Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30027094
Length (bp)1404
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase (SMED30027094) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30027094) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027094

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30027094SMESG000075171.1 Contig5208_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CB (protein phosphatase 1 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9282])

HSP 1 Score: 309.301 bits (791), Expect = 6.083e-102
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CB (protein phosphatase 1 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9282])

HSP 1 Score: 309.301 bits (791), Expect = 6.083e-102
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CB (protein phosphatase 1 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9282])

HSP 1 Score: 309.301 bits (791), Expect = 6.083e-102
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CA (protein phosphatase 1 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9281])

HSP 1 Score: 305.449 bits (781), Expect = 2.169e-100
Identity = 156/324 (48.15%), Postives = 202/324 (62.35%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQW 1148
             +LD  I  +   Q S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG++V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++           +L   F IL P    K ++
Sbjct:    7 LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDE----------TLMCSFQILKPADKNKGKY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 304.679 bits (779), Expect = 3.163e-100
Identity = 154/321 (47.98%), Postives = 203/321 (63.24%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIK 1139
             ++D  I+ +   + S PG    +++ + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG++V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++           +L   F IL P +  K
Sbjct:    7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDE----------TLMCSFQILKPAEKKK 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-1 (Serine/threonine-protein phosphatase PP1-alpha [Source:UniProtKB/Swiss-Prot;Acc:Q27497])

HSP 1 Score: 301.212 bits (770), Expect = 3.177e-99
Identity = 156/328 (47.56%), Postives = 205/328 (62.50%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPP-DKSIKNQW 1148
            D   ++D  I  +   +   PG    + + + RALC   +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R  S K WK+F   F+ LPIAA+ID  IFCCHGGLSPD      +   E I+ + RP++VP  G++CDLLW+DP       +K  +GW  N RG S+ FG DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +++           +L   F IL P +K  K Q+
Sbjct:    4 DGDLNIDNLITRLLEVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLKICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRF-SIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPD------LQNMEQIRRVMRPTDVPDTGLLCDLLWSDP-------DKDVTGWGENDRGVSFTFGPDVVAKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDE----------TLMCSFQILKPSEKKAKYQY 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-2 (Serine/threonine-protein phosphatase PP1-beta [Source:UniProtKB/Swiss-Prot;Acc:P48727])

HSP 1 Score: 300.056 bits (767), Expect = 8.506e-99
Identity = 147/294 (50.00%), Postives = 191/294 (64.97%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLE 1058
             +LD  I  +   + S PG    + + + + LC   +++ L +  +L+L+AP+K+CGD+HGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAIID  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K  +GW  N RG S+ FG +V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  +  ++
Sbjct:    6 LNLDNIISRLLEVRGSKPGKNVQLTESEIKGLCQKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVTGWGENDRGVSFTFGPEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGSMMTVD 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-1 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EC18])

HSP 1 Score: 286.96 bits (733), Expect = 2.001e-93
Identity = 144/295 (48.81%), Postives = 191/295 (64.75%), Query Frame = 3
Query:  258 DCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLR--ETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSI 1136
            + R +CV+ +++ + +  +L+L+ P+K+ GDIHGQ  DL+R+F+L G+P +  YLFLGDYVDRG  S++ I LL  YK+KYP N FLLRGNHE   +NR+YGF  E  +R  S K WK F  VF+ +P+AA+IDN IFCCHGGLSP        NLR  + +K + RP +V + G++CD+LW+DP       + +  GW  N RG SYVFG DV+  FL K  LD++VR HQVV DGYEF+    LVT+FSA NYCG FDNA  V N++  EN L          F IL P   +
Sbjct:   39 EIRMVCVLARQIFMHQPMLLELEPPLKIGGDIHGQFADLLRLFNLAGYPPESNYLFLGDYVDRGPKSIETIVLLLCYKIKYPNNFFLLRGNHEVANLNRIYGFYDE-CKRRYSVKLWKCFQDVFNCMPVAALIDNKIFCCHGGLSP--------NLRSLDQLKRLSRPCDVQETGLLCDVLWSDP-------DATVVGWAPNERGVSYVFGVDVLAQFLQKMDLDIVVRGHQVVEDGYEFFGRRGLVTVFSAPNYCGEFDNAGAVMNVD--ENLLC--------SFQILKPQSQL 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: ZK938.1 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:G5ECL6])

HSP 1 Score: 257.684 bits (657), Expect = 2.380e-82
Identity = 136/293 (46.42%), Postives = 181/293 (61.77%), Query Frame = 3
Query:  174 VFHLDKFIENIESFQ-RSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVF 1049
            + ++  FI+ + S    SN      I++ D   +    K ++  + T+++++API VCGDIHGQ  DL+RIF+ C  P  Q YLFLGDYVDRG   L+VI LL AYK++YP   F+LRGNHE   INR YGF  E  +R  S   +  F  +F++LP+ A+I   IFC HGGLSP     E V+  +  K I RP + P   +  DLLWADP       E + +GW  N+RG SY+FG++V++ F +K  +DLI R HQVV DGYEF+ D  LVTIFSA  YCG FDN AG+ 
Sbjct:    1 MVNIPNFIDKVLSVNDTSNASLTHCIKEADIDGVIEECKDILSAQATMVEVQAPIAVCGDIHGQYTDLLRIFNRCSFPPDQNYLFLGDYVDRGRQQLEVICLLMAYKVRYPNGFFILRGNHECASINRTYGFYDEC-KRRYSLALYNEFQNLFNSLPLCAMISGRIFCMHGGLSP-----ELVSWTQLAKII-RPFDPPNACLAMDLLWADP-------ENNHTGWGKNSRGVSYIFGANVVKDFTEKMNIDLIARGHQVVQDGYEFFADKRLVTIFSAPKYCGEFDNNAGIM 279          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-4 (Serine/threonine-protein phosphatase PP1-delta [Source:UniProtKB/Swiss-Prot;Acc:P91420])

HSP 1 Score: 256.144 bits (653), Expect = 4.539e-82
Identity = 123/292 (42.12%), Postives = 175/292 (59.93%), Query Frame = 3
Query:  183 LDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLE 1058
            +D  +  + +   S     T + + + +  C + K +   + ++L+++ PI VCGDIHGQ  DL+RIFD  G P    +LFLGDYVDRG  +++ I L+F +K+KYP N F+LRGNHE   INRVYGF +E   R  S++ W  F   F+ +P+  +I + I C HGGLSP       +   + ++ +PRP + P   I  DLLWADP       ++   GW +NTRG SYVFG DV+     +  +DL+ RAHQVV DGYEF+    +VTIFSA +YCG FDN+A    ++
Sbjct:    7 VDNLMSRLLNVGMSGGRLTTSVNEQELQTCCAVAKSVFASQASLLEVEPPIIVCGDIHGQYSDLLRIFDKNGFPPDINFLFLGDYVDRGRQNIETICLMFCFKIKYPENFFMLRGNHECPAINRVYGFYEECNRRYKSTRLWSIFQDTFNWMPLCGLIGSRILCMHGGLSPH------LQTLDQLRQLPRPQDPPNPSIGIDLLWADP-------DQWVKGWQANTRGVSYVFGQDVVADVCSRLDIDLVARAHQVVQDGYEFFASKKMVTIFSAPHYCGQFDNSAATMKVD 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0071447)

HSP 1 Score: 300.056 bits (767), Expect = 1.127e-98
Identity = 146/297 (49.16%), Postives = 192/297 (64.65%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLE 1058
            D   ++D  I+ +   +    G +  + + + R LC+  +++ LQ+  +L+L+AP+ +CGDIHGQ  DL+R+F+  G P    YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAIID  IFCCHGGLSPD      +   E I+ + RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+  ++
Sbjct:    3 DFDLNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPD------LQGMEQIRRLMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVD 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0333305)

HSP 1 Score: 300.056 bits (767), Expect = 1.127e-98
Identity = 146/297 (49.16%), Postives = 192/297 (64.65%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLE 1058
            D   ++D  I+ +   +    G +  + + + R LC+  +++ LQ+  +L+L+AP+ +CGDIHGQ  DL+R+F+  G P    YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAIID  IFCCHGGLSPD      +   E I+ + RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+  ++
Sbjct:    3 DFDLNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPD------LQGMEQIRRLMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVD 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1-87B (gene:FBgn0004103 transcript:FBtr0082595)

HSP 1 Score: 298.901 bits (764), Expect = 1.300e-98
Identity = 153/323 (47.37%), Postives = 203/323 (62.85%), Query Frame = 3
Query:  174 VFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHIL-PPDKSIK 1139
            V ++D  I  +   + + PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KY  N FLLRGNHE   INR+YGF  E  +R  S K WK+F   F+ LP+AAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K + GW  N RG S+ FG++V+  FL K   DLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++           +L   F IL P DK  K
Sbjct:    4 VMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDE-CKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPD------LTSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDD----------TLMCSFQILKPADKRKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1-13C (gene:FBgn0003132 transcript:FBtr0074017)

HSP 1 Score: 298.13 bits (762), Expect = 2.234e-98
Identity = 144/296 (48.65%), Postives = 196/296 (66.22%), Query Frame = 3
Query:  171 HVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLE 1058
             V +L+  I  +   + + PG    + + + R LC+  ++++L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G+P +  YLFLGDYVDRG  SL+ I LL AYK+KY  N FLLRGNHE   INR+YGF  E  +R  + K WK+F   F+ LP+ AI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K + GW  N RG S+ FG++V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++
Sbjct:    3 EVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDE-CKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPD------LTSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVD 284          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0474146)

HSP 1 Score: 299.671 bits (766), Expect = 2.325e-98
Identity = 146/297 (49.16%), Postives = 192/297 (64.65%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLE 1058
            D   ++D  I+ +   +    G +  + + + R LC+  +++ LQ+  +L+L+AP+ +CGDIHGQ  DL+R+F+  G P    YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAIID  IFCCHGGLSPD      +   E I+ + RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+  ++
Sbjct:    3 DFDLNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPD------LQGMEQIRRLMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVD 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 308.916 bits (790), Expect = 5.073e-102
Identity = 156/327 (47.71%), Postives = 203/327 (62.08%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
             ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAIID  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       +N G  + PP
Sbjct:    6 LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQYSGVNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 307.76 bits (787), Expect = 1.727e-101
Identity = 156/336 (46.43%), Postives = 209/336 (62.20%), Query Frame = 3
Query:  180 HLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFH----ILPPDKSIKN 1142
            ++D  I+ +   + S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGD+HGQ YDL+R+F+  G+P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAI+D  IFCCHGGLSPD      +   E I+ + RP++VP  G++CDLLWADP       +K   GW  N RG S+ FGSDV+  FL K  +DLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +           L+P+E +++       GGF     + PP  + K 
Sbjct:    8 NIDSIIQRLLEVKGSRPGKNVQLTEQEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPD------LQSMEQIRRVMRPTDVPDQGLLCDLLWADP-------DKDVMGWGENDRGVSFTFGSDVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKVL--SYGGAGGFGNSRPVTPPRNTAKG 327          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: CABZ01076667.1 (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:571753])

HSP 1 Score: 305.449 bits (781), Expect = 1.121e-100
Identity = 154/321 (47.98%), Postives = 204/321 (63.55%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIK 1139
             ++D  I+ +   + S PG    +++ + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G+P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG++V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++           +L   F IL P +  K
Sbjct:    7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECRRRYN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDE----------TLMCSFQILKPAEKKK 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 302.753 bits (774), Expect = 1.256e-99
Identity = 145/296 (48.99%), Postives = 195/296 (65.88%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPS 1064
             ++D  I+ +   + S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGD+HGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAI+D  IFCCHGGLSPD      +   E ++ + RP++VP  G++CDLLWADP       +K   GW  N RG S+ FG+DV+  FL K  +DLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++ +
Sbjct:    7 LNIDSIIQRLLEVKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPD------LQSMEQVRRVMRPTDVPDQGLLCDLLWADP-------DKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDET 288          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 299.671 bits (766), Expect = 1.818e-98
Identity = 143/290 (49.31%), Postives = 194/290 (66.90%), Query Frame = 3
Query:  195 IENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPS 1064
            ++++ + + S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGD+HGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAI+D  IFCCHGGLSPD      +   E ++ + RP++VP  G++CDLLWADP       +K   GW  N RG S+ FG+DV+  FL K  +DLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++ +
Sbjct:    9 LKSLHNLKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPD------LQSMEQVRRVMRPTDVPDQGLLCDLLWADP-------DKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDET 284          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 309.301 bits (791), Expect = 4.116e-102
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 305.449 bits (781), Expect = 1.725e-100
Identity = 154/311 (49.52%), Postives = 197/311 (63.34%), Query Frame = 3
Query:  225 NPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
             PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:   21 RPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 317          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 304.679 bits (779), Expect = 2.632e-100
Identity = 154/311 (49.52%), Postives = 197/311 (63.34%), Query Frame = 3
Query:  225 NPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
             PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:   21 RPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 317          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 304.679 bits (779), Expect = 3.060e-100
Identity = 157/328 (47.87%), Postives = 205/328 (62.50%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEP----SENQLIPNEVSL-NGGFHILPPDKSIKNQ 1145
             ++D  I+ +   + S PG    +++ + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG++V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++     S   L P E    N    + PP   I  Q
Sbjct:    7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNASRPVTPPRGMITKQ 320          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 304.679 bits (779), Expect = 3.724e-100
Identity = 163/337 (48.37%), Postives = 207/337 (61.42%), Query Frame = 3
Query:  150 ELDVQIDHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEP----SENQLIPNEVSL-NGGFHILPPDKSIKNQ 1145
            EL   ID    L K      SF+ S PG    +++ + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG++V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++     S   L P E    N    + PP   I  Q
Sbjct:   10 ELQSAIDSYGRLPK------SFRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNASRPVTPPRGMITKQ 326          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cb (protein phosphatase 1 catalytic subunit beta [Source:MGI Symbol;Acc:MGI:104871])

HSP 1 Score: 309.301 bits (791), Expect = 4.176e-102
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cb (protein phosphatase 1 catalytic subunit beta [Source:MGI Symbol;Acc:MGI:104871])

HSP 1 Score: 309.301 bits (791), Expect = 4.176e-102
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cc (protein phosphatase 1 catalytic subunit gamma [Source:MGI Symbol;Acc:MGI:104872])

HSP 1 Score: 304.294 bits (778), Expect = 2.697e-100
Identity = 154/321 (47.98%), Postives = 203/321 (63.24%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIK 1139
             ++D  I+ +   + S PG    +++ + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG++V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++           +L   F IL P +  K
Sbjct:    7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDE----------TLMCSFQILKPAEKKK 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1ca (protein phosphatase 1 catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:103016])

HSP 1 Score: 304.294 bits (778), Expect = 3.579e-100
Identity = 155/324 (47.84%), Postives = 202/324 (62.35%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQW 1148
             +LD  I  +   Q S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK++YP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG++V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++           +L   F IL P    K ++
Sbjct:    7 LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDE----------TLMCSFQILKPADKNKGKY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1ca (protein phosphatase 1 catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:103016])

HSP 1 Score: 304.294 bits (778), Expect = 3.579e-100
Identity = 155/324 (47.84%), Postives = 202/324 (62.35%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQW 1148
             +LD  I  +   Q S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK++YP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG++V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++           +L   F IL P    K ++
Sbjct:    7 LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDE----------TLMCSFQILKPADKNKGKY 306          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q5I085|PP1B_XENTR (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis OX=8364 GN=ppp1cb PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 2.180e-101
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q6GQL2|PP1B_XENLA (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis OX=8355 GN=ppp1cb PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 2.180e-101
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62142|PP1B_RAT (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp1cb PE=1 SV=3)

HSP 1 Score: 309.301 bits (791), Expect = 2.921e-101
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62143|PP1B_RABIT (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus OX=9986 GN=PPP1CB PE=1 SV=3)

HSP 1 Score: 309.301 bits (791), Expect = 2.921e-101
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q5R740|PP1B_PONAB (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii OX=9601 GN=PPP1CB PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 2.921e-101
Identity = 157/330 (47.58%), Postives = 204/330 (61.82%), Query Frame = 3
Query:  168 DHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            D   ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       LN G  + PP
Sbjct:    3 DGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A3S5BQW5 (Serine/threonine-protein phosphatase OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS28799 PE=3 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 4.639e-120
Identity = 179/324 (55.25%), Postives = 224/324 (69.14%), Query Frame = 3
Query:  180 HLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQWL 1151
            HLDK I+++       PG R  + +LDC ALC +VK +   E+ +L+L APIKVCGDIHGQ YDL+R+F LC +P K +YLFLGDYVDRG  S++V+ LLFA K+KYP   F+LRGNHES  +NR+YGF+ E+ ER   SK  K F+ VFS +P+AAII+NSIFCCHGGLSP+ L      L+E I  IPRP +VP+ G++CDLLWADP D   + E    GW  + RGCS+ FG DVI+ FLDKF LDLIVRAHQVV DGYEFY +  L+T+FSA NYC  FDNA GVF ++  E     +   L GGF I+ P+K      L
Sbjct:   15 HLDKLIDSLR-LNIETPGVRMELNELDCIALCCLVKPIFESENMLLELAAPIKVCGDIHGQFYDLLRLFLLCEYPPKTRYLFLGDYVDRGPQSVEVLCLLFALKIKYPRGFFMLRGNHESDIVNRIYGFRDEIRERYGKSKLRKHFSNVFSVMPVAAIIENSIFCCHGGLSPELLQDNVTGLQEMINPIPRPVDVPRQGLLCDLLWADPADYAPNGE-MQLGWTPSPRGCSWCFGHDVIDKFLDKFGLDLIVRAHQVVEDGYEFYHNRKLITVFSAPNYCNQFDNAGGVFVIKKEEE----SSSVLEGGFQIIRPEKKFNAMTL 332          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A183AE29 (Serine/threonine-protein phosphatase OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5214 PE=3 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 3.545e-115
Identity = 168/315 (53.33%), Postives = 222/315 (70.48%), Query Frame = 3
Query:  183 LDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPD 1127
            LDK I+N++S   S PG R  I +L+C ALC +VK +   E  +L ++APIKVCGDIHGQ YDL+R+FD+C +P + ++LFLGDYVDRG  S++ + LLFA K+KYP   F+LRGNHES  +NRVYGF++EL ER   SK  K F  VF+ +P+AA+I+NSIFCCHGGLSPD +      L   I  I RP+EVP+ G++CDLLW+DP D + + +   +GW  +TRGCS+ FG DVI  FLDK+ LDL+VRAHQVV DGYEFY +  L+T+FSA NYC  F N+ GVF +  ++        +L GGF ++ PD
Sbjct:   13 LDKVIDNLKS-NISTPGVRVNISELECIALCCLVKPIFESESMLLRIQAPIKVCGDIHGQFYDLLRLFDVCEYPPRSRFLFLGDYVDRGQQSVETVCLLFALKIKYPRGFFMLRGNHESEIVNRVYGFREELKERFGKSKIHKHFVSVFNVMPVAAVIENSIFCCHGGLSPDLIPEVHKPLDALINQIQRPTEVPRQGLLCDLLWSDPADYNQAGD-LPTGWHPSTRGCSFTFGVDVINTFLDKYELDLVVRAHQVVEDGYEFYYENRLITLFSAPNYCNQFQNSGGVFVVRKADEVF----GTLEGGFEVIRPD 321          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A5J4NPP9 (Serine/threonine-protein phosphatase OS=Paragonimus westermani OX=34504 GN=DEA37_0005794 PE=3 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 5.132e-114
Identity = 164/315 (52.06%), Postives = 222/315 (70.48%), Query Frame = 3
Query:  183 LDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPD 1127
            LDK I  ++   R+ PG R PI +L+C ALC +VK +   E+ ++ ++APIKVCGDIHGQ YDL+R+FD+C +P + ++LFLGDYVDRG  S++ +SLLFA+K+KYP   ++LRGNHES  INRVYGF++EL ER   SK  K F  VF+ +P+AA+I+NSIFCCHGGLSPD +      L   I  I RP+E+P+ G++CDL+W+DP D   + +    GW+ +TRGC+Y FG DVI  FLD + LDL+VRAHQVV DGYEFY +  L+T+FSA NYC  F N+ GVF +  ++        +L GGF ++ PD
Sbjct:   13 LDKLISTLKENIRT-PGVRVPISELECIALCCLVKPIFQSENMLVRVQAPIKVCGDIHGQFYDLLRLFDVCEYPPRSRFLFLGDYVDRGPQSVETLSLLFAFKIKYPRGFYMLRGNHESELINRVYGFREELKERFGKSKIHKHFVSVFNMMPVAALIENSIFCCHGGLSPDLMPEIHKPLDTLINQIQRPTEIPRQGLLCDLVWSDPADYTQAGD-LPVGWLPSTRGCAYNFGVDVINTFLDTYELDLVVRAHQVVEDGYEFYYENRLITLFSAPNYCNQFQNSGGVFVVRKADESF----GTLEGGFEVIRPD 321          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A4S2LG51 (Serine/threonine-protein phosphatase OS=Opisthorchis felineus OX=147828 GN=CRM22_009142 PE=3 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 6.240e-113
Identity = 162/319 (50.78%), Postives = 223/319 (69.91%), Query Frame = 3
Query:  183 LDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIK 1139
            LDK I +++   R +PG R PI +L+C ALC +VK +   E+ ++ ++APIKVCGDIHGQ YDL+R+FD+C +P + ++LFLGDYVDRG  S++ + LLFA+K+KYP   F+LRGNHES  INRVYGF++EL ER   +K  K F  VF+ +P+AA+I+NSIFCCHGGLSPD +      L   I  I RP+E+P+ G++CDL+W+DP D   + +    GW+ ++RGC+Y FG DVI  FLD + LDL+VRAHQVV DGYEFY +  L+T+FSA NYC  F N+ GVF +  ++        +L GGF ++ PD   +
Sbjct:   13 LDKIIASLKDNIR-HPGVRVPITELECVALCCLVKPIFQSENMLIRIQAPIKVCGDIHGQFYDLLRLFDICEYPPRSRFLFLGDYVDRGPQSVETLCLLFAFKIKYPRGFFMLRGNHESELINRVYGFREELKERFGKTKVHKHFVSVFNVMPVAAVIENSIFCCHGGLSPDLIPEVHKPLDTLINQIQRPTEIPRQGLLCDLVWSDPADYTQAGD-LPVGWLPSSRGCAYNFGVDVINTFLDTYELDLVVRAHQVVEDGYEFYYENRLITLFSAPNYCNQFQNSGGVFVVRKADEVF----GTLEGGFEVIRPDNRYR 325          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A074ZXK9 (Serine/threonine-protein phosphatase OS=Opisthorchis viverrini OX=6198 GN=T265_13657 PE=3 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 1.869e-112
Identity = 163/319 (51.10%), Postives = 222/319 (69.59%), Query Frame = 3
Query:  183 LDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIK 1139
            LDK I +++   R +PG R PI +L+C ALC +VK +   E+ ++ + APIKVCGDIHGQ YDL+R+FD+C +P + ++LFLGDYVDRG  S++ + LLFA+K+KYP   F+LRGNHES  INRVYGF++EL ER   SK  K F  VF+ +P+AA+I+NSIFCCHGGLSPD +      L   I  I RP+E+P+ G++CDL+W+DP D   + +    GW+ ++RGC+Y FG DVI  FLD + LDL+VRAHQVV DGYEFY +  L+T+FSA NYC  F N+ GVF +  ++        +L GGF ++ PD   +
Sbjct:   13 LDKIIGSLKDNIR-HPGVRVPITELECVALCCLVKPIFQSENMLIRIHAPIKVCGDIHGQFYDLLRLFDICEYPPRSRFLFLGDYVDRGPQSVETLCLLFAFKIKYPRGFFMLRGNHESELINRVYGFREELKERFGKSKVHKHFVSVFNVMPVAAVIENSIFCCHGGLSPDLIPEVHKPLDTLINQIQRPTEIPRQGLLCDLVWSDPADYTQAGD-LPVGWLPSSRGCAYNFGVDVINTFLDTYELDLVVRAHQVVEDGYEFYYENRLITLFSAPNYCNQFQNSGGVFVVRKADEVF----GTLEGGFEVIRPDNRYR 325          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103028275])

HSP 1 Score: 308.531 bits (789), Expect = 6.488e-102
Identity = 156/327 (47.71%), Postives = 203/327 (62.08%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
             ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAIID  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       +N G  + PP
Sbjct:    6 LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQYGGVNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ENSAMXT00000056848.1 (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:103033313])

HSP 1 Score: 308.145 bits (788), Expect = 7.075e-102
Identity = 159/340 (46.76%), Postives = 206/340 (60.59%), Query Frame = 3
Query:  138 FSSNELDVQIDHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
             +  ELDV        D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       +N G  + PP
Sbjct:    1 MAEGELDV--------DSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:103034518])

HSP 1 Score: 308.145 bits (788), Expect = 8.609e-102
Identity = 157/337 (46.59%), Postives = 210/337 (62.31%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFH----ILPPDKSIKN 1142
             ++D  I+ +   + S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGD+HGQ YDL+R+F+  G+P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAI+D  IFCCHGGLSPD      +   E I+ + RP++VP  G++CDLLWADP       +K   GW  N RG S+ FGSDV+  FL K  +DLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +           L+P++ +L+    S  GGF     + PP  + K 
Sbjct:    7 LNIDSIIQRLLEVKGSRPGKNVQLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPD------LQSMEQIRRVMRPTDVPDQGLLCDLLWADP-------DKDVMGWGENDRGVSFTFGSDVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKLL--SYSGAGGFGSGRPVTPPRNAAKG 327          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cb (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103030509])

HSP 1 Score: 307.76 bits (787), Expect = 1.216e-101
Identity = 156/327 (47.71%), Postives = 203/327 (62.08%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
             ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAIID  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       +N G  + PP
Sbjct:    6 LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQYGGVNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cb (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103030509])

HSP 1 Score: 305.834 bits (782), Expect = 6.808e-101
Identity = 156/328 (47.56%), Postives = 204/328 (62.20%), Query Frame = 3
Query:  174 VFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
            V +  +++ N    +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAIID  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       +N G  + PP
Sbjct:   11 VLYFHRYLRN--RLRGCRPGKIVQMTEAEVRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQYGGVNSGRPVTPP 322          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 304.679 bits (779), Expect = 1.773e-101
Identity = 156/319 (48.90%), Postives = 204/319 (63.95%), Query Frame = 3
Query:  222 SNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPPDKSIKNQ 1145
            S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE+  INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K + GW  N RG S+ FG++V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +           L+P++ +  P  V LN G  + PP  + K +
Sbjct:    4 SRPGKNVQLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEA-SINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDTMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY-VGLNAGRPVTPPRNAAKKK 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.166 bits (692), Expect = 7.761e-89
Identity = 141/278 (50.72%), Postives = 173/278 (62.23%), Query Frame = 3
Query:  345 GDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQF---GIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPPDKSI 1136
            GDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP     G++CDLLW+DP       +K   GW  N RG S+ FG DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       +N G  + PP  ++
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGDAGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNSGRPVTPPKAAV 264          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 233.802 bits (595), Expect = 4.932e-75
Identity = 114/235 (48.51%), Postives = 151/235 (64.26%), Query Frame = 3
Query:  201 NIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAF 905
             + + +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  F
Sbjct:    1 RLPTVRGCRPGKTVHMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKF 221          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 205.682 bits (522), Expect = 7.943e-61
Identity = 108/263 (41.06%), Postives = 157/263 (59.70%), Query Frame = 3
Query:  291 LMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNT-RGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDG------SLVTIFSASNYCGTFDNAAGVFNLE 1058
            ++ +E T++D++AP+ VCGDIHGQ +DLM++F++ G P+  +YLFLGDYVDRGY S++ +  L+A K+ YP  +FLLRGNHE   +   + FK+E   +   +  + +    F  LP+AA+++    C HGGLSP+      V+  E I+ + R  E P FG MCDLLW+DP + D  +EK+   +  NT RGCSY +    +  FL    L  ++RAH+    GY  Y         SL+TIFSA NY   ++N A V   E
Sbjct:   54 ILRREKTMIDIEAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKYTET-VYDACMDAFDCLPLAALMNQQFLCVHGGLSPE------VHNLEDIRKLDRFKEPPAFGPMCDLLWSDPSE-DFGNEKTQEYFCHNTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYE 308          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 180.644 bits (457), Expect = 8.168e-52
Identity = 102/242 (42.15%), Postives = 146/242 (60.33%), Query Frame = 3
Query:  333 IKVCGDIHGQIYDLMRIFDLCGHPSKQK-YLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNL 1055
            I VCGDIHGQ +DL+ IF+L G PS+   Y+F GD+VDRG  S++VI +LF +KL YP +  L+RGNHE+  +N++YGF+ E+  +  +++ +  F+ VF  LP+A  I++ +   HGGL       + V L + I+ I R  + P  G MCDLLW+DP        +   G   + RG S  FG DV  AF+++  L+LI+R+H+   DGYE   DG  VT+FSA NYC    N     +L
Sbjct:  199 ITVCGDIHGQYFDLLHIFELNGLPSETNPYVFNGDFVDRGSWSVEVILVLFGFKLLYPDHFHLMRGNHETDNMNQMYGFEGEVKAKY-TAQMFDFFSEVFQWLPLAMCINSRVLIMHGGL----FSEDGVTL-DDIRKIDRNRQPPDSGPMCDLLWSDP--------QPQPGRSVSKRGVSCQFGPDVSRAFMEQNNLELIIRSHE-KPDGYEVAHDGRCVTVFSAPNYCDQMGNKGSYIHL 425          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 300.442 bits (768), Expect = 6.458e-100
Identity = 155/322 (48.14%), Postives = 203/322 (63.04%), Query Frame = 3
Query:  183 LDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHIL-PPDKSIKNQ 1145
            +D  I+ +   + S PG +  +E+ + R LC   + + +++  +L+L+APIK+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N F+LRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAIID  IFC HGGLSPD      +N  E I+ + RP+++P  G++CDLLW+DP       +K   GW  N RG S+ FG DV+  FL K  ++LI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++           SL   F IL P  KS+  Q
Sbjct:    8 VDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPD------LNSMEQIRRVMRPTDIPDVGLLCDLLWSDP-------DKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDE----------SLLCSFQILKPAQKSLPRQ 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ1 (Serine/threonine protein phosphatase Z, isoform of Ppz2p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000004478])

HSP 1 Score: 273.478 bits (698), Expect = 5.573e-85
Identity = 132/262 (50.38%), Postives = 170/262 (64.89%), Query Frame = 3
Query:  270 LCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNL 1055
            +C+  +++ L + ++L+L  P+K+ GD+HGQ  DL+R+F  CG P    YLFLGDYVDRG  SL+ I LLF YK+KYP N FLLRGNHE   + RVYGF  E   R N  K WK+F   F+TLP+AAI+   IFC HGGLSP       +N  + I+ + RP++VP FG++ DLLW+DP D       S + W  N RG SY +    I  FL+KF  DL+ RAH VV DGYEF+ D SLVT+FSA NYCG FDN   V ++
Sbjct:  393 ICIKAREIFLSQPSLLELSPPVKIVGDVHGQYGDLLRLFTKCGFPPSSNYLFLGDYVDRGKQSLETILLLFCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCN-IKIWKTFIDTFNTLPLAAIVAGKIFCVHGGLSP------VLNSMDEIRHVVRPTDVPDFGLINDLLWSDPTD-------SPNEWEDNERGVSYCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMSV 640          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPQ1 (Protein phosphatase that regulates the mating response; negatively regulates the MAP kinase signaling cascade during mating; member of the serine/threonine phosphatase PP1 family [Source:SGD;Acc:S000006100])

HSP 1 Score: 266.159 bits (679), Expect = 1.117e-83
Identity = 140/308 (45.45%), Postives = 189/308 (61.36%), Query Frame = 3
Query:  141 SSNE---LDVQIDHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNL 1055
            SSNE   +DV I+ +  + +  E  ++ ++ N     P    + + +C   +++ L + T+L L+APIKV GD+HGQ  DL+RI  L G PS   YLFLGDYVDRG  SL+ I LL  YK+KY  N F+LRGNHES  + ++YGF  E   RL SSK WK F  VF+TLP+AAII + IFC HGG+SPD  LH+     + I+ + RP+++P+ G++ DLLW+DP       +   + W  N RG SY F    +  F  KF+ DLI+R H VV DGYEF+     VTIFSA NYCG F N   V ++
Sbjct:  233 SSNEGLDIDVAIEKLLQVGESREITKTSKKKN----FPFHSWEIQLICYHAREIFLNQPTLLRLQAPIKVVGDVHGQFNDLLRILKLSGVPSDTNYLFLGDYVDRGKNSLETILLLLCYKIKYKDNFFMLRGNHESANVTKMYGFYDECKRRL-SSKVWKMFVDVFNTLPLAAIIQDKIFCVHGGISPD--LHDM----KQIEKVARPTDIPESGLVTDLLWSDP-------DPQVTDWSENDRGVSYTFSKRNVLDFCAKFKFDLILRGHMVVEDGYEFFARKKFVTIFSAPNYCGEFHNWGAVMSV 522          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ2 (Serine/threonine protein phosphatase Z, isoform of Ppz1p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000002844])

HSP 1 Score: 265.388 bits (677), Expect = 1.010e-81
Identity = 131/262 (50.00%), Postives = 166/262 (63.36%), Query Frame = 3
Query:  270 LCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNL 1055
            +C   ++L L +  +L+L   +K+ GD+HGQ  DL+R+F  CG P    YLFLGDYVDRG  SL+ I LL  YK+KYP N FLLRGNHE   + RVYGF  E   R N  K WK+F   F+TLP+AAI+   IFC HGGLSP       +N  + I+ + RP++VP FG++ DLLW+DP D       SS+ W  N RG S+ +    I  FL+KF  DL+ RAH VV DGYEF+ D SLVT+FSA NYCG FDN   V  +
Sbjct:  428 ICHKARELFLAQPALLELSPSVKIVGDVHGQYADLLRLFTKCGFPPMANYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCN-IKIWKTFVDTFNTLPLAAIVTGKIFCVHGGLSP------VLNSMDEIRHVSRPTDVPDFGLINDLLWSDPTD-------SSNEWEDNERGVSFCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMTV 675          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH3 (Catalytic subunit of protein phosphatase PP4 complex; Pph3p and Psy2p form active complex, Psy4p may provide substrate specificity; regulates recovery from the DNA damage checkpoint, the gene conversion- and single-strand annealing-mediated pathways of meiotic double-strand break repair and efficient Non-Homologous End-Joining (NHEJ) pathway; involved in activation of Gln3p to alleviate nitrogen catabolite repression; Pph3p and Psy2p localize to foci on meiotic chromosomes [Source:SGD;Acc:S000002482])

HSP 1 Score: 240.35 bits (612), Expect = 1.562e-76
Identity = 126/302 (41.72%), Postives = 180/302 (59.60%), Query Frame = 3
Query:  270 LCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQ--------LIPNEVSLNGGFHILPPDKSIKNQWL 1151
            LC+  ++L++ E  V  +  P+ +CGDIHGQ++DL+ +F+  G   K +Y+FLGD+VDRG+ SL+   LL  YKL+YP  + L+RGNHE+  I +VYGF  E++ +  +S  W+    VF  L + AII+NSIFC HGGLSPD      +   + I+ I R  EVP  G MCDLLW+DP DVD+        W  + RG  ++FG   ++ FL+K  ++LI RAHQ+V +GY+   DG LVT++SA NYC    N A V  ++   N+           NEV    G  I+P  KS  + +L
Sbjct:   25 LCLNSQELLMNEGNVTQVDTPVTICGDIHGQLHDLLTLFEKSGGVEKTRYIFLGDFVDRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEVVRKYGNSNVWRYCCEVFDYLSLGAIINNSIFCVHGGLSPD------MTTVDEIRTIDRKQEVPHEGAMCDLLWSDPEDVDT--------WSLSPRGAGFLFGKREVDQFLEKNNVELIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIDDDLNREYTIFEAVQAQNEV----GNAIIPTKKSQMDYFL 308          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 306.22 bits (783), Expect = 1.664e-101
Identity = 155/327 (47.40%), Postives = 203/327 (62.08%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
             ++D  I  +   + S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG D++  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +           L+P++ +  P    LN G  + PP
Sbjct:    7 LNVDSIISRLLEVRGSRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYG-GLNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 235.343 bits (599), Expect = 3.274e-74
Identity = 115/265 (43.40%), Postives = 161/265 (60.75%), Query Frame = 3
Query:  264 RALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLE 1058
            + LC   K+++ +E  V ++K P+ VCGD+HGQ +DLM +F + G      YLF+GDYVDRGY S++ ++LL   K+++P  + +LRGNHES  I +VYGF  E + +  ++  WK F  +F  LP+ A++DN IFC HGGLSP       ++  + I+A+ R  EVP  G MCDLLW+DP D          GW  + RG  Y FG D+ E F     L LI RAHQ+V +GY +  D ++VTIFSA NYC    N A +  L+
Sbjct:   30 KTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNASVWKYFTDLFDYLPLTALVDNQIFCLHGGLSPS------IDTLDHIRALDRIQEVPHEGPMCDLLWSDPDD--------RGGWGISPRGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELD 280          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 227.639 bits (579), Expect = 3.506e-71
Identity = 110/271 (40.59%), Postives = 167/271 (61.62%), Query Frame = 3
Query:  246 IEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLE 1058
            I + + + LC   ++++++E  V  + +P+ VCGDIHGQ YDL  +F + G      YLF+GD+VDRG+ S++   LL A K++YP  + L+RGNHES  I +VYGF  E +++  S   W+    +F  L ++AIIDN +FC HGGLSP       ++  + I++I R  EVP  G MCDLLW+DP D+         GW  + RG  Y+FGSDV+  +     +DLI RAHQ+V +GY+++ + +++T++SA NYC    N A +  L+
Sbjct:   20 ITEKEVKQLCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSITVWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPS------ISTLDQIRSIDRKQEVPHDGPMCDLLWSDPEDI--------QGWGVSPRGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELD 276          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 199.519 bits (506), Expect = 1.259e-58
Identity = 108/263 (41.06%), Postives = 153/263 (58.17%), Query Frame = 3
Query:  291 LMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNT-RGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDG------SLVTIFSASNYCGTFDNAAGVFNLE 1058
            ++ +E T+L++ API VCGDIHGQ YDL+++F++ G P+  +YLFLGDYVDRGY S++ +  L+  K  Y   +FLLRGNHE   +   + FK E   +  S   + +    F  LP+AA+++    C HGGLSP+      ++  + +K + R  E P FG MCDLLW+DP++ D  +EK+S  +  NT RGCSY +       FL    L  I+RAH+    GY  Y         SL+TIFSA NY   ++N A V   E
Sbjct:   49 ILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKY-SEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPE------IHTLDDVKKLDRFKEPPAFGPMCDLLWSDPLE-DYGNEKTSEHFSHNTVRGCSYFYSYPATCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKYE 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO40084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8D8])

HSP 1 Score: 154.066 bits (388), Expect = 6.141e-45
Identity = 75/159 (47.17%), Postives = 103/159 (64.78%), Query Frame = 3
Query:  579 IERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNL 1055
            ++R  + K WK F   F+ LPIAAI++ +IFC HGGLSPD      +   + I+ + RP +VP  G++CDLLW+DP       ++  +GW  N RG S+ FG DV+  +L+K+   L+VRAHQVV DGY F+    LVT+FSA NYCG FDNA GV ++
Sbjct:    1 MKRRYNIKLWKIFTDCFNCLPIAAIVEQTIFCMHGGLSPD------LQGLDEIRNLERPMDVPDKGLVCDLLWSDP-------DEDITGWGDNDRGVSWTFGGDVVREYLEKYGFSLVVRAHQVVEDGYRFFEKRKLVTLFSAPNYCGEFDNAGGVMSV 146          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1caa (serine/threonine-protein phosphatase alpha-2 isoform-like [Source:NCBI gene;Acc:101169945])

HSP 1 Score: 309.686 bits (792), Expect = 2.257e-102
Identity = 154/330 (46.67%), Postives = 206/330 (62.42%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPPDKS 1133
             ++D  I+ +   + S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGD+HGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAI+D  IFCCHGGLSPD      +   E I+ + RP++VP  G++CDLLWADP       +K   GW  N RG S+ FG+DV+  FL K  +DLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +           L+P++ +L P    +  G  + PP  S
Sbjct:    7 LNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPD------LQSMEQIRRVMRPTDVPDQGLLCDLLWADP-------DKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKLYPYGGGMGSGRPVTPPRNS 322          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101155811])

HSP 1 Score: 308.531 bits (789), Expect = 6.448e-102
Identity = 156/327 (47.71%), Postives = 203/327 (62.08%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
             ++D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAIID  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       +N G  + PP
Sbjct:    6 LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQYGGVNSGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000013925.2 (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101158483])

HSP 1 Score: 307.76 bits (787), Expect = 1.145e-101
Identity = 159/340 (46.76%), Postives = 206/340 (60.59%), Query Frame = 3
Query:  138 FSSNELDVQIDHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFN-----------LEPSENQLIPNEVSLNGGFHILPP 1124
             +  ELDV        D  I  +   +   PG    + + + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ  DL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FG+DV+  FL++  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA G+ +           L+PSE +       +N G  + PP
Sbjct:    1 MAEGELDV--------DSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDTGLLCDLLWSDP-------DKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNTGRPVTPP 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000019964.2 (protein phosphatase 1 catalytic subunit gamma [Source:NCBI gene;Acc:101161814])

HSP 1 Score: 306.605 bits (784), Expect = 2.965e-101
Identity = 157/328 (47.87%), Postives = 206/328 (62.80%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEP----SENQLIPNEVSL-NGGFHILPPDKSIKNQ 1145
             ++D  I+ +   + + PG    +++ + R LC+  +++ L +  +L+L+AP+K+CGDIHGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LPIAAI+D  IFCCHGGLSPD      +   E I+ I RP++VP  G++CDLLW+DP       +K   GW  N RG S+ FGS+V+  FL K  LDLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++     S   L P E    NG   + PP   +  Q
Sbjct:    7 LNIDSIIQRLLEVRGAKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPD------LQSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------DKDVLGWGENDRGVSFTFGSEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNGSRPVTPPRNMVTKQ 320          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:101171445])

HSP 1 Score: 303.138 bits (775), Expect = 6.018e-100
Identity = 146/296 (49.32%), Postives = 195/296 (65.88%), Query Frame = 3
Query:  177 FHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPS 1064
             ++D  I+ +   + S PG    + + + R LC+  +++ L +  +L+L+AP+K+CGD+HGQ YDL+R+F+  G P +  YLFLGDYVDRG  SL+ I LL AYK+KYP N FLLRGNHE   INR+YGF  E   R N  K WK+F   F+ LP+AAI+D  IFCCHGGLSPD      +   E I+ + RP++VP  G++CDLLWADP       +K   GW  N RG S+ FG+DV+  FL K  +DLI RAHQVV DGYEF+    LVT+FSA NYCG FDNA  + +++ +
Sbjct:    7 LNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN-IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPD------LQSMEQIRRVMRPTDVPDQGLLCDLLWADP-------DKDVLGWGENDRGVSFTFGADVVTKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDET 288          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000075171.1 (SMESG000075171.1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 378/378 (100.00%), Postives = 378/378 (100.00%), Query Frame = 3
Query:   90 MHKVSLNLLTEAHEKTFSSNELDVQIDHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQWLXXXXXXXXXXXXXXXXTQEISNVA 1223
            MHKVSLNLLTEAHEKTFSSNELDVQIDHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQWLKAKKKEVKPKPGKKSKTQEISNVA
Sbjct:    1 MHKVSLNLLTEAHEKTFSSNELDVQIDHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQWLKAKKKEVKPKPGKKSKTQEISNVA 378          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000070492.1 (SMESG000070492.1)

HSP 1 Score: 350.517 bits (898), Expect = 2.285e-118
Identity = 172/336 (51.19%), Postives = 223/336 (66.37%), Query Frame = 3
Query:  144 SNELDVQIDHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQWL 1151
            + E  V ID++  +DK I+N     RSN   +      +C+A+ V+++         + + APIKVCGDIHGQ  DL+R+FDLCG+P   +YLFLGDYVDRG   L+V+ LLF YK+KYP+++F+LRGNHE   I RVYGF++E+ ER NSSK WK+F   F  +P+ AII+ SIFCCHGGLSP F   +   L E    +  PSE+   G++CDL+WADPMD D   E   +GWV+N RGCS+ FG D+I  FL KF LDL++R HQVV DGYEFYCD SLVT+F+A  YCG FDNA G+F L+        +E +L G F IL PD  I +QW 
Sbjct:   11 AEEYLVDIDNL--IDKLIQNRHIADRSNLSAK------ECQAVAVVIRAEFDLNSICVYVNAPIKVCGDIHGQFTDLLRVFDLCGYPPNSRYLFLGDYVDRGRKGLEVLMLLFLYKIKYPSSIFMLRGNHECERITRVYGFRQEIKERFNSSKVWKAFLKTFQLMPMCAIIEKSIFCCHGGLSPIFFSDKYKTLEEVFGTVSLPSEISYEGLLCDLVWADPMDFDGKTE--PTGWVTNKRGCSWNFGCDIIREFLKKFSLDLVIRGHQVVEDGYEFYCDRSLVTLFTAPRYCGEFDNAGGIFVLDREVKA--NSETTLEGSFKILSPDYKIPHQWF 334          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000023512.1 (SMESG000023512.1)

HSP 1 Score: 347.436 bits (890), Expect = 1.416e-116
Identity = 171/346 (49.42%), Postives = 229/346 (66.18%), Query Frame = 3
Query:  132 KTFSSNELDVQIDHVFHLDKFIENIESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDS--SDEKSSS----GWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQWL 1151
            K  + ++L++  D+VF++D FI+  E      PG R  I++ DC+A+CVIVKK+   E T+L++ AP KVCGDIHGQ YDLMRIF  CG PS +                  + +LFAYK+KYP  ++LLRGNHES  IN+VYGF  E++ER NS   +  FN VF  LPIAA+ID +IFCCHGGLSP  L  E  +LRE +K I RP EVP  G++CDLLW+DP+D D     E  ++    GW  N+RGCS+VF   +++ FL+KF L+LIVRAHQVV DGYEF+C+  LVT+FS SNYCGTFDNAA +  +   E ++      L+G F +L P+K++  +W+
Sbjct:    3 KQNAKDQLNLPFDYVFNVDYFIQKFEENHEKIPGQRLHIKETDCKAICVIVKKIFSAEMTLLEISAPTKVCGDIHGQWYDLMRIFQYCGKPSTK-----------------TVCILFAYKIKYPNRIYLLRGNHESNVINKVYGFYGEIMERFNSDILYHLFNRVFDYLPIAALIDGTIFCCHGGLSPTLLHSEVKDLREELKNIKRPLEVPSEGMICDLLWSDPIDNDEDFGTENGTTFLQHGWALNSRGCSFVFSESIVKQFLNKFNLELIVRAHQVVPDGYEFFCERGLVTLFSVSNYCGTFDNAAAILII---EKKMTETSYILHGYFQVLTPEKNMPAKWV 328          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000003447.1 (SMESG000003447.1)

HSP 1 Score: 341.273 bits (874), Expect = 1.228e-114
Identity = 163/315 (51.75%), Postives = 213/315 (67.62%), Query Frame = 3
Query:  204 IESFQRSNPGCRTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQW 1148
            IE   +   G R  +   D  A+  + K + ++E  +L++ APIK+CGDIHGQ  DL+R+F LCG+  K +YLFLGDYVDRG   L+ I LLF  K+KYP +++LLRGNHE   +NR YGF+ E+  R  SSK WK+F   F+ LP+AAI++N+IFCCHGGLSPD L     NL+ TI A+ RP++VP  G++CDLLW+DP D++S  E    GW  N RGCS+ FG D +E FL+KF LDLI+R HQVV DGYEFYCD  L+T+F+A NYCG FDNA G+F L  + N        + G F IL P+  + NQW
Sbjct:   16 IERLYQVPDGKRLDLNYEDYLAIAYVSKSIFIKEPMLLEVNAPIKICGDIHGQYTDLLRMFKLCGYVPKSRYLFLGDYVDRGSYGLECICLLFCLKIKYPNHLYLLRGNHECETLNRTYGFRDEVRNRFGSSKIWKAFLKTFNFLPVAAIVENTIFCCHGGLSPDLLSASVKNLKNTINAVKRPTDVPLEGLLCDLLWSDPTDMESL-ESRPQGWEVNDRGCSWTFGFDAVEQFLNKFDLDLIIRGHQVVEDGYEFYCDRKLITVFTAPNYCGKFDNAGGIFCLSKNLNTPKGLPPIVEGSFVILKPNYELPNQW 329          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000031893.1 (SMESG000031893.1)

HSP 1 Score: 340.117 bits (871), Expect = 6.766e-114
Identity = 166/336 (49.40%), Postives = 233/336 (69.35%), Query Frame = 3
Query:  147 NELDVQIDHVFHLDKFIENIESFQRSNPGC--RTPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFDLCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHESICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGLSPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSSSGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSLVTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIKNQW 1148
            +ELD+++D    + + IE         P C  R  ++  +CRAL ++ ++++ ++D +L L+AP+K+CGDIHGQ  DL+R+F+LCG+P K +YLFLGDYVDRG  SL+VI+LLFAYK+KYP ++FLLRGNHE+  I++VYGF +E++ER NS K WK     F  LPI+AI++ SIFCCHGGLSP  + H   NL    K   RP E+P+ G++CD+LW+DPMD   +   +  GW  N RGCS+ FG D++E+FL+KF LDL+VR HQVV DGYEFY +  L+T+FSA  Y G FDNA G+F L+        +E+ +  GF IL PD ++ +Q+
Sbjct:   25 DELDIELDLDAIIKRLIE-------EGPKCSDRLILDLNECRALALVAREIISKDDLLLKLEAPLKICGDIHGQFLDLLRLFNLCGYPPKSRYLFLGDYVDRGRRSLEVINLLFAYKIKYPESIFLLRGNHETEVISKVYGFYEEIMERFNSPKLWKVIIKTFCWLPISAIVEKSIFCCHGGLSPTLMKHSVTNLYREFKNYKRPFEIPREGLLCDILWSDPMD-SPAKGITPVGWRQNERGCSWQFGHDILESFLNKFNLDLVVRGHQVVEDGYEFYGNRQLLTVFSAPFYGGEFDNAGGIFCLDKDGKG--SSEI-IEAGFLILKPDYNLDSQF 349          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1CB6.083e-10247.58protein phosphatase 1 catalytic subunit beta [Sour... [more]
PPP1CB6.083e-10247.58protein phosphatase 1 catalytic subunit beta [Sour... [more]
PPP1CB6.083e-10247.58protein phosphatase 1 catalytic subunit beta [Sour... [more]
PPP1CA2.169e-10048.15protein phosphatase 1 catalytic subunit alpha [Sou... [more]
PPP1CC3.163e-10047.98protein phosphatase 1 catalytic subunit gamma [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsp-13.177e-9947.56Serine/threonine-protein phosphatase PP1-alpha [S... [more]
gsp-28.506e-9950.00Serine/threonine-protein phosphatase PP1-beta [So... [more]
pph-12.001e-9348.81Serine/threonine-protein phosphatase [Source:UniP... [more]
ZK938.12.380e-8246.42Serine/threonine-protein phosphatase [Source:UniP... [more]
gsp-44.539e-8242.12Serine/threonine-protein phosphatase PP1-delta [S... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flw1.127e-9849.16gene:FBgn0000711 transcript:FBtr0071447[more]
flw1.127e-9849.16gene:FBgn0000711 transcript:FBtr0333305[more]
Pp1-87B1.300e-9847.37gene:FBgn0004103 transcript:FBtr0082595[more]
Pp1-13C2.234e-9848.65gene:FBgn0003132 transcript:FBtr0074017[more]
flw2.325e-9849.16gene:FBgn0000711 transcript:FBtr0474146[more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cb5.073e-10247.71protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cab1.727e-10146.43protein phosphatase 1, catalytic subunit, alpha is... [more]
CABZ01076667.11.121e-10047.98protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1caa1.256e-9948.99protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp1caa1.818e-9849.31protein phosphatase 1, catalytic subunit, alpha is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cb4.116e-10247.58protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cb1.725e-10049.52protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cb2.632e-10049.52protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cc3.060e-10047.87protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cc3.724e-10048.37protein phosphatase 1, catalytic subunit, gamma is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1cb4.176e-10247.58protein phosphatase 1 catalytic subunit beta [Sour... [more]
Ppp1cb4.176e-10247.58protein phosphatase 1 catalytic subunit beta [Sour... [more]
Ppp1cc2.697e-10047.98protein phosphatase 1 catalytic subunit gamma [Sou... [more]
Ppp1ca3.579e-10047.84protein phosphatase 1 catalytic subunit alpha [Sou... [more]
Ppp1ca3.579e-10047.84protein phosphatase 1 catalytic subunit alpha [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5I085|PP1B_XENTR2.180e-10147.58Serine/threonine-protein phosphatase PP1-beta cata... [more]
sp|Q6GQL2|PP1B_XENLA2.180e-10147.58Serine/threonine-protein phosphatase PP1-beta cata... [more]
sp|P62142|PP1B_RAT2.921e-10147.58Serine/threonine-protein phosphatase PP1-beta cata... [more]
sp|P62143|PP1B_RABIT2.921e-10147.58Serine/threonine-protein phosphatase PP1-beta cata... [more]
sp|Q5R740|PP1B_PONAB2.921e-10147.58Serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S5BQW54.639e-12055.25Serine/threonine-protein phosphatase OS=Protopolys... [more]
A0A183AE293.545e-11553.33Serine/threonine-protein phosphatase OS=Echinostom... [more]
A0A5J4NPP95.132e-11452.06Serine/threonine-protein phosphatase OS=Paragonimu... [more]
A0A4S2LG516.240e-11350.78Serine/threonine-protein phosphatase OS=Opisthorch... [more]
A0A074ZXK91.869e-11251.10Serine/threonine-protein phosphatase OS=Opisthorch... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1CB6.488e-10247.71serine/threonine-protein phosphatase PP1-beta cata... [more]
ENSAMXT00000056848.17.075e-10246.76serine/threonine-protein phosphatase PP1-beta cata... [more]
ppp1cab8.609e-10246.59serine/threonine-protein phosphatase alpha-2 isofo... [more]
ppp1cb1.216e-10147.71serine/threonine-protein phosphatase PP1-beta cata... [more]
ppp1cb6.808e-10147.56serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cab1.773e-10148.90protein phosphatase 1, catalytic subunit, alpha is... [more]
ENSPMAT00000010086.17.761e-8950.72pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ppp1cb4.932e-7548.51protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp3cb7.943e-6141.06protein phosphatase 3, catalytic subunit, beta iso... [more]
ppp5c8.168e-5242.15protein phosphatase 5, catalytic subunit [Source:Z... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GLC76.458e-10048.14Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
PPZ15.573e-8550.38Serine/threonine protein phosphatase Z, isoform of... [more]
PPQ11.117e-8345.45Protein phosphatase that regulates the mating resp... [more]
PPZ21.010e-8150.00Serine/threonine protein phosphatase Z, isoform of... [more]
PPH31.562e-7641.72Catalytic subunit of protein phosphatase PP4 compl... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO446481.664e-10147.40Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297593.274e-7443.40Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499363.506e-7140.59Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO362721.259e-5841.06Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO400846.141e-4547.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1caa2.257e-10246.67serine/threonine-protein phosphatase alpha-2 isofo... [more]
PPP1CB6.448e-10247.71serine/threonine-protein phosphatase PP1-beta cata... [more]
ENSORLT00000013925.21.145e-10146.76serine/threonine-protein phosphatase PP1-beta cata... [more]
ENSORLT00000019964.22.965e-10147.87protein phosphatase 1 catalytic subunit gamma [Sou... [more]
ppp1cab6.018e-10049.32serine/threonine-protein phosphatase alpha-2 isofo... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075171.10.000e+0100.00SMESG000075171.1[more]
SMESG000070492.12.285e-11851.19SMESG000070492.1[more]
SMESG000023512.11.416e-11649.42SMESG000023512.1[more]
SMESG000003447.11.228e-11451.75SMESG000003447.1[more]
SMESG000031893.16.766e-11449.40SMESG000031893.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027094 ID=SMED30027094|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1404bp
CTCAATGACAAAATAGAATAATTGATCGATAAAATATTTTATGCTTTATC
GATAATTTTAAACATGTTGAATTCCAGATCTTATTTGCCATGCATAAAGT
GTCATTGAATCTTTTAACAGAAGCTCACGAGAAGACATTTTCTTCCAATG
AATTGGACGTTCAAATCGACCACGTTTTCCATTTGGACAAATTCATAGAA
AATATCGAATCGTTCCAGCGATCGAATCCGGGCTGTCGGACTCCAATAGA
GGATTTAGACTGTCGAGCGCTTTGTGTAATTGTCAAGAAATTGATGTTGC
AAGAAGACACAGTTTTAGATCTGAAAGCTCCTATCAAAGTTTGTGGGGAC
ATCCACGGTCAGATCTATGATTTGATGAGAATTTTCGATTTATGTGGTCA
TCCTTCTAAACAGAAATATCTATTTTTAGGAGATTATGTCGACAGAGGTT
ACACATCCCTCGATGTGATAAGCCTATTATTTGCATATAAATTGAAATAT
CCAGCTAATATGTTTTTATTGAGAGGAAATCACGAGTCTATTTGCATCAA
CCGAGTGTATGGATTTAAGAAAGAACTTATTGAAAGATTGAATTCATCGA
AATCATGGAAATCTTTTAATGTGGTATTTTCTACTTTGCCTATTGCTGCT
ATCATAGACAATTCCATATTTTGCTGTCATGGTGGACTTTCTCCTGATTT
CTTACTTCACGAATGTGTCAATCTACGGGAAACAATAAAGGCTATTCCTA
GACCATCAGAGGTACCTCAATTTGGTATTATGTGTGACTTATTGTGGGCT
GATCCAATGGATGTCGACTCTTCTGATGAGAAATCGTCATCTGGTTGGGT
TTCCAATACAAGAGGCTGTTCCTACGTGTTCGGATCGGATGTTATTGAAG
CGTTTCTTGATAAATTCCGACTAGATCTCATTGTTAGAGCTCATCAGGTA
GTGGCTGATGGTTATGAATTTTATTGTGATGGTAGTTTGGTTACAATATT
TTCTGCTTCTAATTACTGTGGAACATTCGATAACGCAGCCGGAGTTTTCA
ATTTAGAGCCCAGCGAAAACCAATTAATACCAAACGAAGTTTCATTAAAT
GGAGGTTTTCATATCCTACCGCCGGACAAAAGTATCAAGAACCAATGGTT
GAAAGCCAAGAAAAAAGAAGTTAAACCAAAACCTGGCAAAAAATCAAAAA
CACAAGAGATCTCTAACGTGGCATAGATTCCTAAATGAGCACATTATTAT
ATCATTCGTGGTCAATTTACTTTATTTTCTTATTGTCAGATTTAATTGCG
GTCTTTTCAATATTAATTTTACTAATTTTGAAATCTCAAGTTTTATTTTT
TATAACTTATCAGTGTGATTCGTCAAAATAATTTTTTTCAAAACATGTAA
AAAC
back to top

protein sequence of SMED30027094-orf-1

>SMED30027094-orf-1 ID=SMED30027094-orf-1|Name=SMED30027094-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=379bp
MHKVSLNLLTEAHEKTFSSNELDVQIDHVFHLDKFIENIESFQRSNPGCR
TPIEDLDCRALCVIVKKLMLQEDTVLDLKAPIKVCGDIHGQIYDLMRIFD
LCGHPSKQKYLFLGDYVDRGYTSLDVISLLFAYKLKYPANMFLLRGNHES
ICINRVYGFKKELIERLNSSKSWKSFNVVFSTLPIAAIIDNSIFCCHGGL
SPDFLLHECVNLRETIKAIPRPSEVPQFGIMCDLLWADPMDVDSSDEKSS
SGWVSNTRGCSYVFGSDVIEAFLDKFRLDLIVRAHQVVADGYEFYCDGSL
VTIFSASNYCGTFDNAAGVFNLEPSENQLIPNEVSLNGGFHILPPDKSIK
NQWLKAKKKEVKPKPGKKSKTQEISNVA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR006186Ser/Thr-sp_prot-phosphatase
IPR004843Calcineurin-like_PHP_ApaH
IPR029052Metallo-depent_PP-like
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0004721phosphoprotein phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation