14 PE=2 SV=3)

HSP 1 Score: 311.997 bits (798), Expect = 3.292e-104
Identity = 143/208 (68.75%), Postives = 174/208 (83.65%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 215          
BLAST of Ras-related protein Rab-14 vs. UniProt/SwissProt
Match: sp|P61107|RAB14_RAT (Ras-related protein Rab-14 OS=Rattus norvegicus OX=10116 GN=Rab14 PE=1 SV=3)

HSP 1 Score: 311.997 bits (798), Expect = 3.438e-104
Identity = 143/208 (68.75%), Postives = 174/208 (83.65%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 215          
BLAST of Ras-related protein Rab-14 vs. TrEMBL
Match: A0A0V0TLT6 (Ras-related protein Rab-14 (Fragment) OS=Trichinella murrelli OX=144512 GN=RAB14 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 7.126e-105
Identity = 141/208 (67.79%), Postives = 181/208 (87.02%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQ----KNCSC 731
            YS+IFKYIIIGDMGVGKSCLLHQFTE KF+PDCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT P TV  LIGNK DL+ +R+V++E+ K+ A+ENG+ F+ECSA+TG+HVED FI+TARKIYQ+IQ+G++DLN+A+    ++  P P ++  ++Q    K+C+C
Sbjct:   13 YSFIFKYIIIGDMGVGKSCLLHQFTEKKFMPDCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTHPNTVIFLIGNKSDLDGDRDVTYEEAKQFADENGLLFMECSAKTGDHVEDVFIDTARKIYQNIQDGSLDLNAAAADTGVQHKPHPQRTLTAHQPGEAKSCNC 220          
BLAST of Ras-related protein Rab-14 vs. TrEMBL
Match: A0A0V1NZU8 (Ras-related protein Rab-14 (Fragment) OS=Trichinella sp. T8 OX=92180 GN=RAB14 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 7.126e-105
Identity = 141/208 (67.79%), Postives = 181/208 (87.02%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQ----KNCSC 731
            YS+IFKYIIIGDMGVGKSCLLHQFTE KF+PDCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT P TV  LIGNK DL+ +R+V++E+ K+ A+ENG+ F+ECSA+TG+HVED FI+TARKIYQ+IQ+G++DLN+A+    ++  P P ++  ++Q    K+C+C
Sbjct:   13 YSFIFKYIIIGDMGVGKSCLLHQFTEKKFMPDCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTHPNTVIFLIGNKSDLDGDRDVTYEEAKQFADENGLLFMECSAKTGDHVEDVFIDTARKIYQNIQDGSLDLNAAAADTGVQHKPHPQRTLTAHQPGEAKSCNC 220          
BLAST of Ras-related protein Rab-14 vs. TrEMBL
Match: A0A0V1BQN0 (Ras-related protein Rab-14 (Fragment) OS=Trichinella spiralis OX=6334 GN=RAB14 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 7.126e-105
Identity = 141/208 (67.79%), Postives = 181/208 (87.02%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQ----KNCSC 731
            YS+IFKYIIIGDMGVGKSCLLHQFTE KF+PDCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT P TV  LIGNK DL+ +R+V++E+ K+ A+ENG+ F+ECSA+TG+HVED FI+TARKIYQ+IQ+G++DLN+A+    ++  P P ++  ++Q    K+C+C
Sbjct:   13 YSFIFKYIIIGDMGVGKSCLLHQFTEKKFMPDCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTHPNTVIFLIGNKSDLDGDRDVTYEEAKQFADENGLLFMECSAKTGDHVEDVFIDTARKIYQNIQDGSLDLNAAAADTGVQHKPHPQRTLTAHQPGEAKSCNC 220          
BLAST of Ras-related protein Rab-14 vs. TrEMBL
Match: A0A0V0S798 (Ras-related protein Rab-14 (Fragment) OS=Trichinella nelsoni OX=6336 GN=RAB14 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 7.126e-105
Identity = 141/208 (67.79%), Postives = 181/208 (87.02%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQ----KNCSC 731
            YS+IFKYIIIGDMGVGKSCLLHQFTE KF+PDCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT P TV  LIGNK DL+ +R+V++E+ K+ A+ENG+ F+ECSA+TG+HVED FI+TARKIYQ+IQ+G++DLN+A+    ++  P P ++  ++Q    K+C+C
Sbjct:   13 YSFIFKYIIIGDMGVGKSCLLHQFTEKKFMPDCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTHPNTVIFLIGNKSDLDGDRDVTYEEAKQFADENGLLFMECSAKTGDHVEDVFIDTARKIYQNIQDGSLDLNAAAADTGVQHKPHPQRTLTAHQPGEAKSCNC 220          
BLAST of Ras-related protein Rab-14 vs. TrEMBL
Match: A0A0V1A4R4 (Ras-related protein Rab-14 (Fragment) OS=Trichinella patagoniensis OX=990121 GN=RAB14 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 7.126e-105
Identity = 141/208 (67.79%), Postives = 181/208 (87.02%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQ----KNCSC 731
            YS+IFKYIIIGDMGVGKSCLLHQFTE KF+PDCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT P TV  LIGNK DL+ +R+V++E+ K+ A+ENG+ F+ECSA+TG+HVED FI+TARKIYQ+IQ+G++DLN+A+    ++  P P ++  ++Q    K+C+C
Sbjct:   13 YSFIFKYIIIGDMGVGKSCLLHQFTEKKFMPDCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTHPNTVIFLIGNKSDLDGDRDVTYEEAKQFADENGLLFMECSAKTGDHVEDVFIDTARKIYQNIQDGSLDLNAAAADTGVQHKPHPQRTLTAHQPGEAKSCNC 220          
BLAST of Ras-related protein Rab-14 vs. Ensembl Cavefish
Match: rab14 (ras-related protein Rab-14 [Source:NCBI gene;Acc:103026976])

HSP 1 Score: 316.235 bits (809), Expect = 8.398e-107
Identity = 147/210 (70.00%), Postives = 178/210 (84.76%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAK------SAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+KVKLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K  PT  +       AQ  ++ CSC
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHK--PTAPQGGRLSSDAQPQKEGCSC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Cavefish
Match: ENSAMXT00000039673.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000139.1:3081649:3095559:1 gene:ENSAMXG00000040126.1 transcript:ENSAMXT00000039673.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 310.457 bits (794), Expect = 7.908e-104
Identity = 142/208 (68.27%), Postives = 174/208 (83.65%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEV+G+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:   65 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVNGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 272          
BLAST of Ras-related protein Rab-14 vs. Ensembl Cavefish
Match: rab14 (ras-related protein Rab-14 [Source:NCBI gene;Acc:103026976])

HSP 1 Score: 266.159 bits (679), Expect = 1.529e-87
Identity = 129/210 (61.43%), Postives = 160/210 (76.19%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAK------SAQSNQKNCSC 731
            YSYIFKYIII                   + DCPHTIGVEFGT+IIEVSG+KVKLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K  PT  +       AQ  ++ CSC
Sbjct:    8 YSYIFKYIII------------------VMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHK--PTAPQGGRLSSDAQPQKEGCSC 197          
BLAST of Ras-related protein Rab-14 vs. Ensembl Cavefish
Match: ENSAMXT00000034024.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000139.1:3089060:3095193:1 gene:ENSAMXG00000040126.1 transcript:ENSAMXT00000034024.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 242.276 bits (617), Expect = 3.645e-78
Identity = 120/211 (56.87%), Postives = 153/211 (72.51%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENG---MFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIII                   + DCPHTIGVEFGT+IIEV+G+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG   +  +  S+R GE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIII------------------VMADCPHTIGVEFGTRIIEVNGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGEIVILLVSVSSR-GENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 199          
BLAST of Ras-related protein Rab-14 vs. Ensembl Cavefish
Match: rab4b (ras-related protein Rab-4B [Source:NCBI gene;Acc:103022831])

HSP 1 Score: 242.662 bits (618), Expect = 3.687e-78
Identity = 112/212 (52.83%), Postives = 152/212 (71.70%), Query Frame = 3
Query:  111 SEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-----VMKRSPTPAKSAQSNQKNCSC 731
            SE Y ++FK+++IG  G GKSCLLHQF E+KF  D  HTIGVEFG++++ V G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDIT + T+N + +WL+DAR+L SP  V IL GNK DL+ +REV+F +    A+EN + FLE SA TGE+VE+AF++ AR I   I+ G +D     +G+      +++   P  +A   ++ C+C
Sbjct:    2 SETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARTLASPNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIESGELDPERMGSGIQYGDASLRQLRQPRGTAAQTKQQCNC 213          
BLAST of Ras-related protein Rab-14 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002219.1 (pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene:ENSPMAG00000002006.1 transcript:ENSPMAT00000002219.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 317.005 bits (811), Expect = 7.535e-108
Identity = 146/208 (70.19%), Postives = 179/208 (86.06%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMK-RSPTP---AKSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+KVKLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV  LIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TG++VE+AF+ETA+KIYQ+IQ+G++DLN+A +GV  K  +P P   A  AQ  + +CSC
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGDNVEEAFLETAKKIYQNIQDGSLDLNAAESGVQHKPATPQPGRLASDAQPAKDSCSC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 243.817 bits (621), Expect = 3.220e-79
Identity = 116/210 (55.24%), Postives = 153/210 (72.86%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVM-----KRSPTPAKSAQSNQKNCSC 731
            +Y+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G++VKLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  ++   V +LIGNK DL   REV  E+G+  A E+G+ F+E SA+T  +VE+AFI TA++IY+ IQEG  D+N+ +NG+ +       SP  A S    Q++  C
Sbjct:    2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKREEGEAFAREHGLVFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAASSPGMASSQNRQQQDGGC 211          
BLAST of Ras-related protein Rab-14 vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 239.58 bits (610), Expect = 1.792e-77
Identity = 112/189 (59.26%), Postives = 146/189 (77.25%), Query Frame = 3
Query:  102 RMHSEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV 668
            R+   +Y+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G++VKLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  ++   V +LIGNK DL   REV  E+G+  A E+G+ F+E SA+T  +VE+AFI TAR+IY+ IQEG  D+N+ +NG+
Sbjct:    2 RLAVMSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMIAIGGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTAWLEDARQHSNSNMVIMLIGNKSDLESRREVKCEEGEAFAREHGLVFMETSAKTAANVEEAFINTAREIYEKIQEGVFDVNNEANGI 190          
BLAST of Ras-related protein Rab-14 vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 231.106 bits (588), Expect = 8.265e-75
Identity = 107/178 (60.11%), Postives = 138/178 (77.53%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLN 650
            +Y+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G++VKLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  +S   + +LIGNK DL   R+V  E+G+  A E+G+ F+E SA+T  +VE+AFI TA++IYQ I EG  D+N
Sbjct:    7 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNMIIMLIGNKSDLESRRDVKREEGEAFAREHGLVFMETSAKTAANVEEAFINTAKEIYQRIHEGVFDIN 184          
BLAST of Ras-related protein Rab-14 vs. Ensembl Sea Lamprey
Match: rab4b (RAB4B, member RAS oncogene family [Source:NCBI gene;Acc:445498])

HSP 1 Score: 224.557 bits (571), Expect = 1.224e-71
Identity = 107/209 (51.20%), Postives = 144/209 (68.90%), Query Frame = 3
Query:  126 YIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDIT--RKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-----VMKRSPTPAKSAQSNQKNCSC 731
            ++FK+++IG  G GKSCLLHQF E+KF  D  HTIGVEFG+K++   G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDIT   + T+N + +WL+DAR+L SP    IL GNK DL  +REV+F +    A+EN + FLE SA TGE+VE+AF++ AR I   I+ G +D     +G+      +++   P       + +C+C
Sbjct:   11 FLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSKVVNTGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSGSRETYNALTNWLADARTLASPNIAIILCGNKKDLEPDREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIESGELDPERMGSGIQYGDSTLRQLRQPRGVQAPAKPDCAC 219          
BLAST of Ras-related protein Rab-14 vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 192.2 bits (487), Expect = 2.456e-59
Identity = 97/222 (43.69%), Postives = 136/222 (61.26%), Query Frame = 3
Query:  105 MHSEAYSY----IFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLN-----------SASNGVVMKRSPTPAKSAQSNQKNC 725
            M SE Y Y    +FK ++IGD GVGKS LL +FT+++F  D   TIGVEF T+ +E+ G+++K QIWDTAGQER+RA+T +YYRGA GA++VYDI++ +++   + WLS+ R          LIGNK DL   R V  E+ K  A+EN + F E SA   E+V+ AF E    IYQ + +  +DL            SA NG  +  +PTP ++ ++N  NC
Sbjct:    1 MSSEDYGYDYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNC 222          
BLAST of Ras-related protein Rab-14 vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 179.489 bits (454), Expect = 1.308e-54
Identity = 86/180 (47.78%), Postives = 122/180 (67.78%), Query Frame = 3
Query:  105 MHSEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVD 644
            M+SE Y Y+FK ++IG+ GVGKSCLL +F++  +  D   TIGV+F  K +E+ G+ VKLQIWDTAGQERFR +T SYYRG+ G I+VYD+T + +FN V  WL +     +   + +L+GNK DL + R V ++  KE A+ N M FLE SA    +VEDAF+  AR+I + + + N++
Sbjct:    1 MNSE-YDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLN 179          
BLAST of Ras-related protein Rab-14 vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 179.874 bits (455), Expect = 1.536e-54
Identity = 90/212 (42.45%), Postives = 124/212 (58.49%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDL----------NSASNGVVMKRSPTPAKSAQSNQKNC 725
            Y Y+FK ++IGD GVGKS LL +FT  +F  +   TIGVEF T+ IEV  +K+K QIWDTAGQER+RA+T +YYRGA GA++VYDI++ +++   + WL++ R          LIGNK DL   R V  ++ K  A EN M F E SA   ++V+ AF E    I+Q + +  VDL          N A  G  +  +P P +  +    NC
Sbjct:   10 YDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNC 221          
BLAST of Ras-related protein Rab-14 vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 165.236 bits (417), Expect = 4.226e-49
Identity = 78/173 (45.09%), Postives = 114/173 (65.90%), Query Frame = 3
Query:  108 HSEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHI 626
            + ++Y  I K ++IGD GVGKSCLL +F E KF P    TIG++F  K ++++G+KVKLQ+WDTAGQERFR +T +YYRGA G ILVYD+T + TF  +  W        + +   +L+GNK D+ E R V+ + G+ LA+E G+ F+E SA+  ++V + F   A+ I + I
Sbjct:   13 NGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM-ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKI 184          
BLAST of Ras-related protein Rab-14 vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 137.117 bits (344), Expect = 1.654e-38
Identity = 78/216 (36.11%), Postives = 120/216 (55.56%), Query Frame = 3
Query:  132 FKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNE---NREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKI-YQHIQEGN------------VDLNSASNGVVMKRSPTPAKSAQSNQKNCSC 731
             K +++G+  VGKS ++ +F  + F  +   TIG  F T+ + ++   VK +IWDTAGQERF ++   YYR A  A++VYD+T+  +F +   W+ +     S   +  L+GNK D+ +    R+V+ E+G++LAEE G+ F E SA+TGE+V D F+    KI  +  +E N            VDLN+A++G       T A SA      CSC
Sbjct:    8 IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSASNERESNNQRVDLNAANDG-------TSANSA------CSC 210          
BLAST of Ras-related protein Rab-14 vs. Ensembl Nematostella
Match: EDO43319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ04])

HSP 1 Score: 314.309 bits (804), Expect = 1.661e-106
Identity = 145/209 (69.38%), Postives = 177/209 (84.69%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSA-----QSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV  LIGNK DL+  R+V++E+ K+ AEENG+ F E SA+TGE+VEDAF+ETA+KIYQ+IQ+G++DLN+A +GV  K      ++A     Q NQ  CSC
Sbjct:    9 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKSDLDAQRDVTYEEAKQFAEENGLLFCEASAKTGENVEDAFLETAKKIYQNIQDGSLDLNAAESGVQHKPLTGRPQNALNTDQQPNQDKCSC 217          
BLAST of Ras-related protein Rab-14 vs. Ensembl Nematostella
Match: EDO43047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZT6])

HSP 1 Score: 244.588 bits (623), Expect = 2.853e-79
Identity = 113/210 (53.81%), Postives = 150/210 (71.43%), Query Frame = 3
Query:  111 SEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-----VMKRSPTPAKSAQSNQKNC 725
            SE Y ++FK+++IG  G GKSC+LHQF E KF  D  HTIGVEFG+KI+ V G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDI+ + TFN + +WL+DAR+L SP  V IL+GNK DL+ +REV+F +    A+EN + FLE SA TGE+VE+ F++ +R I   I+ G +D +   +G+      M+RS  P +    N+  C
Sbjct:    2 SETYDFLFKFLVIGSAGTGKSCILHQFIEGKFKQDSSHTIGVEFGSKIVNVGGKSVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDISSRETFNSLTNWLTDARTLASPNIVIILVGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEGFLKCSRTILNKIESGELDPDRMGSGIQYGDPSMRRSIRPGRGRGDNKNKC 211          
BLAST of Ras-related protein Rab-14 vs. Ensembl Nematostella
Match: EDO36687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU3])

HSP 1 Score: 240.736 bits (613), Expect = 8.895e-78
Identity = 111/196 (56.63%), Postives = 149/196 (76.02%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSA 704
            +Y+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G+++KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  +S   V +LIGNK DL   R+V  E+G+  A E+G+ F+E SA+T  +VE+AFI TA++IYQ IQEG  D+N+ +NG+ +    +P+  +
Sbjct:    2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNMVIMLIGNKSDLEARRDVKKEEGEAFAREHGLIFMETSAKTAANVEEAFINTAKEIYQKIQEGVFDINNEANGIKLGPQHSPSNPS 197          
BLAST of Ras-related protein Rab-14 vs. Ensembl Nematostella
Match: EDO33074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST94])

HSP 1 Score: 177.948 bits (450), Expect = 1.710e-53
Identity = 91/210 (43.33%), Postives = 130/210 (61.90%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQ--------SNQKNC 725
            Y Y++K ++IGD GVGKS LL +FT ++F  +   TIGVEF T+ I+V G+ +K Q+WDTAGQER+RA+T +YYRGA GA+LVYD+T++ TF  V  WL + R    P  V +L+GNK DL   R V+ +D K+  +E+G+ F+E SA    +VE+AF +T  K++ H+Q     +    +G   +   T A   Q        S  KNC
Sbjct:    9 YDYLYKIVLIGDSGVGKSSLLSRFTRNEFDIESKSTIGVEFATRSIQVEGKIIKAQVWDTAGQERYRAITSAYYRGAVGAVLVYDLTKQKTFQDVERWLLEVREHADPTIVVMLVGNKCDLKHLRAVASDDAKKYGDEHGLAFIEASALDATNVEEAFQQTITKLH-HVQLAK--MKKELDGKDTREGQTAASKQQNSVDLNKPSQGKNC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Nematostella
Match: EDO44463 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVW8])

HSP 1 Score: 173.326 bits (438), Expect = 2.109e-52
Identity = 81/164 (49.39%), Postives = 109/164 (66.46%), Query Frame = 3
Query:  114 EAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETA 605
            + YSY+FK I++GD  VGK+CL+ QFT+  F P+   TIGV+F  K ++V GEKVKLQIWDTAGQERFR++T+SYY  A G I+ YDIT K +F  +  WL D    TS   +  ++GNK DL+ NR+V F   + LAE+     LE SA+  ++VE  F+  A
Sbjct:    2 DDYSYLFKIILVGDANVGKTCLVRQFTKGYFPPNQGPTIGVDFTIKTVDVDGEKVKLQIWDTAGQERFRSITQSYYHNADGVIVTYDITNKKSFESLPQWLDDTNRYTSKDVLIAIVGNKSDLSTNRKVDFHHAEALAEKENTVALETSAKEADNVELLFMSLA 165          
BLAST of Ras-related protein Rab-14 vs. Ensembl Medaka
Match: rab14 (ras-related protein Rab-14 [Source:NCBI gene;Acc:101162540])

HSP 1 Score: 311.997 bits (798), Expect = 3.672e-105
Identity = 143/208 (68.75%), Postives = 174/208 (83.65%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S           Q  ++ C C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Medaka
Match: ENSORLT00000033612.1 (ras-related protein Rab-14 [Source:NCBI gene;Acc:101167092])

HSP 1 Score: 307.76 bits (787), Expect = 1.371e-103
Identity = 140/208 (67.31%), Postives = 177/208 (85.10%), Query Frame = 3
Query:  120 YSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPA----KSAQSNQKNCSC 731
            YS+IFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+I+EV G+KVKLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ A+ENG+ FLE SA+TGE+VE+AF+E A++IYQ+IQ+G++DLN+A +GV  K S          +QS +++CSC
Sbjct:    8 YSFIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIMEVHGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFADENGLLFLEASAKTGENVEEAFLEAAKRIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLNSDSQSPKESCSC 215          
BLAST of Ras-related protein Rab-14 vs. Ensembl Medaka
Match: rab14 (ras-related protein Rab-14 [Source:NCBI gene;Acc:101162540])

HSP 1 Score: 286.189 bits (731), Expect = 2.049e-95
Identity = 132/196 (67.35%), Postives = 164/196 (83.67%), Query Frame = 3
Query:  156 MGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRS-PTPAK---SAQSNQKNCSC 731
            MGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIEVSG+K+KLQIWDTAGQERFRAVTRSYYRGAAGA++VYDITR++T+N + SWL+DAR+LT+P TV ILIGNK DL   R+V++E+ K+ AEENG+ FLE SA+TGE+VEDAF+E A+KIYQ+IQ+G++DLN+A +GV  K S P   +     Q  ++ C C
Sbjct:    1 MGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC 196          
BLAST of Ras-related protein Rab-14 vs. Ensembl Medaka
Match: rab2a (RAB2A, member RAS oncogene family [Source:NCBI gene;Acc:101175108])

HSP 1 Score: 242.276 bits (617), Expect = 5.639e-78
Identity = 114/201 (56.72%), Postives = 152/201 (75.62%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-VMKRSPTPAKSAQSNQ 716
            AY+Y+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G+++KLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  ++   V +LIGNK DL   REV  E+G+  A E+G+ F+E SA+T  +VE+AFI TA++IY+ IQEG  D+N+ +NG+ +  + PT   +  S+Q
Sbjct:    2 AYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHPTTNSTLSSSQ 202          
BLAST of Ras-related protein Rab-14 vs. Ensembl Medaka
Match: rab4b (ras-related protein Rab-4B [Source:NCBI gene;Acc:101159839])

HSP 1 Score: 241.891 bits (616), Expect = 7.886e-78
Identity = 112/212 (52.83%), Postives = 150/212 (70.75%), Query Frame = 3
Query:  111 SEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGV-----VMKRSPTPAKSAQSNQKNCSC 731
            SE Y ++FK+++IG  G GKSCLLHQF E+KF  D  HTIGVEFG+++I V G+ VKLQIWDTAGQERFR+VTRSYYRGAAGA+LVYDIT + T+N + +WL+DAR+L SP  V IL GNK DL+ +REV+F +    A+EN + FLE SA TGE+VE+ F++ AR I   I  G +D     +G+      +++   P  +   N++ C+C
Sbjct:    2 SETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVINVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALSNWLTDARTLASPNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEGFLKCARTILNKIDSGELDPERMGSGIQYGDASLRQLRQPRGTTTQNKQQCNC 213          
BLAST of Ras-related protein Rab-14 vs. Planmine SMEST
Match: SMESG000024495.1 (SMESG000024495.1)

HSP 1 Score: 440.269 bits (1131), Expect = 6.994e-156
Identity = 209/209 (100.00%), Postives = 209/209 (100.00%), Query Frame = 3
Query:  105 MHSEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKNCSC 731
            MHSEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKNCSC
Sbjct:    1 MHSEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKNCSC 209          
BLAST of Ras-related protein Rab-14 vs. Planmine SMEST
Match: SMESG000044270.1 (SMESG000044270.1)

HSP 1 Score: 333.183 bits (853), Expect = 1.071e-113
Identity = 151/208 (72.60%), Postives = 180/208 (86.54%), Query Frame = 3
Query:  108 HSEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKNCSC 731
             S  YSYIFKYIIIGDMGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIE++GEK+KLQIWDTAGQERFRAVTRSYYRGAAGA+LVYD+TRK+TFN +HSWL+DAR LTSP TV  +IGNK D+NE R+V++++GK +A+ENG+ FLECSA+TGE VEDAFIETARKI+Q+IQ+G+VDLNSA++GVVMK +     S   + K   C
Sbjct:    4 QSYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEINGEKIKLQIWDTAGQERFRAVTRSYYRGAAGALLVYDVTRKSTFNHIHSWLTDARGLTSPNTVIFMIGNKSDMNEQRDVTYDEGKAVADENGLMFLECSAKTGEGVEDAFIETARKIFQNIQDGSVDLNSANDGVVMKNNQGGQNSDGKSDKQTGC 211          
BLAST of Ras-related protein Rab-14 vs. Planmine SMEST
Match: SMESG000044270.1 (SMESG000044270.1)

HSP 1 Score: 307.375 bits (786), Expect = 7.730e-104
Identity = 138/192 (71.88%), Postives = 167/192 (86.98%), Query Frame = 3
Query:  156 MGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKNCSC 731
            MGVGKSCLLHQFTE KF+ DCPHTIGVEFGT+IIE++GEK+KLQIWDTAGQERFRAVTRSYYRGAAGA+LVYD+TRK+TFN +HSWL+DAR LTSP TV  +IGNK D+NE R+V++++GK +A+ENG+ FLECSA+TGE VEDAFIETARKI+Q+IQ+G+VDLNSA++GVVMK +     S   + K   C
Sbjct:    1 MGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEINGEKIKLQIWDTAGQERFRAVTRSYYRGAAGALLVYDVTRKSTFNHIHSWLTDARGLTSPNTVIFMIGNKSDMNEQRDVTYDEGKAVADENGLMFLECSAKTGEGVEDAFIETARKIFQNIQDGSVDLNSANDGVVMKNNQGGQNSDGKSDKQTGC 192          
BLAST of Ras-related protein Rab-14 vs. Planmine SMEST
Match: SMESG000076159.1 (SMESG000076159.1)

HSP 1 Score: 244.973 bits (624), Expect = 3.119e-79
Identity = 116/204 (56.86%), Postives = 152/204 (74.51%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKNCS 728
            +YSY+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G++VKLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TFN + +WL DAR  +S   V +LIGNK DL   R+V  E+G+  A E+G+ F+E SA+T  +VE+AFI TA+ IY+ IQEG +D+N+ +NG+ +    TP+ S     +N S
Sbjct:    2 SYSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSSSNMVIMLIGNKSDLEARRDVKREEGEAFAREHGLVFMETSAKTAANVEEAFINTAKAIYEKIQEGVLDINNEANGIKLGPQHTPSGSTAGLGQNRS 205          
BLAST of Ras-related protein Rab-14 vs. Planmine SMEST
Match: SMESG000017457.1 (SMESG000017457.1)

HSP 1 Score: 236.498 bits (602), Expect = 6.024e-76
Identity = 111/195 (56.92%), Postives = 148/195 (75.90%), Query Frame = 3
Query:  117 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKS 701
            +YSY+FKYIIIGD GVGKSCLL QFT+ +F P    TIGVEFG ++I + G++VKLQIWDTAGQE FR++TRSYYRGAAGA+LVYDITR+ TF+ + +WL DAR  +S   V +LIGNK DL   R+V  E+G+  A E+G+ F+E SA+T  +VE+AFI TA+ IY  IQEG +D+N+ +NG+ +  + + A +
Sbjct:    2 SYSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFDHLTTWLEDARQHSSSNMVIMLIGNKSDLENRRDVKREEGESFAHEHGLVFMETSAKTALNVEEAFINTAKAIYGKIQEGVLDINNEANGIKLGPNTSNANT 196          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-14 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB146.854e-10568.75RAB14, member RAS oncogene family [Source:HGNC Sym... [more]
RAB142.138e-9975.86RAB14, member RAS oncogene family [Source:HGNC Sym... [more]
RAB4A1.169e-7854.25RAB4A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB2A2.231e-7659.78RAB2A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB4B5.436e-7551.89RAB4B, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-145.123e-10669.12RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874][more]
rab-145.123e-10669.12RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874][more]
unc-1082.930e-7756.99pep chromosome:WBcel235:I:3824947:3826514:1 gene:W... [more]
unc-1083.176e-7755.72pep chromosome:WBcel235:I:3822883:3826514:1 gene:W... [more]
F11A5.31.230e-5544.78pep chromosome:WBcel235:V:16194939:16195544:1 gene... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab147.142e-10266.51gene:FBgn0015791 transcript:FBtr0343678[more]
Rab147.142e-10266.51gene:FBgn0015791 transcript:FBtr0080626[more]
Rab141.959e-10166.51gene:FBgn0015791 transcript:FBtr0080627[more]
Rab23.534e-7854.98gene:FBgn0014009 transcript:FBtr0336658[more]
Rab23.534e-7854.98gene:FBgn0014009 transcript:FBtr0086124[more]
back to top
BLAST of Ras-related protein Rab-14 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab149.909e-10770.00RAB14, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab14l8.016e-10568.27RAB14, member RAS oncogene family, like [Source:ZF... [more]
rab4b1.527e-7853.30RAB4B, member RAS oncogene family [Source:NCBI gen... [more]
rab4b1.527e-7853.30RAB4B, member RAS oncogene family [Source:NCBI gen... [more]
rab2a1.374e-7659.78RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab141.718e-8560.10RAB14, member RAS oncogene family [Source:NCBI gen... [more]
rab146.037e-8459.22RAB14, member RAS oncogene family [Source:NCBI gen... [more]
RAB2A7.954e-7657.51RAB2A, member RAS oncogene family [Source:NCBI gen... [more]
hus19.578e-7659.78HUS1 checkpoint clamp component [Source:Xenbase;Ac... [more]
map48.357e-7555.50microtubule associated protein 4 [Source:Xenbase;A... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab144.706e-10568.75RAB14, member RAS oncogene family [Source:MGI Symb... [more]
Rab141.301e-8560.10RAB14, member RAS oncogene family [Source:MGI Symb... [more]
Rab4a4.276e-7853.77RAB4A, member RAS oncogene family [Source:MGI Symb... [more]
Rab4a4.276e-7853.77RAB4A, member RAS oncogene family [Source:MGI Symb... [more]
Rab2a1.351e-7756.93RAB2A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R8Z8|RAB14_PONAB3.292e-10468.75Ras-related protein Rab-14 OS=Pongo abelii OX=9601... [more]
sp|Q91V41|RAB14_MOUSE3.292e-10468.75Ras-related protein Rab-14 OS=Mus musculus OX=1009... [more]
sp|P61106|RAB14_HUMAN3.292e-10468.75Ras-related protein Rab-14 OS=Homo sapiens OX=9606... [more]
sp|Q5ZKU5|RAB14_CHICK3.292e-10468.75Ras-related protein Rab-14 OS=Gallus gallus OX=903... [more]
sp|P61107|RAB14_RAT3.438e-10468.75Ras-related protein Rab-14 OS=Rattus norvegicus OX... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0TLT67.126e-10567.79Ras-related protein Rab-14 (Fragment) OS=Trichinel... [more]
A0A0V1NZU87.126e-10567.79Ras-related protein Rab-14 (Fragment) OS=Trichinel... [more]
A0A0V1BQN07.126e-10567.79Ras-related protein Rab-14 (Fragment) OS=Trichinel... [more]
A0A0V0S7987.126e-10567.79Ras-related protein Rab-14 (Fragment) OS=Trichinel... [more]
A0A0V1A4R47.126e-10567.79Ras-related protein Rab-14 (Fragment) OS=Trichinel... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab148.398e-10770.00ras-related protein Rab-14 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000039673.17.908e-10468.27pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
rab141.529e-8761.43ras-related protein Rab-14 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000034024.13.645e-7856.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
rab4b3.687e-7852.83ras-related protein Rab-4B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002219.17.535e-10870.19pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene... [more]
rab2a3.220e-7955.24RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
RAB2B1.792e-7759.26RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB2B8.265e-7560.11RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
rab4b1.224e-7151.20RAB4B, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT312.456e-5943.69Rab family GTPase; involved in the exocytic pathwa... [more]
YPT11.308e-5447.78Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT321.536e-5442.45Rab family GTPase involved in the exocytic pathway... [more]
SEC44.226e-4945.09Rab family GTPase; essential for vesicle-mediated ... [more]
VPS211.654e-3836.11Endosomal Rab family GTPase; required for endocyti... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433191.661e-10669.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430472.853e-7953.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366878.895e-7856.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330741.710e-5343.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444632.109e-5249.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab143.672e-10568.75ras-related protein Rab-14 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000033612.11.371e-10367.31ras-related protein Rab-14 [Source:NCBI gene;Acc:1... [more]
rab142.049e-9567.35ras-related protein Rab-14 [Source:NCBI gene;Acc:1... [more]
rab2a5.639e-7856.72RAB2A, member RAS oncogene family [Source:NCBI gen... [more]
rab4b7.886e-7852.83ras-related protein Rab-4B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ras-related protein Rab-14 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024495.16.994e-156100.00SMESG000024495.1[more]
SMESG000044270.11.071e-11372.60SMESG000044270.1[more]
SMESG000044270.17.730e-10471.88SMESG000044270.1[more]
SMESG000076159.13.119e-7956.86SMESG000076159.1[more]
SMESG000017457.16.024e-7656.92SMESG000017457.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027146 ID=SMED30027146|Name=Ras-related protein Rab-14|organism=Schmidtea mediterranea sexual|type=transcript|length=1353bp
CCTCAATAATTTGTATATTTTCCTTAGTCTTTACACAATCAGTTGATAAT
TAGGACTGCACGGAATTTCAATTTCAAAACTCTATATTAACAATTTTTGA
CAGAATGCATTCAGAAGCTTATTCTTATATTTTCAAATATATTATCATTG
GAGATATGGGAGTCGGAAAAAGTTGTTTGTTGCATCAATTTACAGAAAGC
AAATTCTTGCCTGACTGTCCCCACACGATCGGAGTTGAATTCGGAACGAA
AATTATTGAGGTATCCGGTGAAAAGGTGAAATTACAAATTTGGGATACTG
CTGGTCAGGAACGATTCCGAGCTGTAACCCGGTCATACTACAGAGGTGCT
GCTGGAGCTATTCTTGTGTATGATATTACGAGGAAGGCCACGTTTAATCG
AGTTCACTCATGGCTGAGTGACGCTCGTAGCCTGACCTCACCACAAACTG
TTTTCATTTTAATTGGAAATAAAGGAGACTTAAATGAAAATAGAGAAGTC
TCATTTGAAGACGGGAAAGAATTAGCTGAAGAAAACGGAATGTTTTTCTT
GGAATGTAGTGCTAGGACAGGTGAACATGTCGAGGATGCATTCATTGAAA
CGGCGAGAAAGATTTATCAACACATTCAGGAAGGAAATGTTGATTTGAAT
TCCGCTTCAAATGGTGTTGTCATGAAGCGATCTCCGACCCCTGCAAAGTC
TGCCCAAAGCAACCAAAAAAATTGCTCTTGTTAATATGTTCTGATTTACA
GACTTATGCAGAATTTGCCTTATGGATTTGTTGAAATTGTAATATTCTTT
CAACCGTTCCACATTTTCATTCCCATAATTTTGTTGTTTTTGTAATATTT
TCAAATGCTCACTTGTTTTCTGTGTTTGCAGGAATAACAATGACTTTTAT
ACGTGGTGGCTGCGGCCCAGTAGCTCCCTTGGCTGGCATTGAGTAGAGAT
TTATAAATGTGTTTATGGCTGTGACGGCTTAGTCATGATGATGTACCAGT
TCTCTGTTATTATTATTATATTGATTTTAAAATATTATTATCGATTATTA
TATCGATTACCAAAATATTGTGCTATTGATCCAATCGAACACACACACAC
AAGCTATCTCAATTAGAGCCAATTATATCATTAAATTATATAACTAACCA
ATCATATTTCTAGCGTAGCAACTGTCATTGTTTATCATTTATTTATCGAT
TTTCAATTTCGATTTCTTGGATTTGGAGCTTGTAATTCTTCTTTTTTCAA
TATAATTTGTTGTTATTATTATTATTCTTATTTATGTCGCTTTCTAATTT
GTAAGTAGTTGGTAAAAAACATTAAATCTAGATTAAATTTTCAATAAAAA
TCT
back to top

protein sequence of SMED30027146-orf-1

>SMED30027146-orf-1 ID=SMED30027146-orf-1|Name=SMED30027146-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
MHSEAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKI
IEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRV
HSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLE
CSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSA
QSNQKNCSC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR030702Rab14
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0016192vesicle-mediated transport
GO:0030100regulation of endocytosis
GO:0032456endocytic recycling
GO:0032880regulation of protein localization
GO:0042742defense response to bacterium
GO:0045176apical protein localization
GO:0046907intracellular transport
GO:0061024membrane organization
GO:0090382phagosome maturation
GO:0006810transport
GO:0006895Golgi to endosome transport
GO:0007589body fluid secretion
GO:0008543fibroblast growth factor receptor signaling pathway
GO:0009790embryo development
GO:0015031protein transport
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0001948glycoprotein binding
GO:0003924GTPase activity
GO:0005515protein binding
GO:0019003GDP binding
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0030133transport vesicle
GO:0030140trans-Golgi network transport vesicle
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0031901early endosome membrane
GO:0042175nuclear outer membrane-endoplasmic reticulum membrane network
GO:0045335phagocytic vesicle
GO:0048471perinuclear region of cytoplasm
GO:0055037recycling endosome
GO:0097208alveolar lamellar body
GO:0005764lysosome
GO:0005768endosome
GO:0005769early endosome
GO:0005770late endosome
GO:0005791rough endoplasmic reticulum
GO:0005794Golgi apparatus
GO:0005795Golgi stack
GO:0005802trans-Golgi network
GO:0005829cytosol
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 10..31
score: 50.11
coord: 51..73
score: 55.15
coord: 113..126
score: 45.29
coord: 33..49
score: 31.99
coord: 148..170
score: 39.46
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 10..173
e-value: 9.3E-100
score: 347.4
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 15..209
e-value: 2.6E-4
score: 12.7
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 7..173
e-value: 3.2E-29
score: 113.1
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 12..173
e-value: 5.5E-9
score: -3.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 3..209
e-value: 1.1E-66
score: 226.0
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 6..193
NoneNo IPR availablePROSITEPS51419RABcoord: 5..207
score: 35.082
IPR001806Small GTPasePFAMPF00071Rascoord: 11..171
e-value: 9.4E-59
score: 197.6
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 9..163
e-value: 1.4E-27
score: 94.5
IPR030702Ras-related protein Rab14PANTHERPTHR24073:SF1098coord: 6..193
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 6..204