TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30027110
Length (bp)1501
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30027110) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30027110) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30027110) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30027110) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027110

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027110SMESG000070236.1 SMESG000070235.1 dd_Smed_v4_7291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027110SMESG000070236.1 SMESG000070235.1 dd_Smed_v4_7291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027110SMESG000070236.1 SMESG000070235.1 dd_Smed_v4_7291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027110SMESG000070236.1 SMESG000070235.1 dd_Smed_v4_7291_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 121.709 bits (304), Expect = 2.932e-29
Identity = 107/448 (23.88%), Postives = 199/448 (44.42%), Query Frame = 2
Query:  191 CTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKC--PEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMT----------EESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELP---------------TDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRF-----MSATSSLRCISANEDIAPFE---------WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            C  C  +L  P Q+ CG R+C SC+   L S +  C      C+E  V   + +  D+   + +LA+++ C    + C  +  L +L+ HLK+   +C F E+ C   + K + + + +           E + SH       +  +  ++ +L+     K K+I  L NQ+ +  ++  ++  +++ + S + ++ ++      +L                 DS++ + +      TE ESV  +  +  +  +G   S+      M +   +R    +      E         WKI D+  R QEA    +  +YS+PFY+   GYK+  RV  NG G  + THLS+FF I+ GE+D  L WP +++V + L+DQ S++  + D ++       F+    KP+    IA     G P  +   ++  NG  +K+  I  +  ++
Sbjct:   53 CEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIV--KDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKN---DCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC---KSQVPMIALQVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQV-ARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFK----KPTGEMNIAS----GCPVFV-AQTVLENGTYIKDDTIFIKVIVD 478          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 110.153 bits (274), Expect = 4.585e-25
Identity = 111/500 (22.20%), Postives = 200/500 (40.00%), Query Frame = 2
Query:  191 CTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKC--PEKACDTKAELKNLMEHLKSH--------------------------SINCPFHEMGCSH------------------------------------SNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELP---------------TDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRF-----MSATSSLRCISANEDIAPFE---------WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            C  C  +L  P Q+ CG R+C SC+   L S +  C      C+E  V   + +  D+   + +LA+++ C    + C  +  L +L+ HLK+                              C + E  CSH                                    S   +Q +  H    +  H  LL E   +++ ++ +L+     K K+I  L NQ+ +  ++  ++  +++ + S + ++ ++      +L                 DS++ + +      TE ESV  +  +  +  +G   S+      M +   +R    +      E         WKI D+  R QEA    +  +YS+PFY+   GYK+  RV  NG G  + THLS+FF I+ GE+D  L WP +++V + L+DQ S++  + D ++       F+    KP+    IA     G P  +   ++  NG  +K+  I  +  ++
Sbjct:   53 CEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIV--KDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQV-ARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFK----KPTGEMNIAS----GCPVFV-AQTVLENGTYIKDDTIFIKVIVD 536          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 110.153 bits (274), Expect = 4.585e-25
Identity = 111/500 (22.20%), Postives = 200/500 (40.00%), Query Frame = 2
Query:  191 CTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKC--PEKACDTKAELKNLMEHLKSH--------------------------SINCPFHEMGCSH------------------------------------SNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELP---------------TDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRF-----MSATSSLRCISANEDIAPFE---------WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            C  C  +L  P Q+ CG R+C SC+   L S +  C      C+E  V   + +  D+   + +LA+++ C    + C  +  L +L+ HLK+                              C + E  CSH                                    S   +Q +  H    +  H  LL E   +++ ++ +L+     K K+I  L NQ+ +  ++  ++  +++ + S + ++ ++      +L                 DS++ + +      TE ESV  +  +  +  +G   S+      M +   +R    +      E         WKI D+  R QEA    +  +YS+PFY+   GYK+  RV  NG G  + THLS+FF I+ GE+D  L WP +++V + L+DQ S++  + D ++       F+    KP+    IA     G P  +   ++  NG  +K+  I  +  ++
Sbjct:   53 CEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIV--KDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQV-ARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFK----KPTGEMNIAS----GCPVFV-AQTVLENGTYIKDDTIFIKVIVD 536          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 107.071 bits (266), Expect = 3.632e-24
Identity = 112/482 (23.24%), Postives = 195/482 (40.46%), Query Frame = 2
Query:  110 NSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCS---------HSN-----------VKSQAMVQHMTEES----------------YSHTILLMESIQNMKNEIEILRENLQRKEKTIG--------KLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQ---INQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPN-GFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +S F E  Q    YD + D  L S   C IC   L    Q+PCG R+C +CI K ++     CP   +      + + N L  D+FA + +L++ VKCP + C  K EL+    HL+ H  +C F  M C          H N           V        M  E                 Y +TIL+ E + N   +++     +     T G         L   L+ NT  H + +A     +S++ +   I +    +     ++   + QD  I + T        + ET S +    +    +    +  I A +    + WKI +F   ++  + +   VI+S  FY+ + GYKL +R++      +    ++S+F   ++GE+D  L WP +  + + ++DQ  ++  V   +      K   + F +P+          +G  T +HL +L      +K+  +L RC ++
Sbjct:   46 SSSFMEEIQ---GYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELR----HLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPN-HYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELT-------AKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQ--SEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKG---FGYVTFMHLEAL-RQRTFIKDDTLLVRCEVS 500          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 107.071 bits (266), Expect = 3.632e-24
Identity = 112/482 (23.24%), Postives = 195/482 (40.46%), Query Frame = 2
Query:  110 NSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCS---------HSN-----------VKSQAMVQHMTEES----------------YSHTILLMESIQNMKNEIEILRENLQRKEKTIG--------KLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQ---INQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPN-GFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +S F E  Q    YD + D  L S   C IC   L    Q+PCG R+C +CI K ++     CP   +      + + N L  D+FA + +L++ VKCP + C  K EL+    HL+ H  +C F  M C          H N           V        M  E                 Y +TIL+ E + N   +++     +     T G         L   L+ NT  H + +A     +S++ +   I +    +     ++   + QD  I + T        + ET S +    +    +    +  I A +    + WKI +F   ++  + +   VI+S  FY+ + GYKL +R++      +    ++S+F   ++GE+D  L WP +  + + ++DQ  ++  V   +      K   + F +P+          +G  T +HL +L      +K+  +L RC ++
Sbjct:   46 SSSFMEEIQ---GYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELR----HLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPN-HYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELT-------AKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQ--SEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKG---FGYVTFMHLEAL-RQRTFIKDDTLLVRCEVS 500          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 75.8702 bits (185), Expect = 1.505e-14
Identity = 44/132 (33.33%), Postives = 62/132 (46.97%), Query Frame = 2
Query:  812 ICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAP-FEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQ 1204
            +CD   +    Y   E D      R++R +SA  +       E   P   WKI+    R  EAKS     I+S PF SHR GYK+       G G      +S++  +++GEFD +L WP  R + I L+DQ
Sbjct:  222 LCDEITDLKGTYELMERDMGSFNDRQTRILSAAET-----CTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQ 348          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 58.151 bits (139), Expect = 5.160e-9
Identity = 28/71 (39.44%), Postives = 40/71 (56.34%), Query Frame = 2
Query:  986 VQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLV 1198
            V+  K+K  + IYS+PFYSH  GYK+     P G G     + SVF  +++GE+DD L WP    V   ++
Sbjct:  172 VKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSIL 242          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 77.0258 bits (188), Expect = 9.180e-15
Identity = 44/153 (28.76%), Postives = 76/153 (49.67%), Query Frame = 2
Query:  959 WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQ--VSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            WKI D+  ++ EA+ K    + S PFY+ + GYKL+  +  NG G  ENTH+SV+  ++ GE+D  L WP    +   L +Q +   Q  V++ +      ++FQ   ++P       D   +G P  I  + L ++   +K   +  R  ++
Sbjct:  326 WKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEP-------DQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 76.6406 bits (187), Expect = 1.222e-14
Identity = 44/153 (28.76%), Postives = 76/153 (49.67%), Query Frame = 2
Query:  959 WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQ--VSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            WKI D+  ++ EA+ K    + S PFY+ + GYKL+  +  NG G  ENTH+SV+  ++ GE+D  L WP    +   L +Q +   Q  V++ +      ++FQ   ++P       D   +G P  I  + L ++   +K   +  R  ++
Sbjct:  335 WKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEP-------DQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKVD 479          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 60.4622 bits (145), Expect = 2.123e-9
Identity = 28/91 (30.77%), Postives = 50/91 (54.95%), Query Frame = 2
Query:  959 WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSD 1231
            W+I+D+  +++E+K +   +++S  F +   GY LRL +  NG G W+  ++    +++ GE+D  L WP   Q  I + DQ +N     D
Sbjct:  338 WRIKDYSKKLEESK-QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAED 427          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074273)

HSP 1 Score: 59.6918 bits (143), Expect = 3.261e-9
Identity = 28/91 (30.77%), Postives = 50/91 (54.95%), Query Frame = 2
Query:  959 WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSD 1231
            W+I+D+  +++E+K +   +++S  F +   GY LRL +  NG G W+  ++    +++ GE+D  L WP   Q  I + DQ +N     D
Sbjct:  316 WRIKDYSKKLEESK-QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAED 405          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 59.3066 bits (142), Expect = 3.434e-9
Identity = 28/91 (30.77%), Postives = 50/91 (54.95%), Query Frame = 2
Query:  959 WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSD 1231
            W+I+D+  +++E+K +   +++S  F +   GY LRL +  NG G W+  ++    +++ GE+D  L WP   Q  I + DQ +N     D
Sbjct:  259 WRIKDYSKKLEESK-QYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAED 348          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 122.865 bits (307), Expect = 1.224e-29
Identity = 113/487 (23.20%), Postives = 195/487 (40.04%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKN------------------------EIEILRENLQR-------------KEKTIGKLQNQLRNNTLQHNKEIAIMKKDI----------------SLLKNVSKIEKGTTAELPTDSIQINQD------------GTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTH-LSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            YD + D  L S   C IC   L    Q+PCG R+C SCI K ++   + CP   +      V +   L  D+FA + +L++ VKC    C  K EL+ L +HL      C F    C     +    + H+ E    H +  + +  +                           E+E++R+ L                  T G  +   RN   QH +E   M                    S   ++S  ++G +A  P DS Q  Q+            G +    ++       ++T  +     R + +S   S R + A +    + W++E+F + ++  ++    V++S PFY+ R GYKL LR++         ++ +S+F   ++GEFD  L WP++  + + ++DQV  +  +         + D Q  F +P   T + +   +G  T +HL +L   G  +K   +L RC + 
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLS----QCRFATAPCP--QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSP-DSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIE----VMETKPDLQA-FQRP---TVMRNPKGFGYVTFLHLQALRQRG-FVKEDVLLVRCEVT 521          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 122.865 bits (307), Expect = 1.224e-29
Identity = 113/487 (23.20%), Postives = 195/487 (40.04%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKN------------------------EIEILRENLQR-------------KEKTIGKLQNQLRNNTLQHNKEIAIMKKDI----------------SLLKNVSKIEKGTTAELPTDSIQINQD------------GTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTH-LSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            YD + D  L S   C IC   L    Q+PCG R+C SCI K ++   + CP   +      V +   L  D+FA + +L++ VKC    C  K EL+ L +HL      C F    C     +    + H+ E    H +  + +  +                           E+E++R+ L                  T G  +   RN   QH +E   M                    S   ++S  ++G +A  P DS Q  Q+            G +    ++       ++T  +     R + +S   S R + A +    + W++E+F + ++  ++    V++S PFY+ R GYKL LR++         ++ +S+F   ++GEFD  L WP++  + + ++DQV  +  +         + D Q  F +P   T + +   +G  T +HL +L   G  +K   +L RC + 
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLS----QCRFATAPCP--QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSP-DSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIE----VMETKPDLQA-FQRP---TVMRNPKGFGYVTFLHLQALRQRG-FVKEDVLLVRCEVT 521          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 122.865 bits (307), Expect = 1.224e-29
Identity = 113/487 (23.20%), Postives = 195/487 (40.04%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKN------------------------EIEILRENLQR-------------KEKTIGKLQNQLRNNTLQHNKEIAIMKKDI----------------SLLKNVSKIEKGTTAELPTDSIQINQD------------GTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTH-LSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            YD + D  L S   C IC   L    Q+PCG R+C SCI K ++   + CP   +      V +   L  D+FA + +L++ VKC    C  K EL+ L +HL      C F    C     +    + H+ E    H +  + +  +                           E+E++R+ L                  T G  +   RN   QH +E   M                    S   ++S  ++G +A  P DS Q  Q+            G +    ++       ++T  +     R + +S   S R + A +    + W++E+F + ++  ++    V++S PFY+ R GYKL LR++         ++ +S+F   ++GEFD  L WP++  + + ++DQV  +  +         + D Q  F +P   T + +   +G  T +HL +L   G  +K   +L RC + 
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLS----QCRFATAPCP--QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSP-DSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIE----VMETKPDLQA-FQRP---TVMRNPKGFGYVTFLHLQALRQRG-FVKEDVLLVRCEVT 521          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 100.523 bits (249), Expect = 2.534e-22
Identity = 107/465 (23.01%), Postives = 189/465 (40.65%), Query Frame = 2
Query:  191 CTICEKILNRPYQ-SPCGCRYCYSCIEKHLKSGNKYCPK---PTDDCREQCVDINNNLQFDHFANKNVLAIKVKC--PEKACDTKAELKNLMEHLKSHSIN---CPFH--------------EMGCSHSNVKSQAMVQHMTEESYS--HTILLMESIQ-NMKNEIEILRENLQRKEKTIGKLQNQ--------LRNNTLQ----HNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVH---------YTESETDSHFS------GTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQ----VSNKIQVSDKYRWKSVEKDFQVIFHKP-STRTEIADYYF-YGTPTLIHLNSLFNNGKLLKNGAILFRCSI 1408
            C +C K +  P Q S CG R+C +C+++ L  G   CP+   P D  +         +  D    + +LA+ ++C   E+ C    ++K L  H  + + N   CP                +  C    VK +      T E+Y     I   ES+    K    ++R  L +   T    + Q           +T+Q    H     +   +     N+++ +     +    S  +     +C F E    H         + E  T SH +      G +R   +     +  +S + D     WK+ D+  ++QEAK + +   +S PFY+HR GYKL++    NG G  E +HLS++  ++ GE+D+ L WP   +V   ++DQ    +S    +++ +      K+FQ    KP S+R  + +    +G P  I    +      +++ +I  + SI
Sbjct:   18 CPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAK---------IYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYENHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALV-----LCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCSLVGRQRQEILELRREMEELSVSHDGV-LIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQ----KPCSSRNSLDESTLGFGYPKFISHEEI-KKRNYIRDNSIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 100.523 bits (249), Expect = 2.534e-22
Identity = 107/465 (23.01%), Postives = 189/465 (40.65%), Query Frame = 2
Query:  191 CTICEKILNRPYQ-SPCGCRYCYSCIEKHLKSGNKYCPK---PTDDCREQCVDINNNLQFDHFANKNVLAIKVKC--PEKACDTKAELKNLMEHLKSHSIN---CPFH--------------EMGCSHSNVKSQAMVQHMTEESYS--HTILLMESIQ-NMKNEIEILRENLQRKEKTIGKLQNQ--------LRNNTLQ----HNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVH---------YTESETDSHFS------GTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQ----VSNKIQVSDKYRWKSVEKDFQVIFHKP-STRTEIADYYF-YGTPTLIHLNSLFNNGKLLKNGAILFRCSI 1408
            C +C K +  P Q S CG R+C +C+++ L  G   CP+   P D  +         +  D    + +LA+ ++C   E+ C    ++K L  H  + + N   CP                +  C    VK +      T E+Y     I   ES+    K    ++R  L +   T    + Q           +T+Q    H     +   +     N+++ +     +    S  +     +C F E    H         + E  T SH +      G +R   +     +  +S + D     WK+ D+  ++QEAK + +   +S PFY+HR GYKL++    NG G  E +HLS++  ++ GE+D+ L WP   +V   ++DQ    +S    +++ +      K+FQ    KP S+R  + +    +G P  I    +      +++ +I  + SI
Sbjct:   18 CPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAK---------IYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYENHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALV-----LCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCSLVGRQRQEILELRREMEELSVSHDGV-LIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQ----KPCSSRNSLDESTLGFGYPKFISHEEI-KKRNYIRDNSIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 105.531 bits (262), Expect = 1.366e-23
Identity = 111/495 (22.42%), Postives = 196/495 (39.60%), Query Frame = 2
Query:  191 CTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDD-----------CREQCVDINNNLQFDHFANKNVLAI--------------KVKCPEKACDTKAELKNLMEHL------------------------KSHSINCPFHEMGCSH-SNVKS--------QAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQ--------------LRNNTLQHNKEIAIMKKDISLLKNVSK-IEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRF--MSATSSLRCISANEDIAPFE---------WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN*AHL 1423
            C  C  +L  P Q+ CG R+C +C+   L S +  C    D+           CR + + +    + +    K ++ +              ++ CP   C  K   K+L +H+                        K   ++CP   + C H  +VKS        Q +  H    +  H  L+ E    ++ ++ +L+     K K+I  L NQ              LRNN  +  +   +++     LK++ K I          D ++ N +      ++ E +    +  +     T+ +R   M +   +R    +      E         WKI D+  R QEA    +  +YS+PFY+   GYK+  RV  NG G  + THLS+FF I+ GE+D  L WP +++V + L+DQ  ++  + D ++       F+    KP+    IA     G P  +   ++  NG  +K+  I  +  ++ + L
Sbjct:   48 CEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFK----KPTGEMNIAS----GCPVFV-AQTVLENGTYIKDDTIFIKVIVDTSDL 533          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 98.2117 bits (243), Expect = 3.241e-21
Identity = 98/418 (23.44%), Postives = 177/418 (42.34%), Query Frame = 2
Query:  263 IEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKN-----LMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQ--------------LRNNTLQHNKEIAIMKKDISLLKNVSK-IEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRF--MSATSSLRCISANEDIAPFE---------WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN*AHL 1423
            +  H++   KY   P   CR Q   +    +     + +  ++ + CP   C  K+ L++     L+E + + S  C F   GC+     +Q +  H    +  H  L+ E    ++ ++ +L+     K K+I  L NQ              LRNN  +  +   +++     LK++ K I          D ++ N +      ++ E +    +  +     T+ +R   M +   +R    +      E         WKI D+  R QEA    +  +YS+PFY+   GYK+  RV  NG G  + THLS+FF I+ GE+D  L WP +++V + L+DQ  ++  + D ++       F+    KP+    IA     G P  +   ++  NG  +K+  I  +  ++ + L
Sbjct:  157 LSDHIEKTCKYRETPCKFCRNQVPLV----EMQKHEDVDCPSVVISCPH-MCSVKSLLRSELNAHLLECVNAPS-TCSFKRYGCTFKGT-NQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFK----KPTGEMNIAS----GCPVFV-AQTVLENGTYIKDDTIFIKVIVDTSDL 558          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 95.5153 bits (236), Expect = 2.596e-20
Identity = 116/510 (22.75%), Postives = 203/510 (39.80%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCS--HSNVKSQAMVQHMTEESYSHTIL-----LMESIQNMKNE----------IEILRENLQRKEKT------------------IGKLQNQLRNNTLQHNKEI--AIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEE-------SVHYTESETDSHFSGTRRS-------------------RFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIY----------------SKPFYSHRNG-------YKLRLRVN---PNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            YD + D  L S   C IC   L    Q+PCG R+C +CI K ++     CP   +   E      N L  D+FA + +L+++VKCP + C    EL+    HL+ H + C F  + CS   S+    ++ +H  EE     I      L  ++++  N            E  + NL R++                     G  +   RN+  +H +E   A M+     L++ S      T+ +P        D + CD ++ E       +VH + + + +  +   R+                   R + A    +C   NE     +  I    NR+ E +S+    I+                 +P   H  G       YKL LR++   P+   +    ++S+F   ++GE+D  L WP++  + + ++DQ S  + + D+      + +  + F +P   T   +   +G  T +HL +L    + +KN  +L RCS+ 
Sbjct:   58 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESLME------NQLFPDNFAKREILSLRVKCPSQGCTETMELR----HLERHLVRCDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFCENCALAMALEDKLNHDQTCPLAYVTCEYCQTNLIREQMPAHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQEFTQAHMRMMAQTLRSFSS-SVTPTSHMP--------DISFCDPSQFEPAPPSVATVHSSHTPSQNDCTQETRNLRETIEQLEGRLVRQDHQIRELIAKMETQCTYVNE----LKHTIRSLDNRLGEMESQQCSGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPS--AQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQ-SEGVAMQDQEEVMDTKPEL-LAFQRP---TVARNPKGFGYVTFMHLQAL-KQRQYVKNDTLLVRCSVT 536          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 90.8929 bits (224), Expect = 7.150e-19
Identity = 97/414 (23.43%), Postives = 166/414 (40.10%), Query Frame = 2
Query:  263 IEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTIL----LMESIQNMKNEIEIL--RENLQRKEKTIGKLQNQLR----------------NNTLQHNKEIA-IMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFS------GTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFN--NGKLLKNGAILFRCSIN 1411
            ++ HL+S  K   +    C++    IN  +    +         V CP  AC        L +HL      CP  E+ C+ SN     MV+    + +  T L    L    +NMK E ++L  ++NL  KE  I +L + ++                 N+L   K +A  + K + L + V ++     + L    I    + T    +  E+        D  F          + +  S     R +          WKI D+  + +EA    +  I+S+ FY+   GY+L  R   NG G  + + LS++F +++GEFD  L WP +++V + L+DQ   K  ++D +R       F+    +P +   IA     G P       L N  NG  +K+  +  +  ++
Sbjct:   85 LKGHLESECKLRQEACIYCKQTMASINLTIHVGLYCQ----LYPVPCP-NACPVTCPRAELDKHL----CECPEAELQCTFSNYGCNVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLGLQQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFK----RPDSEMNIAS----GCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 481          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 88.9669 bits (219), Expect = 3.653e-18
Identity = 84/350 (24.00%), Postives = 143/350 (40.86%), Query Frame = 2
Query:  455 LKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTIL----LMESIQNMKNEIEILR--ENLQRKEKTIGKLQNQLR----------------NNTLQHNKEIA-IMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFS------GTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFN--NGKLLKNGAILFRCSIN 1411
            L  H   CP  E+ C+ SN     MV+    + +  T L    L    +NMK E ++L   +NL  KE  I +L + ++                 N+L   K +A  + K + L + V ++     + L    I    + T    +  E+        D  F          + +  S     R +          WKI D+  + +EA    +  I+S+ FY+   GY+L  R   NG G  + + LS++F +++GEFD  L WP +++V + L+DQ   K  ++D +R       F+    +P +   IA     G P       L N  NG  +K+  +  +  ++
Sbjct:  191 LDKHLCECPEAELQCTFSNYGCNVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLSVLQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFK----RPDSEMNIAS----GCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 532          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 120.168 bits (300), Expect = 1.323e-28
Identity = 116/490 (23.67%), Postives = 206/490 (42.04%), Query Frame = 2
Query:  110 NSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEH----------------------LKSHSI-NCPFHEMGCSHSNVKSQAMVQHMTEES---------YSHTILLMESIQNMKN------------EIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLK---NVSKIEKGTTAELPT--------DSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPN-GFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +S F E  Q    YD + D  L S   C IC   L    Q+PCG R+C +CI K ++     CP   +      + + N L  D+FA + +L++ VKCP K C  K EL++L +H                      + +H I +CP  ++ C +  V      + + ++S         Y  TIL+ E + N  +             +    E +QR       L   L+ NT  H + +A    +++L     + +   +G   E P         +S  + QD  I + T        + ET S + G  +    +    +  + A +    + WKI +F   ++  + +   VI+S  FY+ R GYKL +R++      +    ++S+F   ++GE+D  L WP +  + + ++DQ    I+ + +    +  K   + F +P+          +G  T +HL +L   G  +K+  +L RC ++
Sbjct:   46 SSSFMEEIQ---GYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNH-----LARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELT-------AKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDA--KPELLAFQRPTIPRNPKG---FGYVTFMHLEAL-RQGTFIKDDTLLVRCEVS 508          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 111.309 bits (277), Expect = 1.352e-25
Identity = 112/500 (22.40%), Postives = 200/500 (40.00%), Query Frame = 2
Query:  191 CTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKC--PEKACDTKAELKNLMEHLKSH--------------------------SINCPFHEMGCSH------------------------------------SNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELP---------------TDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRF-----MSATSSLRCISANEDIAPFE---------WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            C  C  +L  P Q+ CG R+C SC+   L S +  C      C+E    I + +  D+   + +LA++V C    + C  +  L +L+ HLK+                              C + E  CSH                                    S   +Q +  H    +  H  LL E   +++ ++ +L+     K K+I  L NQ+ +  ++  ++  +++ + S + ++ ++      +L                 DS++ + +      TE ESV  +  +  +  +G   S+      M +   +R    +      E         WKI D+  R QEA    +  +YS+PFY+   GYK+  RV  NG G  + THLS+FF I+ GE+D  L WP +++V + L+DQ S++  + D ++       F+    KP+    IA     G P  +   ++  NG  +K+  I  +  ++
Sbjct:   52 CEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTA----CQESI--IKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQA-ARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFK----KPTGEMNIAS----GCPVFV-AQTVLENGTYIKDDTIFIKVIVD 535          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 111.309 bits (277), Expect = 1.352e-25
Identity = 112/500 (22.40%), Postives = 200/500 (40.00%), Query Frame = 2
Query:  191 CTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKC--PEKACDTKAELKNLMEHLKSH--------------------------SINCPFHEMGCSH------------------------------------SNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELP---------------TDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRF-----MSATSSLRCISANEDIAPFE---------WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            C  C  +L  P Q+ CG R+C SC+   L S +  C      C+E    I + +  D+   + +LA++V C    + C  +  L +L+ HLK+                              C + E  CSH                                    S   +Q +  H    +  H  LL E   +++ ++ +L+     K K+I  L NQ+ +  ++  ++  +++ + S + ++ ++      +L                 DS++ + +      TE ESV  +  +  +  +G   S+      M +   +R    +      E         WKI D+  R QEA    +  +YS+PFY+   GYK+  RV  NG G  + THLS+FF I+ GE+D  L WP +++V + L+DQ S++  + D ++       F+    KP+    IA     G P  +   ++  NG  +K+  I  +  ++
Sbjct:   52 CEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTA----CQESI--IKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQA-ARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFK----KPTGEMNIAS----GCPVFV-AQTVLENGTYIKDDTIFIKVIVD 535          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 105.145 bits (261), Expect = 1.655e-23
Identity = 96/416 (23.08%), Postives = 178/416 (42.79%), Query Frame = 2
Query:  263 IEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCP----FHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELP---------------TDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRF-----MSATSSLRCISANEDIAPFE---------WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +  H++   KY       C+ Q   I    +     + +   + V CP K C  +  L++ +    S  +N P    F   GC      +Q +  H    +  H  LL E   +++ ++ +L+     K K+I  L NQ+ +  ++  ++  +++ + S + ++ ++      +L                 DS++ + +      TE ESV  +  +  +  +G   S+      M +   +R    +      E         WKI D+  R QEA    +  +YS+PFY+   GYK+  RV  NG G  + THLS+FF I+ GE+D  L WP +++V + L+DQ S++  + D ++       F+    KP+    IA     G P  +   ++  NG  +K+  I  +  ++
Sbjct:  161 LRDHVEKACKYREATCSHCKSQVPMI----KLQKHEDTDCPCVVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGT-NQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQA-ARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFK----KPTGEMNIAS----GCPVFV-AQTVLENGTYIKDDTIFIKVIVD 560          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 93.9745 bits (232), Expect = 5.729e-20
Identity = 86/334 (25.75%), Postives = 150/334 (44.91%), Query Frame = 2
Query:  437 KNLMEHLKSHS---INCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNV-----SKIEK-GTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +   +H+++ S   + C FH +GCS        MV+  TE    H       +Q ++  + +L  +    + + G L NQ+    LQ  +   I+++ I+  +N+      ++E+   TAE  +   +++QD       E  S    + E          +      S L  +S  + +  F WKI DF  + QEA +  +  I+S  FY+ R GYK+ LRV  NG G    THLS+FF +++G  D  L WP  ++V + L+D  +N+  V D +R       FQ    +P +   IA     G P    ++ +      +++ AI  +  ++
Sbjct:  200 ETFQDHVRACSKCRVLCRFHTVGCSE-------MVE--TENLQDH------ELQRLREHLALLLSSFLEAQASPGTL-NQVGPELLQRCQ---ILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKI-----EALSNKVQQLERSIGLKDLAMADLEQKVSELE-VSTYDGV--FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH-NNREHVIDAFRPDVTSSSFQ----RPVSDMNIAS----GCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          

HSP 2 Score: 54.6842 bits (130), Expect = 1.910e-7
Identity = 35/111 (31.53%), Postives = 55/111 (49.55%), Query Frame = 2
Query:  161 VDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPT-DDCREQCVDI--NNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPF 484
            + T L +  +C+ C+ IL RP+Q+ CG RYC  C+   L SG + C     +   E+ + I  +++   D+ A + V ++   CP   C  K  LK   E+   H   CPF
Sbjct:   24 LGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLK---EYESCHEGLCPF 131          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6IWL4|TRAF6_DANRE (TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 9.240e-29
Identity = 113/487 (23.20%), Postives = 195/487 (40.04%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKN------------------------EIEILRENLQR-------------KEKTIGKLQNQLRNNTLQHNKEIAIMKKDI----------------SLLKNVSKIEKGTTAELPTDSIQINQD------------GTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTH-LSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            YD + D  L S   C IC   L    Q+PCG R+C SCI K ++   + CP   +      V +   L  D+FA + +L++ VKC    C  K EL+ L +HL      C F    C     +    + H+ E    H +  + +  +                           E+E++R+ L                  T G  +   RN   QH +E   M                    S   ++S  ++G +A  P DS Q  Q+            G +    ++       ++T  +     R + +S   S R + A +    + W++E+F + ++  ++    V++S PFY+ R GYKL LR++         ++ +S+F   ++GEFD  L WP++  + + ++DQV  +  +         + D Q  F +P   T + +   +G  T +HL +L   G  +K   +L RC + 
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLS----QCRFATAPCP--QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSP-DSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIE----VMETKPDLQA-FQRP---TVMRNPKGFGYVTFLHLQALRQRG-FVKEDVLLVRCEVT 521          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70196|TRAF6_MOUSE (TNF receptor-associated factor 6 OS=Mus musculus OX=10090 GN=Traf6 PE=1 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 9.252e-28
Identity = 116/490 (23.67%), Postives = 206/490 (42.04%), Query Frame = 2
Query:  110 NSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEH----------------------LKSHSI-NCPFHEMGCSHSNVKSQAMVQHMTEES---------YSHTILLMESIQNMKN------------EIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLK---NVSKIEKGTTAELPT--------DSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPN-GFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +S F E  Q    YD + D  L S   C IC   L    Q+PCG R+C +CI K ++     CP   +      + + N L  D+FA + +L++ VKCP K C  K EL++L +H                      + +H I +CP  ++ C +  V      + + ++S         Y  TIL+ E + N  +             +    E +QR       L   L+ NT  H + +A    +++L     + +   +G   E P         +S  + QD  I + T        + ET S + G  +    +    +  + A +    + WKI +F   ++  + +   VI+S  FY+ R GYKL +R++      +    ++S+F   ++GE+D  L WP +  + + ++DQ    I+ + +    +  K   + F +P+          +G  T +HL +L   G  +K+  +L RC ++
Sbjct:   46 SSSFMEEIQ---GYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNH-----LARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELT-------AKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDA--KPELLAFQRPTIPRNPKG---FGYVTFMHLEAL-RQGTFIKDDTLLVRCEVS 508          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B5DF45|TRAF6_RAT (TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.402e-27
Identity = 118/484 (24.38%), Postives = 207/484 (42.77%), Query Frame = 2
Query:  110 NSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEH----------------------LKSHSI-NCPFHEMGCSHSNVKSQAMVQHMTEES---------YSHTILLMESIQNMKN------------EIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISL-LK--NVSKIEKGTTAELPTDSIQINQ-DGTICDFTEEESVHYTESETDS-HFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPN-GFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +S F E  Q    YD + D  L S   C IC   L    Q+PCG R+C +CI K ++     CP   +      + + N L  D+FA + +L++ VKCP K C  K EL++L +H                      +  H I +CP  ++ C +  V      + + ++S         Y  TIL+ E + N  +             +    E +QR       L   L+ NT  H + +A    +++L L+  + S   +G   E P     + Q +G +     +      + ET S H S  +R+   S    +  + A +    + WKI +F   ++  + +   VI+S  FY+ R GYKL +R++      +    ++S+F   ++GE+D  L WP +  + + ++DQ    I+ + +    +  K   + F +P+          +G  T +HL +L   G  +K+  +L RC ++
Sbjct:   46 SSSFMEEIQ---GYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACITKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCVQKMELRHLEDHQVHCEFALVICPQCQRFFQKCQINKHIIEDCPRRQVSCVNCAVPMPYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPVPCTFSVFGCHEKMQRNH-----LARHLQENTQLHMRLLAQAVHNVNLSLRPCDASSPSRGCRPEDPNYEETVKQLEGRLVRQDHQIRELTAKMETQSMHVSELKRT-IRSLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAVIRQNHEEVMDA--KPELLAFQRPTIPRNPKG---FGYVTFMHLEAL-RQGTFIKDDTLLVRCEVS 508          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 4.885e-24
Identity = 113/482 (23.44%), Postives = 198/482 (41.08%), Query Frame = 2
Query:  110 NSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCS---------HSNV--------------KSQAMVQHMTEE-------------SYSHTILLMESIQNMKNEIEILRENLQRKEKTIG--------KLQNQLRNNTLQHNKEIAIMKKDISLLKN---VSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPN-GFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +S F E  Q    YD + D  L S   C IC   L    Q+PCG R+C +CI K ++     CP   +      + + N L  D+FA + +L++ VKCP + C  K EL+    HL+ H  +C F  + C          H N+                 A+V    +E              Y +TIL+ E + N   +++     +     T G         L   L+ NT  H + +A     +SL+ +   VS++          +   + QD  I + T        + ET S +    +    +    +  I A +    + WKI +F   ++  + +   VI+S  FY+ + GYKL +R++      +    ++S+F   ++GE+D  L WP +  + + ++DQ  ++  V   +      K   + F +P+          +G  T +HL +L      +K+  +L RC ++
Sbjct:   46 SSSFMEEIQ---GYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELR----HLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAALVAFEDKEIHDQNCPLANVICEYCNTILIREQMPN-HYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSEVRNFQETIHQLEGRLVRQDHQIRELT-------AKMETQSTYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQ--SEAPVRQNHEEIMDAKPDLLAFQRPTIPRNPKG---FGYVTFMHLEAL-RQRTFIKDDTLLVRCEVS 500          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 5.068e-24
Identity = 113/482 (23.44%), Postives = 198/482 (41.08%), Query Frame = 2
Query:  110 NSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCS---------HSNV--------------KSQAMVQHMTEE-------------SYSHTILLMESIQNMKNEIEILRENLQRKEKTIG--------KLQNQLRNNTLQHNKEIAIMKKDISLLKN---VSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPN-GFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +S F E  Q    YD + D  L S   C IC   L    Q+PCG R+C +CI K ++     CP   +      + + N L  D+FA + +L++ VKCP + C  K EL+    HL+ H  +C F  + C          H N+                 A+V    +E              Y +TIL+ E + N   +++     +     T G         L   L+ NT  H + +A     +SL+ +   VS++          +   + QD  I + T        + ET S +    +    +    +  I A +    + WKI +F   ++  + +   VI+S  FY+ + GYKL +R++      +    ++S+F   ++GE+D  L WP +  + + ++DQ  ++  V   +      K   + F +P+          +G  T +HL +L      +K+  +L RC ++
Sbjct:   46 SSSFMEDIQ---GYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELR----HLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAALVAFEDKEIHDQNCPLANVICEYCNTILIREQMPN-HYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSEVRNFQETIHQLEGRLVRQDHQIRELT-------AKMETQSTYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQ--SEAPVRQNHEEIMDAKPDLLAFQRPTIPRNPKG---FGYVTFMHLEAL-RQRTFIKDDTLLVRCEVS 500          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0F7GY08 (TNF receptor associated factor 5 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 3.695e-35
Identity = 69/146 (47.26%), Postives = 97/146 (66.44%), Query Frame = 2
Query:  932 ANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGK 1369
              E IAPFEWKI +FM + + A S     +YS+PFYSH+NGYK++LR++PNG    +  +LSV F II GE+DD L WPM +QV I L++Q +  + +S +Y++ SV K  + IF KP +R E  + YF+GT  L + + LFNN K
Sbjct:   41 VKEHIAPFEWKITNFMEKHERAISGEKLTVYSEPFYSHKNGYKIQLRIDPNGDEAVKALYLSVSFGIIGGEYDDELDWPMTKQVKISLINQKTGLVHISKRYKFDSVLKKSKCIFFKPISRFEDDEDYFFGTLKLSNFSVLFNNQK 186          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.979e-34
Identity = 126/482 (26.14%), Postives = 216/482 (44.81%), Query Frame = 2
Query:  104 MANSKFQEIYQLLTDYDFQ-VDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFAN----KNVLAIKVKCPEKACDTKAELKNLMEHLKS---HSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEI---------------EILR-----------------ENLQRKE-------KTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSI 1408
            M  SK   + +LL+ Y+ + VD  + +DL+C +C K++    +S CGC YCY+CI  +L   + YCP    +C+E  +    NL+ D F N      +  I VKCP   C+  +EL  L EHL      S+ CP   +GC    +    M +H+T++   HT L+M     +K+EI               E+LR                 E L+ K+       + I +++N++         E+  +K DI + +   +  K     + +  I+ NQ   + D  +E  +   +   DS+     R R M+    L  +  N D+  F W+IE++       K +    +YS  F SH   + L L +  +  G W          I++GE DD L WPM R V + +++Q S K   +  +++ + +++ +  F +P  + E  DY   GT +L+  + +     +L N +I+  C +
Sbjct:    1 MIPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYL----NLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDISHLKEVLRVQKALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKSDIQIFRQEIEFMKNDLEVVGSTDIK-NQ---VKDLKKE--IFGIKMNIDSN--NEERERKMNNLIRLNKLCPNVDM-DFMWRIEEY-----SKKRRTVTDVYSDSFQSHNYKFCLNLYIYGDNLGLW--------CVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKA-FDRP--KDERNDYCI-GTDSLVRYSYIKETPMILVNDSIIVACVV 452          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.409e-29
Identity = 64/208 (30.77%), Postives = 121/208 (58.17%), Query Frame = 2
Query:  122 QEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSI---NCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLK 736
            ++I +LL  Y+F+V+  +  +L C +C+ +L    QS CGCR+C  CI +++  GN YCP  T +C+E+ + I +N+  D+  N+ +  ++VKCPE+ C    EL ++ EHL+  ++   NCPF  +GC+   +  Q +  H+   ++ H+ L+++ I NM+N+       L  KE  + +  N ++N+    N+ + ++  +I ++K
Sbjct:    4 EKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDF----FGLTTKEVELREDINLIKNHFQSQNEIMMLINSEIEIIK 207          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A498M8A6 (TNF receptor-associated factor OS=Labeo rohita OX=84645 GN=ROHU_027055 PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 3.135e-29
Identity = 113/465 (24.30%), Postives = 201/465 (43.23%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSH--SNVKSQAMVQHMTEESYSHTIL--------------LMESIQNMKN------EIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKD--------ISLLKNVSKIEKGTTAELPTDSIQINQ------------DGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYK--LRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            YD + D  L S   C IC   L    Q+PCG R+C SCI+K ++   + CP   +      V +   L  D+FA + +L++ V+CP   C  K EL+     L+ HS  C F  + C     +V+   + +H +++     +               + E I    N      ++E++R+ + R E     L   ++  T  H + +A   +          S+  + S  E+G +A  P DS Q  Q            +G +    ++       +ET        R +  +   + R + A +    + W++E+F   ++  ++    V++S PFY+ R GYK  LRL +      +  N ++S+F   ++GEFD  L WP++  + + ++DQV  +  V         + D Q  F +P   T + +   +G  T +HL +L   G  +K+  +L RC + 
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCNSCIKKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVRCPNAGCSDKMELR----QLEKHSSQCKFATVQCPQCLESVRKSHLDEHKSQQCLQRLLTCPDCAESFVYAGKQIHEQICPFANTVCEYCDMELIRDQMPRNE-----LAQHMQEFTQMHMRYMAEFLRSQTLNSCPVPSVATHSSSDERGASARAP-DSCQCRQELMNLRETVLELEGRLVRQDQQIRELCIHNETQKIQVTDLRRKLGTLEEATRELEAQQYQGIYVWRLENFSVHLRSQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSN-YISLFVHTMQGEFDSQLSWPLQGMIRLSVLDQVEGQHHVE----VMETKPDLQA-FQRP---TVLRNPKGFGYVTFLHLQALRQRG-FVKDDVLLVRCEVT 495          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A553RF85 (TNF receptor-associated factor OS=Danionella translucida OX=623744 GN=DNTS_014115 PE=3 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.066e-28
Identity = 122/473 (25.79%), Postives = 209/473 (44.19%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHL---KSHSINCP--FHEMGCSHSNV-KSQAMVQH-MTEESYSHT-ILLMESIQNMKNEIEILRENLQR-------------KEKTIGKLQNQLRNNTLQHNKEIAI--MKKDISLLKN--------------VSKIEKGTTAELPTDSIQINQ------------DGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVN---PNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            YD + D  L S   C IC   L    Q+PCG R+C SCI+K ++   + CP   +      V + + L  D+FA + +L++ V+C    C+ K EL+ L +HL   K  + +CP     +  SH +  KSQ   Q  MT  + + T I    + +    E+E++RE L                  T G  +   RN   QH +E     M+     L+N               S  E+G +++ P DS Q  Q            +G +    ++       ++T  +     R +  S   + R + A +    + W++E+F N ++  ++    V++S PFY+ R GYKL LR++   PN      + ++S+F   ++GEFD  L WP++  + + +++QV  +  V         + D Q  F +P+ +        +G  T +HL +L   G  +K   +L RC ++
Sbjct:   52 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCLSCIKKSIRDTGQKCPVDNE------VLLEDQLFPDNFAKREILSLTVRCSNIGCNNKMELRQLEKHLSQCKFSTAHCPQCLESVLKSHLDEHKSQFCSQRLMTCPACAGTFICPFANTRCEYCEMELIREQLSLHCDTDCLKAPVACTFSTFGCREKMARNELAQHMQEFTQMHMRYMAEFLRNQTLTNCLMPPSTGYCSPDERGASSK-PPDSCQCKQELMNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLTSLEEATRELEAQQFQGVYIWRLENFSNHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPN--APRCSNYISLFVHTMQGEFDSQLSWPLQGTITLAVLNQVDGQHHVE----VMETKPDLQA-FQRPTVQRNPKG---FGYVTFLHLQALRQRG-FVKEDVLLVRCEVS 506          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 120.553 bits (301), Expect = 6.799e-29
Identity = 112/463 (24.19%), Postives = 197/463 (42.55%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSH--SNVKSQAMVQHMTEESYSHTILLMESIQNM---------KNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMK----KDISLLKNVSKI--EKGTTAELPTDSIQIN-QDGTICDFTEE-----ESVHYTES----------------ETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVN---PNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            YD   D  L S   C IC   L    Q+PCG R+C  CI K ++   + CP   +      V   + L  D+FA + +L++ V+C    C  K EL+    HL++H  +C F  + C     +V    + +H+ +E     I   +  +N+           + + L+  +       G  +  LRN+   H +E   M      D+   + ++ +      +A  PTDS   + +    C   +E     E+V   ES                ET S      R +  S   S+R + A +    + W++E F   ++  ++    V++S PFY+ R GYKL LR++   PN   +  N ++S+F   ++GEFD  L WP++  + + ++DQ   +  V         + D Q  F +P+ +        +G  T + L +L   G  +++  ++ RC + 
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNE------VLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELR----HLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNA-PRCSN-YISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVE----VMETKPDLQA-FQRPTVQRNPKG---FGYVTFMQLQALHQRG-FVRDDVLMVRCEVT 497          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 114.005 bits (284), Expect = 1.216e-26
Identity = 116/487 (23.82%), Postives = 200/487 (41.07%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSH--SNVKSQAMVQHMTEESYSHTILLMESIQNM--------------KNEI------EILRENLQRKEKT-------------IGKLQNQLRNNTLQHNKEIAIMK----KDISLLKNVSKI--EKGTTAELPTDSIQIN-QDGTICDFTEE-----ESVHYTES----------------ETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVN---PNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            YD   D  L S   C IC   L    Q+PCG R+C  CI K ++   + CP   +      V   + L  D+FA + +L++ V+C    C  K EL+    HL++H  +C F  + C     +V    + +H+ +E     I   +  +N+               N +      E++R  L     T              G  +  LRN+   H +E   M      D+   + ++ +      +A  PTDS   + +    C   +E     E+V   ES                ET S      R +  S   S+R + A +    + W++E F   ++  ++    V++S PFY+ R GYKL LR++   PN   +  N ++S+F   ++GEFD  L WP++  + + ++DQ   +  V         + D Q  F +P+ +        +G  T + L +L   G  +++  ++ RC + 
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNE------VLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELR----HLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQFHEQLCLFANTVCEYCNMELIRNQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNA-PRCSN-YISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVE----VMETKPDLQA-FQRPTVQRNPKG---FGYVTFMQLQALHQRG-FVRDDVLMVRCEVT 521          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 114.005 bits (284), Expect = 1.216e-26
Identity = 116/487 (23.82%), Postives = 200/487 (41.07%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSH--SNVKSQAMVQHMTEESYSHTILLMESIQNM--------------KNEI------EILRENLQRKEKT-------------IGKLQNQLRNNTLQHNKEIAIMK----KDISLLKNVSKI--EKGTTAELPTDSIQIN-QDGTICDFTEE-----ESVHYTES----------------ETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVN---PNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            YD   D  L S   C IC   L    Q+PCG R+C  CI K ++   + CP   +      V   + L  D+FA + +L++ V+C    C  K EL+    HL++H  +C F  + C     +V    + +H+ +E     I   +  +N+               N +      E++R  L     T              G  +  LRN+   H +E   M      D+   + ++ +      +A  PTDS   + +    C   +E     E+V   ES                ET S      R +  S   S+R + A +    + W++E F   ++  ++    V++S PFY+ R GYKL LR++   PN   +  N ++S+F   ++GEFD  L WP++  + + ++DQ   +  V         + D Q  F +P+ +        +G  T + L +L   G  +++  ++ RC + 
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNE------VLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELR----HLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQFHEQLCLFANTVCEYCNMELIRNQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNA-PRCSN-YISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVE----VMETKPDLQA-FQRPTVQRNPKG---FGYVTFMQLQALHQRG-FVRDDVLMVRCEVT 521          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 101.293 bits (251), Expect = 1.380e-22
Identity = 106/479 (22.13%), Postives = 192/479 (40.08%), Query Frame = 2
Query:  140 LTDYDFQVDTFLYSDLICTICEKILNRPYQ-SPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKC--PEKACDTKAELKNLMEHLKSHSIN---CPFH--------------EMGCSHSNVKSQAMVQHMTEESYS--HTILLMESIQ-NMKNEIEILRENLQ--------RKEKTIGKLQNQLRNNTLQ----HNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVH---------YTESETDSHFS------GTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQ----VSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIAD--YYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSI 1408
            +  YD++          C +C K +  P Q S CG R+C +C+++ L  G   CP+      +Q       +  D    + +LA+ ++C   E+ C    ++K L  H  + + N   CP                +  C    VK +      T E++     I   ES+    K    ++R  L         ++ +       +   +T+Q    H     +   +     N+++ +  T  +    S  +     +C F +    H         + E  T SH +      G +R   +     +  +S + D     WK+ D+  ++QEAK   +   +S PFY+HR GYKL++    NG G  E +HLS++  ++ GE+D+ L WP   +V   ++DQ    +S    +++ +      K+FQ    KPS+     D     +G P  I  + +      +++ AI  + SI
Sbjct:    1 MPGYDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE------DQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCAVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAFENHQGICPQESVYCENKCGARMMRRLLAQHTMAECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLATHVKESCGSALV-----LCPFKDAGCKHRCPKLAIGRHLEETTKSHLTMMCSLVGRQRQEIIELRREMEELSVSHDGV-LIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQ----KPSSSRNSLDESTLGFGYPKFISHDEI-RKRNYIRDNAIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 1.260e-19
Identity = 47/151 (31.13%), Postives = 80/151 (52.98%), Query Frame = 2
Query:  959 WKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            WKI D+  R  EA +  +  +YS+PFY+   GYK+  RV  NG G  + THLS+FF ++ GE+D  L WP +++V + L+DQ   +  + D ++       F+    +P+    IA     G P  +   ++  NG  +K+  I  + +++
Sbjct:    8 WKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFR----RPTGEMNIAS----GCPLFVA-QTVLENGTYIKDDTIFIKVTVD 149          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 1.720e-23
Identity = 87/365 (23.84%), Postives = 155/365 (42.47%), Query Frame = 2
Query:  392 KVKCPEKA--CDTKAELKNLM-EHLKSHSINCP-------FHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLR---------NNTLQHNKEI-AIMKKDISL----LKNVSKIEKGTTAELPTDSIQINQDGTICDF---------TEEESVHYTESETDSHFSG----------------TRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLI 1339
            + +CP     C  K E +++  E L SH   CP       F + GC +     Q + +H +  +  H  L+     N++ ++ +L+  L  +  +   L  ++R           T   N+ +  ++++ +++    L  + +  +GTT     D+++ + DGT              EE     T S T +  +                 TR +        L   S N  +    WKI D+  R Q+A S  +  +YS+PFY+   GY++  R   NG G    THLS+FF ++ GE+D  L WP  ++V + L+DQ + + Q+SD ++       F+    +P++   IA     G P  +
Sbjct:   95 ETRCPRYPIPCPNKCEEQSIAREELVSHLGICPYKQAECFFSQFGCKYKGTL-QGLKEHESGATQQHLSLVTARSANLELKVSMLQSQLAERANSADLLGTRVRELEKELISVGQTASKNESVLCVVQRMLAVQTERLLRLQESMQGTTRRADHDALRGDLDGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYNGKLV---WKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFR----RPTSDMNIAS----GCPLFV 447          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 1.083e-22
Identity = 90/384 (23.44%), Postives = 153/384 (39.84%), Query Frame = 2
Query:  251 CYSCIEK-HLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCP---EKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLME--------------SIQNMKNEIEILRENLQRKEK------TIGKLQNQLRNNTL----QHNKEI----------------AIMKKDISLLK-NVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQ 1267
            C + +++  L +    CP   + C+     +  +L   H   +      + CP   E+    +AEL   M      +  C FH +GC+     S+++ +H      SH  L++               SI++  N  E+L + + + E+      T+    N    +TL    QHN+++                A +++D++ L+  +  +E       P                 EE  H  E     H          +A   L+ +          WKI D+  R QEA S  +  +YS+PFY+   GYK+  R   NG G    THLS+FF ++ GE+D  L WP  R+V + L+DQ + +  +SD +        F+
Sbjct:   13 CGTSVQRTRLAAHRASCPHRAEFCKYCSAAVTCSLLERHH-KEECAQYPLPCPNNCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLVISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHNEQLQSLHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNPGPC----------------EERCHMHEQRLTMH-----DGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFR 374          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 65.4698 bits (158), Expect = 1.316e-11
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 2
Query:  149 YDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCI--EKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGC 499
            Y+   +  L S   C IC   L  P Q+PCG R+C +CI     L+     CP       +  V     L  D+FA + +L++ V+CP K C  + EL+ L E    H + C + ++ C
Sbjct:   51 YEADFEPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPV------DNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQE----HQLRCEYAQVPC 159          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 4.737e-7
Identity = 26/76 (34.21%), Postives = 43/76 (56.58%), Query Frame = 2
Query:  953 FEWKIEDFMNRVQEAKSKLSKV--IYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPME 1174
            F WKI+  +NR++EA +   +   I S  F++ R GY+LRLR+  +G       H+S +  +  G +D +L WP +
Sbjct:  327 FLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSG------EHVSAYAMLGPGPYDATLAWPYQ 396          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 113.62 bits (283), Expect = 5.911e-27
Identity = 120/521 (23.03%), Postives = 188/521 (36.08%), Query Frame = 2
Query:  140 LTDYDFQVDTF---LYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNK----------------------------YCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLK-----------------------------SHSINCP----------------------------FHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQL---RNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQIN--------QDGTICDFTEEESVHYTESETDSHFSGT----RRS------------RFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQ-VSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSL 1354
            + D  FQ + F   L     C +C   L  P Q+PCG R+C  C+E  L+  +K                            YCP      R+   +   +LQ+      N     V+C    C  K   ++L  HL+                              H + CP                            F + GC H     +A+  H  +++  H  LL+ + QN +     +   L + EK   K Q Q+   R      N+ +   +  +++++     ++   AEL  + IQ+         QD  +     E S     S       GT    RR             +       L+ + A      + WKI+++  R QE  S  +  IYS PFY  R GYK   RV PNG G  + +HLS+FF ++ GEFD  L WP  ++V   L+DQ  +++  + D +R       F+    +P++   IA     G P  I   +L
Sbjct:    1 MQDEGFQTELFVEPLDPKYRCPVCGNALKHPVQTPCGHRFCEGCLEPILRGPSKCPVDGEELKIDGVFKDVCCRREILCLACYCPN-----RQLGCEWMKDLQYLEEHRANCEYKGVQCHNPGCQEKVAKRDLEAHLERCEFKPSDCQYCLQRIPAASMEDHLQTCEKHPVVCPHCGAEGICRDELLHHQTNICEQAELPCSFAKHGC-HFKGTREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAEL-KERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQ--DRVHDIGDTFRPDPTSSSFK----RPTSNMNIAS----GCPLFISHTNL 504          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 110.153 bits (274), Expect = 5.678e-26
Identity = 113/450 (25.11%), Postives = 191/450 (42.44%), Query Frame = 2
Query:  155 FQVDTFLY---SDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKN---------------------------LME-----------HLK--------------SHSINCP-------FHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIM--KKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAK-------------------SKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVE 1255
            F +D F+     +LIC IC  ++N P  + CG  YC  CIEK   +G +    P D+ + +   I  + + D      VL+++VKC    C  K EL+                            LME           H K               H  +CP       F E+GC+    +S A  +H      +H  +  E+I++ K +I  L + L        K++ +L+  +  H KE+  +  K D ++  N  +IE   + E    S  I+++    D  ++E    +E+         R++R   A  S  C +   D   F W+I ++ ++ ++A                    S    ++ S PFY+ R GYK+RL+  PNG+G  + THLS+   I++GE+D  L WP  R++ + L++Q       S+++R ++VE
Sbjct:   15 FDLDQFIIPPNDELICAICHMVVNEPVLTSCGHSYCKYCIEKWC-NGKEVVTCPVDNEQLKPSQIFPDKKTDRI----VLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKCILEGCNVKVPRILMEKHTNTCGWRLLHCKPCNLSYPKKDEETVQHKDDCPLAFLPCRFSEIGCTFKGRES-ARDEHCESAVQTHLHIACETIRDNKEQISDLHKELD-------KVRQELQTKSCDHMKEVNAIREKHDEAIRDNKGQIE-ALSKEHGIASNTIHENKEQLDTLKKELGIASET--------IRKNRDQIAKLSTACKTQYTD-GTFVWRICNYKDKYKKAVAFATNQEVKGGNSDSDDDISMAGDIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQ-------SEQWRSETVE 434          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 105.145 bits (261), Expect = 3.610e-24
Identity = 95/380 (25.00%), Postives = 159/380 (41.84%), Query Frame = 2
Query:  374 KNVLAIKVKCPEKACDTKAELKNLMEHLKSHS---INCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKD-------ISLLKNVSKIEKGTTAELPTDSIQINQDGTI------------------CDFTEEESVHYTE-SETDSHFSGTRRSRFMSATSSLRCISANEDI-----------APFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAIL 1393
            K   A  ++CP +    + E K L  H +       +C F  +GC++  VK  A+ +H  +    H ILL  +    +  +  L   L+R +      + +L     +H  E A MK+        + +++     +KG  AE+     Q N  G +                  C  +  + +   + S+T+ +    R S+  S+ +  +     ED+             F WKI+ F  R  EAKS  +  IYS PFY+HR GYKL  R+ PNG G   + +LS+F +++ GE+D  L WP +  + I L+DQ  N + +S+ +        FQ    +P+    +A     G P       L   G + +N   +
Sbjct:  154 KKCPAFPIECPNECGVKRIERKKLSAHTRECPNALTDCRFSPLGCTY-KVKKIALREHQNKHVIKHMILLGRTTGEPQPNLLELENQLERFDGENTSFKTELE----RHKYEFAQMKERFNDQNARLGIVEKTVANQKGDIAEIWMRFDQENLVGEVRMRDKLKKFKVKTKANKECLLSLMKRLEVQDDSQTNPNKLNRRLSQLESSITIHKTKLFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQ-DNGMNISETFDPDPCSISFQ----RPTRNINVAS----GCPRFCSQTVLRTRGYMNENCVFV 519          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO31690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX76])

HSP 1 Score: 88.5817 bits (218), Expect = 4.027e-19
Identity = 104/433 (24.02%), Postives = 179/433 (41.34%), Query Frame = 2
Query:  158 QVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKS---HSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLME--SIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKE--IAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQD---GTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISAN--EDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRL----RVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSI 1408
            Q +T    +L+C IC  ++N+P  + CG  +C  C  K  ++G      P D  + +     N    D    + VL++ VKC    C  K EL++  +HL       I C F   GC  + +   +M +H  EE+    I+  E   +   K E E                       T++H  +  +AI+    S +    +  +        +++Q + D   GTI D  +E   +  +   ++    T      +A  ++R +     + I  F W+I D+ +   E        IYS  FY+ + GYK++L    R NP   G    THLS++  I+ GE+D  L WP  R++ + ++DQ   +   +       V  D +  FH+P T   +     YG    + L  L  +G  +K+G +  +  +
Sbjct:   16 QFETPPSPELMCGICLMVVNKPVLTYCGHSFCNFCFNK-WRNGKDVVTCPVDYKQLE----TNQFMADKKTERQVLSLCVKCMNGPCSWKGELRDKKKHLTKCGHEVIKCVFD--GCD-TRLARNSMEKH--EETCEWKIVTCEFCDVPYPKREEE-----------------------TVKHRGDCPLAILPCKFSDIGCTFEGRQHAHVAHCENAVQAHLDMACGTIRDNNKEIRKNNKKIRGNNKEIETLHKELNTANQTIRELKGKMAKLIGTFVWRICDYKDLYGE--------IYSPSFYTSKYGYKVQLKANLRTNPFNGG----THLSLYACIMVGEYDALLEWPFRRKITLYVIDQSDQRKHETLLINPDDVLPDRKKCFHRPITGNNVG----YGLTRFLSLEEL-TSGGFIKDGVMFIKAVV 398          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 88.5817 bits (218), Expect = 8.461e-19
Identity = 102/506 (20.16%), Postives = 179/506 (35.38%), Query Frame = 2
Query:  134 QLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGN-----------------------------------------------------KYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSI------------------------NCPFHEMGCSHSNVKS-QAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVS--KIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +L   YD   D  L S   C IC   L  P Q+PCG R+C++CI + ++                                                        K CP    +C  +C  +    + D    +      V C    C  K  +  + EHLK                             CP   + C H  +KS +    H  +E   H          ++ E      N+QR+   +G   ++ R       + +A +++ +  +K  S  +I + T   +  ++ +I  +G +C+ T                                          F WK+++F    + + + L+  I+S PFY+   GYK+ LR+N NG       H+S+F  +++G++D  L WP   ++ + ++DQ S++I          V K   + F +P   T   ++  YG      ++ L   G+ +KN +IL R  I+
Sbjct:   39 RLEEGYDEFFDPPLESKYECPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPKCPVDNTPLSERELYRDNFAKREMMSFIVWCRLKKERGCTWKGALKELEEHLKGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPC--DHCKMKVTISKIEEHLKGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKSSKEQASHGPQEHTPHEA-------ELRREALFQSANMQREVDMLGSRGDEYR-------QFLAYLERKVEDVKTSSDRRIAELTHKLMRLETREIELEGRVCNGT------------------------------------------FIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQ-SDQIDSRRPISETLVAKPNLLAFQRP---TSPRNHKGYGYVEFCPIDQL-TEGQYIKNNSILVRIQIS 481          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 121.324 bits (303), Expect = 1.901e-29
Identity = 98/425 (23.06%), Postives = 183/425 (43.06%), Query Frame = 2
Query:  191 CTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKA--CDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGK-----LQNQLRNNTLQHNKEI-----------AIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            C  C  +L +P Q+ CG R+CYSCI   L   N  CP   +          + +  D   ++ ++A+KV C  +A  C  +  L+ + +H+      CPF E+ C     K + M + + E           + +  KN++ +    LQ+ ++T+         N   +++L  ++++            +  + +  L++  +  +GT   + T    + Q G         S+    +  D   S     R        + +          WKI D+  R Q+A +  +  +YS+PFY+   GYK+  RV  NG G  + THLS+FF ++ GE+D  L WP +++V + L+DQ  ++  + D ++       F+    +P     IA     G P  +   S+  +G  +K+  I  + +++
Sbjct:   48 CEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADMEPL------FKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNV----CPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEFCKNKMPL--TELQKHKETVCPAFPVSCPNHCTSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALEQGG-------RASLETQLNRHDDMLS-VHEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFR----RPVAEMNIAS----GCPLFVS-QSVLESGTYIKDDTIFIKVTVD 443          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 90.8929 bits (224), Expect = 3.746e-19
Identity = 81/323 (25.08%), Postives = 140/323 (43.34%), Query Frame = 2
Query:  476 CPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNM-KNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDI----------APFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            CPF E+GC  S V++  + +H    +  H  LL+  + +M +  ++       +++  +G  +          +     + K +S L+N+  +      E+   S+      T+  F+ +   H  + E   + S   R    S T     +S  E +            F WKI DF +R QEA S  +  ++S  FYS + GYK+ LR+  NG G    THLS+FF ++  ++D  L WP  ++V + L+DQ +N+  + D +R       FQ    +P +   IA     G P    L  L      L++  I  +  ++
Sbjct:  212 CPFSEVGCK-SVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCV---LNREVERSSL------TLEAFSHQ---HRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDITSTSFQ----RPVSEMNIAS----GCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 512          

HSP 2 Score: 51.2174 bits (121), Expect = 2.002e-6
Identity = 31/110 (28.18%), Postives = 52/110 (47.27%), Query Frame = 2
Query:  191 CTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCR-----EQCVDINNNLQF--DHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGC 499
            C  C ++L +P Q+ CG R+C  C  +   SG    PKP   CR     E+ + I N+ +   D+ A + + ++  +C  + CD    +K   E+   H   C F ++ C
Sbjct:   30 CQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSG----PKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIK---EYEAKHEGRCEFEQIQC 132          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 90.8929 bits (224), Expect = 4.394e-19
Identity = 80/323 (24.77%), Postives = 139/323 (43.03%), Query Frame = 2
Query:  476 CPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNM-KNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDI----------APFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            CPF E+GC  S V++  + +H    +  H  LL+  + +M +  ++       +++  +G  +          +     + K +S L+N+  +      E+   S+ +        F+ +   H  + E   + S   R    S T     +S  E +            F WKI DF +R QEA S  +  ++S  FYS + GYK+ LR+  NG G    THLS+FF ++  ++D  L WP  ++V + L+DQ +N+  + D +R       FQ    +P +   IA     G P    L  L      L++  I  +  ++
Sbjct:  219 CPFSEVGCK-SVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCV---LNREVERSSLTLEA------FSHQ---HRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDITSTSFQ----RPVSEMNIAS----GCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 519          

HSP 2 Score: 51.2174 bits (121), Expect = 1.740e-6
Identity = 31/110 (28.18%), Postives = 52/110 (47.27%), Query Frame = 2
Query:  191 CTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCR-----EQCVDINNNLQF--DHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGC 499
            C  C ++L +P Q+ CG R+C  C  +   SG    PKP   CR     E+ + I N+ +   D+ A + + ++  +C  + CD    +K   E+   H   C F ++ C
Sbjct:   37 CQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSG----PKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIK---EYEAKHEGRCEFEQIQC 139          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 89.3521 bits (220), Expect = 1.788e-18
Identity = 97/408 (23.77%), Postives = 171/408 (41.91%), Query Frame = 2
Query:  365 FANKNVLAIKVKCP------EKACDTKAELKNLMEHLKSHS---INCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILR-ENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNV-------------SKIEKGTTAELPTDSIQINQDGTICDFTE-----------------EESVHYTESETDSHFSG-------TRRSRFMSATSSLRCISANE------DIAP------FEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            F  KN+ A    CP      E     K   +  ++H+K  S     C FH +GC  ++V+ + +  H  + SY H  LL+  I  +K  +E L+ + L+   + + +L   LR+  L+ ++   + +   + L+ V             S +      +L ++  ++ +    C   E                 E S    E+    H          + + R +  T SLR +S  E      D++       F WKI DF  + Q+A +  +  ++S  FY+ + GYK+ LR+  NG G    THLS+FF ++ G  D  L WP  ++V + L+DQ +N+  + D +R       FQ    +P +   IA     G P    L+ L +    +++  I  +  ++
Sbjct:  171 FLLKNIKAHDEICPKYPMMCEGCAKKKIPREKYVDHIKFCSKFKAPCRFHVVGCD-TSVEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQRLEVASQKLHELHQSLRDLELRMSQ---LGRSGTAPLQGVCAATLATSFTPLHSAMGAALELQLQSEKTKVAELSRRCQELELKVSTFENIVCILNRELERSCATMEAYNRQHRLDQDKIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIIDAFRPDISSSSFQ----RPVSDMNIAS----GCPLFCPLSKLDSKNSYIRDETIFIKAIVD 565          

HSP 2 Score: 51.2174 bits (121), Expect = 1.900e-6
Identity = 34/107 (31.78%), Postives = 50/107 (46.73%), Query Frame = 2
Query:  188 ICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPT-DDCREQCVDI--NNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGC 499
            +C  CEKIL RP Q+ CG R+C  C  + + SG + C     +D  E+   I        D+ A + V A+   CP + C     +K   E+  SH  +C F  + C
Sbjct:   34 LCNSCEKILRRPLQAQCGHRFCCFCFNRTVSSGPQKCSACIKEDLFEEPTSILKQGGAFHDNAARREVEALAAVCPNEGCTWTGTVK---EYEASHEGSCDFTIIMC 137          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 87.8113 bits (216), Expect = 3.918e-18
Identity = 101/441 (22.90%), Postives = 182/441 (41.27%), Query Frame = 2
Query:  191 CTICEKILNRPYQ-SPCGCRYCYSCIEKHLKSGNKYCPK-----------PTDDCREQ-------CVDINNNLQF--------DHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCS--HSNVKSQAMVQHMT----EESYSHTILLMESIQNMKNEIEILRENLQRKE--KTIGK--LQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVH---------YTESETDSHFS------GTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQ----VSNKIQVSDKYRWKSVEKDFQVIFHKP-STRTEIADYYF-YGTPTLI 1339
            C +C K +  P Q S CG R+C +C+++ L  G   CP+           P  +  +Q       C+      ++         HF+      I   CP + C  K   ++L +HL+    +CP  ++ C    S    +A   H      E  Y         ++ + ++   + E  +R +  K  GK  + + ++N+   H     +   +     N+++ +     +    S  +     +C F +    H         + E  T SH +        +R   +     +  +S + D     WK+ D+  ++QEAK + +   +S PFY+HR GYKL++    NG G  E +HLSV+  ++ GE+D+ L WP   +V   ++DQ    +S    +++ +      K+FQ    KP STR  + +    +G P  I
Sbjct:   18 CPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIP--CPNR-CSVKLTRRDLPDHLQH---DCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQ-HGMAECPKRTQPCKYCGKEFVFDTIQNHQF-HCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALV-----LCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNLVSRQRQEILELRREMEELSVSHDGV-LIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQ----KPCSTRNSLDESTLGFGYPKFI 440          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070236.1 (SMESG000070236.1)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 436/436 (100.00%), Postives = 436/436 (100.00%), Query Frame = 2
Query:  104 MANSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            MANSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN
Sbjct:    1 MANSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 436          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070235.1 (SMESG000070235.1)

HSP 1 Score: 306.605 bits (784), Expect = 1.521e-103
Identity = 144/145 (99.31%), Postives = 144/145 (99.31%), Query Frame = 2
Query:  977 MNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            MNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFY TPTLIHLNSLFNNGKLLKNGAILFRCSIN
Sbjct:    1 MNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYSTPTLIHLNSLFNNGKLLKNGAILFRCSIN 145          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070155.1 (SMESG000070155.1)

HSP 1 Score: 295.434 bits (755), Expect = 2.130e-95
Identity = 165/430 (38.37%), Postives = 251/430 (58.37%), Query Frame = 2
Query:  122 QEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            +E + LL  +DF  D+ L  DL+C+IC+ IL+   Q+ CGCRYCY CIEK+L    K+CPK   +C+ + ++ N ++  DHFANK +L+IKVKCPE  C     L  + +H+KSHSI CP+ E+GC  S + +  +  H+T E+YSHT LL+ESI+N+ NEI  L+EN  R ++ I  LQ  + N  LQ+  EI +    I+++K   K  +    EL  DS Q N+   I +   + S        +      +R + +   +    ++  +  APFEWKIE+    + ++K    +  YS+ FYSH NGYK+RL ++P G+   E  HL V+F ++ GE+DD L WPM + V IGLVDQ+   I V + ++  S+++ F+  F +PS R+   D   Y    LI+L  L NN KL+ +G+I  +C ++
Sbjct:    7 EEAWNLLNKFDFVFDSNLSDDLLCSICKNILHIASQNICGCRYCYHCIEKYLNGNEKFCPKNIGNCK-KLINFNRDITIDHFANKKILSIKVKCPELFCQFSDSLIVMADHMKSHSIKCPYAEVGCIESRMDTHNIKDHLTNETYSHTNLLIESIRNLSNEINFLKENAIRNKEMIENLQ--IENIELQN--EINM----INIVKMEMKTLQDGMKELKNDSQQKNK--LIYEMMRKNS--------NEQILIEKRLKSLEEINEGN-LTNTKFYAPFEWKIENISQLIDQSKLGNQRFTYSQSFYSHVNGYKMRLYIDPYGYQINEYAHLVVYFVVVNGEYDDVLDWPMNKLVTIGLVDQILGSIYVKESFKANSIDRYFKAAFDRPSQRS--PDDIDYCQSVLINLKVLLNNPKLVMDGSIFLKCFVD 414          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067196.1 (SMESG000067196.1)

HSP 1 Score: 294.664 bits (753), Expect = 6.678e-95
Identity = 156/442 (35.29%), Postives = 248/442 (56.11%), Query Frame = 2
Query:  104 MANSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEESYSHTILLMESIQNMKNEIEILRENLQRKEKTIGKL-------QNQLRNNTLQHNKEIAIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTESETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSI 1408
            MAN+K+ +I++L   Y+F++D   Y DLIC IC KILN   QS CGCRYCYSCI  +L    K CP+ ++DC+   ++  N+LQ DH ANK +  I+V+CPE  C  K EL+ + EH++ H   CP+H +GC  +N  SQA+ QH+ E+  SH  +L E I+ MK E + L   +   E  + +L       + QL +     N+ I+ MK    +L+     ++    E+  + +++     + +  ++ S  Y E       +G   SR  S  +      A +  +P+ W + DF+ +   A++ +   I S  F S   GY +RL + PNG+G  EN ++SV F ++EG+FD  L WPM++++ I L+DQ S    + +K+ + + EK  + IFHKPS+R   ++ Y YG    I ++SL +N +L KNG+IL +C +
Sbjct:    1 MANNKYDDIWELFDKYNFEIDYKTYKDLICIICNKILNNSTQSSCGCRYCYSCISTYLNGEEKCCPRDSEDCKNHLINSQNDLQIDHAANKIISKIEVQCPEPQCQVKTELQKMSEHIQRHKFQCPYHTIGCQINNSNSQALKQHLIED--SHATMLSEFIEIMKTENKKLNAMVSITEARVDELTVMNVDMKQQLIDVKNGENEIISKMK----ILEEDGHYKQNIINEIMEEIVKL--QSHLKNLEQKISTKYPEE------NGNTLSRRTSKLTLTPPTVAMQQFSPYSWTVGDFLAKWDSARNGIETFINSDIFLSKEMGYGIRLSLYPNGYGSAENNYVSVLFGLMEGQFDHKLAWPMKQEITIALIDQQSGSFHIHEKFSYGATEKQSKYIFHKPSSRYTNSN-YMYGAAKFIKIDSLISNNRLFKNGSILLKCFV 427          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070096.1 (SMESG000070096.1)

HSP 1 Score: 277.33 bits (708), Expect = 7.739e-88
Identity = 161/462 (34.85%), Postives = 262/462 (56.71%), Query Frame = 2
Query:  113 SKFQEIYQLLTDYDFQVD-TFLYSDLICTICEKILNRPYQSPCGCRYCYSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKCPEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQA---MVQHMTEESYSHTILLMESIQNMKNEIEILR----------ENLQRKEKTIGKLQNQLRNNTL-QHNKEIAIMKK-------DISLLKN-VSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTE------SETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKSKLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDDSLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEIADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN 1411
            SK++E++ L   Y+F+++    ++DL C +C+ +L    QSPCGCRYC+SCI  +L    K CP P DDC+ Q ++I+ ++  DH AN+ +  + VKCPE++C+ + +L+ + EH+ SH ++CP+ ++GC   N+K +    +V HM +   SH  LL++ + N+KN+IE L+          EN+           N ++ +TL Q +++I+ +K        DI  L++ + ++     +E+   ++++ +          E V Y        S TDS  S    +   S           E IAPFEWKI +FM + + A S     +YS+PFYSH+NGYK++LR++PNG    +  +LSV F II GE+DD L WPM +QV I L++Q +  + +S +Y++ SV K  + IF KP +R E  + YF+GT   I  + LFNN K+  N +I+ +C I+
Sbjct:    3 SKYEEMWNLFNKYNFKLNLNSKFADLKCCVCQGLLRNASQSPCGCRYCHSCIVVYLGDEEKCCPGPHDDCKYQRINIHKDITIDHAANRKISMVDVKCPEESCNARIQLRQMPEHITSHILSCPYLDIGC---NIKLRGVCELVDHMLDADQSHASLLIQCLNNIKNDIEYLKGSDSASFSSSENINAINYDAISQINNIKLSTLPQISQKISKLKSETAQRGNDIGRLESQIEEVNSNCMSEIKILTLEMER-------LRNELVAYKIGKDLDISTTDSMLSSADSNSTSSFILK----QVKEHIAPFEWKITNFMEKHERAISGEKLTVYSEPFYSHKNGYKIQLRIDPNGDEAVKALYLSVSFGIIGGEYDDELDWPMTKQVKISLINQKTGLVHISKRYKFDSVLKKSKCIFFKPISRFEDDEDYFFGTLKFIKFSVLFNNQKIFLNDSIVLKCFID 450          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF32.932e-2923.88TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.585e-2522.20TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.585e-2522.20TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF63.632e-2423.24TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF63.632e-2423.24TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.505e-1433.33TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-25.160e-939.44TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf49.180e-1528.76gene:FBgn0026319 transcript:FBtr0334401[more]
Traf41.222e-1428.76gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like2.123e-930.77gene:FBgn0030748 transcript:FBtr0074275[more]
Traf-like3.261e-930.77gene:FBgn0030748 transcript:FBtr0074273[more]
Traf-like3.434e-930.77gene:FBgn0030748 transcript:FBtr0308606[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf61.224e-2923.20TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf61.224e-2923.20TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf61.224e-2923.20TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf4a2.534e-2223.01tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a2.534e-2223.01tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh21.366e-2322.42slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh23.241e-2123.44slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
egf2.596e-2022.75epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
slc12a17.150e-1923.43solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a13.653e-1824.00solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf61.323e-2823.67TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf31.352e-2522.40TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.352e-2522.40TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.655e-2323.08TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf25.729e-2025.75TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6IWL4|TRAF6_DANRE9.240e-2923.20TNF receptor-associated factor 6 OS=Danio rerio OX... [more]
sp|P70196|TRAF6_MOUSE9.252e-2823.67TNF receptor-associated factor 6 OS=Mus musculus O... [more]
sp|B5DF45|TRAF6_RAT6.402e-2724.38TNF receptor-associated factor 6 OS=Rattus norvegi... [more]
sp|B6CJY4|TRAF6_CERAT4.885e-2423.44TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|B6CJY5|TRAF6_MACMU5.068e-2423.44TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GY083.695e-3547.26TNF receptor associated factor 5 (Fragment) OS=Sch... [more]
T1E1011.979e-3426.14TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZID81.409e-2930.77TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
A0A498M8A63.135e-2924.30TNF receptor-associated factor OS=Labeo rohita OX=... [more]
A0A553RF851.066e-2825.79TNF receptor-associated factor OS=Danionella trans... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf66.799e-2924.19TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.216e-2623.82TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.216e-2623.82TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf4a1.380e-2222.13TNF receptor associated factor 4 [Source:NCBI gene... [more]
ENSAMXT00000035169.11.260e-1931.13pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.11.720e-2323.84pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.11.083e-2223.44pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf61.316e-1131.09TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.14.737e-734.21pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494645.911e-2723.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483945.678e-2625.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352373.610e-2425.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316904.027e-1924.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487738.461e-1920.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf31.901e-2923.06TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf2b3.746e-1925.08TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b4.394e-1924.77TNF receptor associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.21.788e-1823.77TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf4a3.918e-1822.90TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070236.10.000e+0100.00SMESG000070236.1[more]
SMESG000070235.11.521e-10399.31SMESG000070235.1[more]
SMESG000070155.12.130e-9538.37SMESG000070155.1[more]
SMESG000067196.16.678e-9535.29SMESG000067196.1[more]
SMESG000070096.17.739e-8834.85SMESG000070096.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027110 ID=SMED30027110|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1501bp
AAATATTAGTAAATTCAATATTATTCTTGGAATTATTTTAATATAATCGC
GTCAGTATTTATTTATTGGAACTTTTATCAAATTCATATGCAATAATTGC
TCAATGGCTAATTCAAAATTTCAAGAAATTTACCAACTCTTAACCGATTA
CGATTTCCAGGTCGACACTTTCTTGTATTCTGATTTGATATGCACAATAT
GTGAGAAAATTCTCAATAGGCCGTATCAAAGCCCATGCGGTTGCAGATAC
TGTTATTCATGTATTGAAAAGCATCTAAAGAGCGGAAACAAGTACTGCCC
CAAGCCGACTGACGACTGTCGGGAACAATGTGTTGACATCAATAATAATT
TACAATTTGATCATTTCGCCAATAAAAATGTATTGGCAATTAAAGTGAAA
TGCCCGGAAAAAGCATGCGACACTAAAGCCGAGTTAAAGAATTTAATGGA
ACACTTGAAATCCCATAGCATCAATTGCCCATTCCATGAAATGGGATGCA
GTCACTCGAATGTCAAGAGTCAGGCCATGGTACAACACATGACGGAGGAA
AGCTATTCACACACGATATTATTAATGGAGTCTATTCAAAACATGAAAAA
TGAAATTGAAATACTCCGAGAGAATTTACAAAGAAAAGAAAAAACTATTG
GAAAATTACAAAATCAACTGAGGAACAATACACTTCAACACAACAAGGAG
ATTGCCATAATGAAAAAGGATATTTCATTGCTAAAAAATGTGTCAAAAAT
CGAAAAGGGAACTACTGCTGAATTGCCAACAGATTCCATTCAAATAAATC
AAGATGGAACAATTTGTGACTTTACAGAGGAAGAAAGCGTTCATTATACG
GAATCAGAAACAGACTCCCATTTCAGTGGAACAAGGCGAAGTCGGTTTAT
GTCTGCTACAAGTTCTCTTAGATGTATATCAGCAAATGAAGACATTGCAC
CTTTCGAATGGAAAATCGAAGATTTTATGAATCGTGTCCAAGAAGCTAAA
TCGAAACTGAGTAAAGTTATTTACAGCAAACCGTTTTATTCCCATAGAAA
CGGTTATAAATTACGGTTACGCGTCAATCCGAACGGATTCGGAAAATGGG
AAAATACCCATCTGTCGGTTTTTTTCAGTATCATTGAAGGTGAATTCGAC
GATTCGCTATTTTGGCCGATGGAACGACAAGTGGTAATCGGATTAGTGGA
TCAAGTTTCAAATAAAATTCAAGTCAGTGATAAATACAGATGGAAATCTG
TTGAAAAGGACTTCCAAGTAATCTTTCACAAACCCTCAACGAGAACTGAA
ATTGCAGATTATTATTTCTACGGTACCCCCACACTTATACACCTTAATTC
CTTATTTAACAATGGTAAACTATTGAAAAACGGCGCCATTCTCTTTAGGT
GTTCCATTAATTGAGCTCATCTATTTTATCATTCAAATTTCAACTATTTA
TTGGTGTTTATTATCTTTCATTTCTGCGTCATTTAGATTGTTATTGCGTA
A
back to top

protein sequence of SMED30027110-orf-1

>SMED30027110-orf-1 ID=SMED30027110-orf-1|Name=SMED30027110-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=437bp
MANSKFQEIYQLLTDYDFQVDTFLYSDLICTICEKILNRPYQSPCGCRYC
YSCIEKHLKSGNKYCPKPTDDCREQCVDINNNLQFDHFANKNVLAIKVKC
PEKACDTKAELKNLMEHLKSHSINCPFHEMGCSHSNVKSQAMVQHMTEES
YSHTILLMESIQNMKNEIEILRENLQRKEKTIGKLQNQLRNNTLQHNKEI
AIMKKDISLLKNVSKIEKGTTAELPTDSIQINQDGTICDFTEEESVHYTE
SETDSHFSGTRRSRFMSATSSLRCISANEDIAPFEWKIEDFMNRVQEAKS
KLSKVIYSKPFYSHRNGYKLRLRVNPNGFGKWENTHLSVFFSIIEGEFDD
SLFWPMERQVVIGLVDQVSNKIQVSDKYRWKSVEKDFQVIFHKPSTRTEI
ADYYFYGTPTLIHLNSLFNNGKLLKNGAILFRCSIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0005164tumor necrosis factor receptor binding
GO:0046872metal ion binding
GO:0005515protein binding
GO:0008270zinc ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
GO:0042981regulation of apoptotic process
GO:0043122regulation of I-kappaB kinase/NF-kappaB signaling
GO:0007165signal transduction
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0046330positive regulation of JNK cascade
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 158..195
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 121..435
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 11..120
NoneNo IPR availableCDDcd16449RING-HCcoord: 30..66
e-value: 5.31222E-9
score: 49.3881
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 24..90
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 286..417
e-value: 0.0044
score: 26.2
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 281..435
score: 15.149
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 248..436
e-value: 1.0E-38
score: 134.7
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 284..435
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 12..138
e-value: 1.4E-17
score: 65.7
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 121..435
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 11..120
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 30..66
score: 9.465