Prefoldin subunit 5

Overview
NamePrefoldin subunit 5
Smed IDSMED30027093
Length (bp)592
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Prefoldin subunit 5 (SMED30027093) t-SNE clustered cells

Violin plots show distribution of expression levels for Prefoldin subunit 5 (SMED30027093) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Prefoldin subunit 5 (SMED30027093) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Prefoldin subunit 5 (SMED30027093) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Prefoldin subunit 5 vs. Ensembl Human
Match: PFDN5 (prefoldin subunit 5 [Source:HGNC Symbol;Acc:HGNC:8869])

HSP 1 Score: 131.339 bits (329), Expect = 1.311e-38
Identity = 60/147 (40.82%), Postives = 102/147 (69.39%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            INI +L  P L  L  QL++E++FL+ S+ QLK +Q ++ +AKD L      NE KE+LVP +S++YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:    5 INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQAT 151          
BLAST of Prefoldin subunit 5 vs. Ensembl Human
Match: PFDN5 (prefoldin subunit 5 [Source:HGNC Symbol;Acc:HGNC:8869])

HSP 1 Score: 131.339 bits (329), Expect = 1.311e-38
Identity = 60/147 (40.82%), Postives = 102/147 (69.39%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            INI +L  P L  L  QL++E++FL+ S+ QLK +Q ++ +AKD L      NE KE+LVP +S++YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:    5 INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQAT 151          
BLAST of Prefoldin subunit 5 vs. Ensembl Human
Match: PFDN5 (prefoldin subunit 5 [Source:HGNC Symbol;Acc:HGNC:8869])

HSP 1 Score: 113.235 bits (282), Expect = 1.899e-31
Identity = 55/148 (37.16%), Postives = 97/148 (65.54%), Query Frame = 2
Query:   86 NINDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILV--PFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            NI +L  P L  L  QL++E++FL+ S+ QLK +Q ++ +AKD L      NE+   L    +S+ +YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:    2 NITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEDGISLCRPGWSAMMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQAT 149          
BLAST of Prefoldin subunit 5 vs. Ensembl Human
Match: PFDN5 (prefoldin subunit 5 [Source:HGNC Symbol;Acc:HGNC:8869])

HSP 1 Score: 77.0258 bits (188), Expect = 5.438e-18
Identity = 31/82 (37.80%), Postives = 59/82 (71.95%), Query Frame = 2
Query:  278 LYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            +YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:   25 MYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQAT 106          
BLAST of Prefoldin subunit 5 vs. Ensembl Human
Match: URI1 (URI1 prefoldin like chaperone [Source:HGNC Symbol;Acc:HGNC:13236])

HSP 1 Score: 53.5286 bits (127), Expect = 5.767e-8
Identity = 29/109 (26.61%), Postives = 56/109 (51.38%), Query Frame = 2
Query:   98 LPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVR 424
            L AP + +L E+ E+ +    E +Q  K +   +   ++ L + +P+  +  I+VPF    ++PGK+   + V + +G  +F   S  QA    + R E++ K ID ++
Sbjct:   25 LRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERL-STLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLK 132          
BLAST of Prefoldin subunit 5 vs. Ensembl Celegans
Match: pfd-5 (Probable prefoldin subunit 5 [Source:UniProtKB/Swiss-Prot;Acc:Q21993])

HSP 1 Score: 71.2478 bits (173), Expect = 1.134e-15
Identity = 37/135 (27.41%), Postives = 71/135 (52.59%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKI 487
            + +++L    L +L +  E+E+ F  ES   LK L  + +K+   L            L+P S +LY+  ++       +++GTGYF++L  ++AK+ +DR+ E+I KQ++ V   L EK   +  +++    K+
Sbjct:    8 VPLSELSLQQLGELQKNCEQELNFFQESFNALKGLLTRNEKSISALDDVKIATAGHTALIPLSESLYIRAELSDPSKHLVEIGTGYFVELDREKAKAIFDRKKEHITKQVETVEGILKEKRRTRAYISDAFQTKV 142          
BLAST of Prefoldin subunit 5 vs. Ensembl Fly
Match: Pfdn5 (gene:FBgn0038976 transcript:FBtr0084257)

HSP 1 Score: 102.449 bits (254), Expect = 2.138e-27
Identity = 50/147 (34.01%), Postives = 92/147 (62.59%), Query Frame = 2
Query:   44 IMASNTLQKKQEVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVK 484
            + A+ +   K E+I++  L    L ++ ++ E+EI  + +S+  L   QA++  +K+ L  + P  EN++ILVP +S++YVPG++K ++   ID+GTGY+I+  ++ +K Y+ RR EY+++QI+K+     +KT     V  VL +K
Sbjct:    1 MAATPSAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQILVPLTSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSVMSVLEMK 147          
BLAST of Prefoldin subunit 5 vs. Ensembl Fly
Match: Pfdn5 (gene:FBgn0038976 transcript:FBtr0301486)

HSP 1 Score: 102.449 bits (254), Expect = 2.138e-27
Identity = 50/147 (34.01%), Postives = 92/147 (62.59%), Query Frame = 2
Query:   44 IMASNTLQKKQEVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVK 484
            + A+ +   K E+I++  L    L ++ ++ E+EI  + +S+  L   QA++  +K+ L  + P  EN++ILVP +S++YVPG++K ++   ID+GTGY+I+  ++ +K Y+ RR EY+++QI+K+     +KT     V  VL +K
Sbjct:    1 MAATPSAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQILVPLTSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSVMSVLEMK 147          
BLAST of Prefoldin subunit 5 vs. Ensembl Fly
Match: Uxt (gene:FBgn0259982 transcript:FBtr0310430)

HSP 1 Score: 50.0618 bits (118), Expect = 1.222e-7
Identity = 28/104 (26.92%), Postives = 61/104 (58.65%), Query Frame = 2
Query:  122 LNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAY---VPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVR 424
            +NE L+E+++ L + + Q      ++ + K+TL+ +   +P+    +  V   S +++  +++K+D++ +DVG   F+D+SI  A+ + D R + + KQ D +R
Sbjct:   31 INEVLKEDLRELEKCIGQYNEEIMEYVQLKNTLQTFDTHLPDGYKTQ--VNIGSNVFMQARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLR 132          
BLAST of Prefoldin subunit 5 vs. Ensembl Fly
Match: Uxt (gene:FBgn0259982 transcript:FBtr0080708)

HSP 1 Score: 50.0618 bits (118), Expect = 1.222e-7
Identity = 28/104 (26.92%), Postives = 61/104 (58.65%), Query Frame = 2
Query:  122 LNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAY---VPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVR 424
            +NE L+E+++ L + + Q      ++ + K+TL+ +   +P+    +  V   S +++  +++K+D++ +DVG   F+D+SI  A+ + D R + + KQ D +R
Sbjct:   31 INEVLKEDLRELEKCIGQYNEEIMEYVQLKNTLQTFDTHLPDGYKTQ--VNIGSNVFMQARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLR 132          
BLAST of Prefoldin subunit 5 vs. Ensembl Zebrafish
Match: pfdn5 (prefoldin 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6858])

HSP 1 Score: 139.043 bits (349), Expect = 8.553e-42
Identity = 63/151 (41.72%), Postives = 103/151 (68.21%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESSPIKA 535
            +N+ +L  P L  L  QL++E +FL+ S+ QLK +Q ++ +AKD+L      NE KE+LVP +S++YVPGK+  VD V +DVGTGYF++ +++  K ++ R+ +++ KQI+K++P+L EK  MK+ V EV+ +K+ +L     S+S   KA
Sbjct:    3 VNLTELSLPQLEGLKTQLDQETEFLSSSIAQLKVVQTKYVEAKDSLNVLNKSNEGKELLVPLTSSMYVPGKLHDVDHVLVDVGTGYFVEKNVEDGKEFFKRKIDFLTKQIEKIQPALQEKYAMKQAVVEVMNMKLQQLHSQQASQSGTTKA 153          
BLAST of Prefoldin subunit 5 vs. Ensembl Zebrafish
Match: pfdn5 (prefoldin 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6858])

HSP 1 Score: 103.219 bits (256), Expect = 5.133e-28
Identity = 53/151 (35.10%), Postives = 91/151 (60.26%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESSPIKA 535
            +N+ +L  P L  L  QL++E +FL+ S+ QLK +Q ++ +AKD+L   V         +P +S       +  VD V +DVGTGYF++ +++  K ++ R+ +++ KQI+K++P+L EK  MK+ V EV+ +K+ +L     S+S   KA
Sbjct:    3 VNLTELSLPQLEGLKTQLDQETEFLSSSIAQLKVVQTKYVEAKDSLNWSV---------IPLTS-------LHDVDHVLVDVGTGYFVEKNVEDGKEFFKRKIDFLTKQIEKIQPALQEKYAMKQAVVEVMNMKLQQLHSQQASQSGTTKA 137          
BLAST of Prefoldin subunit 5 vs. Ensembl Zebrafish
Match: pfdn5 (prefoldin 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6858])

HSP 1 Score: 103.219 bits (256), Expect = 5.133e-28
Identity = 53/151 (35.10%), Postives = 91/151 (60.26%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESSPIKA 535
            +N+ +L  P L  L  QL++E +FL+ S+ QLK +Q ++ +AKD+L   V         +P +S       +  VD V +DVGTGYF++ +++  K ++ R+ +++ KQI+K++P+L EK  MK+ V EV+ +K+ +L     S+S   KA
Sbjct:    3 VNLTELSLPQLEGLKTQLDQETEFLSSSIAQLKVVQTKYVEAKDSLNWSV---------IPLTS-------LHDVDHVLVDVGTGYFVEKNVEDGKEFFKRKIDFLTKQIEKIQPALQEKYAMKQAVVEVMNMKLQQLHSQQASQSGTTKA 137          
BLAST of Prefoldin subunit 5 vs. Ensembl Zebrafish
Match: pfdn5 (prefoldin 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6858])

HSP 1 Score: 103.219 bits (256), Expect = 5.656e-28
Identity = 53/151 (35.10%), Postives = 92/151 (60.93%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESSPIKA 535
            +N+ +L  P L  L  QL++E +FL+ S+ QLK +Q ++ +AKD+L   V         +P +S       +  VD V +DVGTGYF++ +++ +K ++ R+ +++ KQI+K++P+L EK  MK+ V EV+ +K+ +L     S+S   KA
Sbjct:    3 VNLTELSLPQLEGLKTQLDQETEFLSSSIAQLKVVQTKYVEAKDSLNWSV---------IPLTS-------LHDVDHVLVDVGTGYFVEKNVEDSKEFFKRKIDFLTKQIEKIQPALQEKYAMKQAVVEVMNMKLQQLHSQQASQSGTTKA 137          
BLAST of Prefoldin subunit 5 vs. Ensembl Xenopus
Match: pfdn5 (prefoldin subunit 5 [Source:NCBI gene;Acc:548939])

HSP 1 Score: 134.806 bits (338), Expect = 5.536e-40
Identity = 58/140 (41.43%), Postives = 99/140 (70.71%), Query Frame = 2
Query:   77 EVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINEL 496
            + +NI DL  P L  L  QL++E++FL+ S+ QLK +Q ++ +AK+ L      NE K++LVP +S++YVPG +  V  + IDVGTGY+++ +++ AK ++ R+ E++ KQI+K++P+L EK  MK+ V E++++KI +L
Sbjct:    3 QTVNITDLSLPQLEGLKSQLDQEVEFLSSSIAQLKVVQTKYVEAKECLSVLNKSNEGKQLLVPLTSSMYVPGTLNDVSNILIDVGTGYYVEKTVEDAKDFFKRKVEFLTKQIEKIQPALQEKHAMKQAVIEMMSIKIQQL 142          
BLAST of Prefoldin subunit 5 vs. Ensembl Mouse
Match: Pfdn5 (prefoldin 5 [Source:MGI Symbol;Acc:MGI:1928753])

HSP 1 Score: 131.339 bits (329), Expect = 8.807e-39
Identity = 60/147 (40.82%), Postives = 102/147 (69.39%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            INI +L  P L  L  QL++E++FL+ S+ QLK +Q ++ +AKD L      NE KE+LVP +S++YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:    5 INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQAT 151          
BLAST of Prefoldin subunit 5 vs. Ensembl Mouse
Match: Pfdn5 (prefoldin 5 [Source:MGI Symbol;Acc:MGI:1928753])

HSP 1 Score: 76.2554 bits (186), Expect = 3.489e-18
Identity = 31/82 (37.80%), Postives = 59/82 (71.95%), Query Frame = 2
Query:  278 LYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            +YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:    1 MYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQAT 82          
BLAST of Prefoldin subunit 5 vs. Ensembl Mouse
Match: Pfdn5 (prefoldin 5 [Source:MGI Symbol;Acc:MGI:1928753])

HSP 1 Score: 76.2554 bits (186), Expect = 3.489e-18
Identity = 31/82 (37.80%), Postives = 59/82 (71.95%), Query Frame = 2
Query:  278 LYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            +YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:    1 MYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQAT 82          
BLAST of Prefoldin subunit 5 vs. Ensembl Mouse
Match: Pfdn5 (prefoldin 5 [Source:MGI Symbol;Acc:MGI:1928753])

HSP 1 Score: 77.0258 bits (188), Expect = 3.938e-18
Identity = 31/82 (37.80%), Postives = 59/82 (71.95%), Query Frame = 2
Query:  278 LYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            +YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:   25 MYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQAT 106          
BLAST of Prefoldin subunit 5 vs. Ensembl Mouse
Match: Pfdn5 (prefoldin 5 [Source:MGI Symbol;Acc:MGI:1928753])

HSP 1 Score: 73.559 bits (179), Expect = 3.504e-17
Identity = 30/72 (41.67%), Postives = 54/72 (75.00%), Query Frame = 2
Query:  278 LYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINE 493
            +YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +
Sbjct:    1 MYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQ 72          
BLAST of Prefoldin subunit 5 vs. UniProt/SwissProt
Match: sp|Q9WU28|PFD5_MOUSE (Prefoldin subunit 5 OS=Mus musculus OX=10090 GN=Pfdn5 PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 6.160e-38
Identity = 60/147 (40.82%), Postives = 102/147 (69.39%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            INI +L  P L  L  QL++E++FL+ S+ QLK +Q ++ +AKD L      NE KE+LVP +S++YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:    5 INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQAT 151          
BLAST of Prefoldin subunit 5 vs. UniProt/SwissProt
Match: sp|Q99471|PFD5_HUMAN (Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2)

HSP 1 Score: 131.339 bits (329), Expect = 6.296e-38
Identity = 60/147 (40.82%), Postives = 102/147 (69.39%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            INI +L  P L  L  QL++E++FL+ S+ QLK +Q ++ +AKD L      NE KE+LVP +S++YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:    5 INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQAT 151          
BLAST of Prefoldin subunit 5 vs. UniProt/SwissProt
Match: sp|Q5RAY0|PFD5_PONAB (Prefoldin subunit 5 OS=Pongo abelii OX=9601 GN=PFDN5 PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 7.329e-38
Identity = 60/147 (40.82%), Postives = 102/147 (69.39%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            INI +L  P L  L  QL++E++FL+ S+ QLK +Q ++ +AKD L      NE KE+LVP +S++YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:    5 INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIRQLTALGAAQAT 151          
BLAST of Prefoldin subunit 5 vs. UniProt/SwissProt
Match: sp|Q8HYI9|PFD5_BOVIN (Prefoldin subunit 5 OS=Bos taurus OX=9913 GN=PFDN5 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.375e-37
Identity = 59/147 (40.14%), Postives = 102/147 (69.39%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            +NI +L  P L  L  QL++E++FL+ S+ QLK +Q ++ +AKD L      NE KE+LVP +S++YVPGK+  V+ V IDVGTGY+++ + + AK ++ R+ +++ KQ++K++P+L EK  MK+ V E+++ KI +L     ++++
Sbjct:    5 VNITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLKKNNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTTLGAAQAT 151          
BLAST of Prefoldin subunit 5 vs. UniProt/SwissProt
Match: sp|Q9VCZ8|PFD5_DROME (Probable prefoldin subunit 5 OS=Drosophila melanogaster OX=7227 GN=Pfdn5 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.144e-26
Identity = 50/147 (34.01%), Postives = 92/147 (62.59%), Query Frame = 2
Query:   44 IMASNTLQKKQEVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVK 484
            + A+ +   K E+I++  L    L ++ ++ E+EI  + +S+  L   QA++  +K+ L  + P  EN++ILVP +S++YVPG++K ++   ID+GTGY+I+  ++ +K Y+ RR EY+++QI+K+     +KT     V  VL +K
Sbjct:    1 MAATPSAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQILVPLTSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSVMSVLEMK 147          
BLAST of Prefoldin subunit 5 vs. TrEMBL
Match: A0A074ZDY5 (Prefoldin, alpha subunit OS=Opisthorchis viverrini OX=6198 GN=T265_07061 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 4.254e-41
Identity = 65/149 (43.62%), Postives = 104/149 (69.80%), Query Frame = 2
Query:   77 EVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            + +NI+DL  P L +L  Q E++I+ +  SVQQLK LQ QF  +K+ LK + PE++N +ILVP +STL VPGK+     V +DVGTGY+ +++I+QA+ +++RR EYI+K I ++ P L EK+++ + V+ VL  K+ E +++  + SS
Sbjct:    4 DTVNISDLSIPQLQELTRQYEQKIQLITASVQQLKALQGQFASSKNCLKEFTPESQNGDILVPLTSTLCVPGKLTDTAHVIVDVGTGYYSEMTIEQAEEHFNRRIEYIDKHIQEIAPVLEEKSQIHRSVSAVLEAKVQEFMRSRAAASS 152          
BLAST of Prefoldin subunit 5 vs. TrEMBL
Match: H2KSI6 (Prefoldin subunit 5 OS=Clonorchis sinensis OX=79923 GN=PFDN5 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 4.691e-41
Identity = 65/149 (43.62%), Postives = 104/149 (69.80%), Query Frame = 2
Query:   77 EVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            + +NI+DL  P L +L  Q E++I+ +  SVQQLK LQ QF  +K+ LK + PE++N +ILVP +STL VPGK+     V +DVGTGY+ +++I+QA+ +++RR EYI+K I ++ P L EK+++ + V+ VL  K+ E +++  + SS
Sbjct:    4 DTVNISDLSIPQLQELTRQYEQKIQLITASVQQLKALQGQFASSKNCLKEFTPESQNGDILVPLTSTLCVPGKLTDTAHVIVDVGTGYYSEMTIEQAEEHFNRRIEYIDKHIQEIAPVLEEKSQIHRSVSAVLEAKVQEFMRSRTAASS 152          
BLAST of Prefoldin subunit 5 vs. TrEMBL
Match: A0A4S2LIB0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008638 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 5.346e-41
Identity = 65/149 (43.62%), Postives = 103/149 (69.13%), Query Frame = 2
Query:   77 EVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            + +NI+DL  P L +L  Q E++I+ +  SVQQLK LQ QF  +K  LK + PE++N +ILVP +STL VPGK+     V +DVGTGY+ +++I+QA+ +++RR EYI+K I ++ P L EK+++ + V+ VL  K+ E +++  + SS
Sbjct:    4 DTVNISDLSIPQLQELTRQYEQKIQLITASVQQLKALQGQFASSKSCLKEFTPESQNGDILVPLTSTLCVPGKLTDTAHVIVDVGTGYYSEMTIEQAEEHFNRRIEYIDKHIQEIAPVLEEKSQIHRSVSAVLEAKVQEFMRSRAAASS 152          
BLAST of Prefoldin subunit 5 vs. TrEMBL
Match: Q86F25 (SJCHGC02568 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.267e-39
Identity = 66/149 (44.30%), Postives = 100/149 (67.11%), Query Frame = 2
Query:   77 EVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESS 523
            E +NI DL  P L +L  Q+E++I+F++ S+QQLK LQ QF  +K+ L    P+ EN +ILVP +STL VPG +     + +D+GTGY++++++ +A+S++DRR EYI KQI K+ P L EKT + K +++ L  KI + IK   S  S
Sbjct:    4 ETVNIMDLTIPQLQELARQMEQKIQFISASIQQLKSLQTQFISSKNYLCELTPDKENSDILVPLTSTLCVPGTLSDASHIFVDIGTGYYVEMTVLEAESHFDRRVEYINKQIRKIFPVLEEKTRVHKSISDTLDAKIQDFIKIPPSPCS 152          
BLAST of Prefoldin subunit 5 vs. TrEMBL
Match: H3B3A9 (Prefoldin subunit 5 OS=Latimeria chalumnae OX=7897 GN=PFDN5 PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.873e-39
Identity = 64/153 (41.83%), Postives = 106/153 (69.28%), Query Frame = 2
Query:   77 EVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESSPIKA 535
            +++NI++L  P L  L  QL++E++FL  S+ QLK +Q ++ +AK+ L     ENE K++LVP +S++YVPGK+  V  V IDVGTGY+++ S+D+A  ++ R+ +++ KQI+K++P+L EK  MK+ V E++ +KI +L     S+S   KA
Sbjct:    3 QMVNISELALPQLEVLKSQLDQEVEFLTSSIAQLKVVQTKYVEAKECLNVLNKENEGKDLLVPLTSSMYVPGKLNDVHHVLIDVGTGYYVEKSVDEATDFFRRKIDFLTKQIEKIQPALQEKHTMKQAVMEMMNMKIQQLTAMGASQSGTTKA 155          
BLAST of Prefoldin subunit 5 vs. Ensembl Cavefish
Match: pfdn5 (prefoldin subunit 5 [Source:NCBI gene;Acc:103047000])

HSP 1 Score: 126.716 bits (317), Expect = 4.980e-37
Identity = 57/134 (42.54%), Postives = 94/134 (70.15%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVK 484
            +N+ +L    L  L  QLE+E +FL+ S+ QLK +Q ++ +AKD+L      NE KE+LVP +S++YVPG +  V+ V +DVGTGYF++ +++ +K ++ R+ +++ KQI+KV+P+L EK  MK+ V EV+ +K
Sbjct:    3 VNLTELSLSQLEGLKTQLEQETEFLSSSIAQLKVVQTKYVEAKDSLNVLKKSNEGKELLVPLTSSMYVPGTLNDVEHVLVDVGTGYFVEKNVEDSKEFFKRKIDFLTKQIEKVQPALQEKHAMKQAVVEVMNMK 136          
BLAST of Prefoldin subunit 5 vs. Ensembl Yeast
Match: GIM5 (Subunit of the heterohexameric cochaperone prefoldin complex; prefoldin binds specifically to cytosolic chaperonin and transfers target proteins to it; prefoldin complex also localizes to chromatin of actively transcribed genes in the nucleus and facilitates transcriptional elongation [Source:SGD;Acc:S000004559])

HSP 1 Score: 71.2478 bits (173), Expect = 2.048e-16
Identity = 35/123 (28.46%), Postives = 74/123 (60.16%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYV-PENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTE 448
            I++  L    LN + +Q ++E++   +S+Q L   + +F +  D +K      NE +++LVP S++LY+PGK+       +D+GTGY+++ S + A ++Y ++ + + K+  +++  + EKT+
Sbjct:    6 IDLTKLNPEQLNAVKQQFDQELQHFTQSLQALTMAKGKFTECIDDIKTVSQAGNEGQKLLVPASASLYIPGKIVDNKKFMVDIGTGYYVEKSAEAAIAFYQKKVDKLNKESVQIQDIIKEKTQ 128          
BLAST of Prefoldin subunit 5 vs. Ensembl Nematostella
Match: EDO44750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT5])

HSP 1 Score: 121.709 bits (304), Expect = 1.607e-35
Identity = 60/157 (38.22%), Postives = 103/157 (65.61%), Query Frame = 2
Query:   62 LQKKQEVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELI---KNAKSESS 523
            +  +Q+ I I+ L  P+L  L  Q+EEE+K L++S+ QLK  Q +F  +K+ ++    +   K+ILVP S+++YVPG ++ VDTV +D+GTGYF + +++ A  Y+  + +Y+ KQI+K++P L EK +M++ V E+  VK+   +   +NA S S+
Sbjct:    1 MATEQQTIEISQLSLPHLEALRNQVEEEVKVLSDSMTQLKVAQQKFVDSKENVEKLTSKGPGKQILVPLSASMYVPGTLENVDTVLVDIGTGYFAEKNLNDAAYYFQGKIDYVTKQIEKLQPILIEKHKMRQAVVEIFNVKVQAQLQQGRNAVSAST 157          
BLAST of Prefoldin subunit 5 vs. Ensembl Nematostella
Match: EDO33919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQU2])

HSP 1 Score: 52.7582 bits (125), Expect = 7.455e-9
Identity = 31/115 (26.96%), Postives = 57/115 (49.57%), Query Frame = 2
Query:   89 INDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSL 433
            INDL    + +L E     I      ++  +  ++ ++   +TLK  +PE  N +I+VPF S  ++PGK+   + + + +G  +F + S  QA+    RR   IE  I  ++  +
Sbjct:   14 INDLAE--ITRLQEHQRTAIIDCQTRLRTWEKFKSDYETLDNTLKT-LPEKLNHDIMVPFGSLAFMPGKLIHTNEILVLLGDNWFAERSATQAREIVQRRQNDIETNIKGIKADI 125          
BLAST of Prefoldin subunit 5 vs. Ensembl Medaka
Match: pfdn5 (prefoldin subunit 5 [Source:NCBI gene;Acc:101158757])

HSP 1 Score: 124.405 bits (311), Expect = 3.744e-36
Identity = 54/134 (40.30%), Postives = 93/134 (69.40%), Query Frame = 2
Query:   83 ININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVK 484
            +N+ DL  P L  L  QL++E++FL  S+ Q K +Q ++ +AKD+L      N+ KE+LVP +S++YVPG +  V+ V +DVGTGY+++ ++  +K ++ R+ +++ KQI+K++P+L EK  MK+ V EV+ +K
Sbjct:    3 VNLTDLSLPQLEGLKGQLDQEVEFLTSSIGQFKVVQTKYVEAKDSLNVLTENNKGKELLVPLTSSMYVPGTLNDVEHVLVDVGTGYYVEKNVKDSKEFFKRKIDFLTKQIEKIQPTLQEKHGMKQAVIEVMNMK 136          
BLAST of Prefoldin subunit 5 vs. Ensembl Medaka
Match: uri1 (URI1 prefoldin like chaperone [Source:NCBI gene;Acc:111947552])

HSP 1 Score: 54.6842 bits (130), Expect = 1.139e-8
Identity = 27/105 (25.71%), Postives = 56/105 (53.33%), Query Frame = 2
Query:  101 PAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQID 415
            P   +++L E+ E+ +K     +Q    +   +    D LK  +P+  + +I+VPF    + PGK+ + + V + +G  +F   S  QA++  D R ++++K++D
Sbjct:   12 PLGGVHRLREEHEKVVKDCDSRIQHWMKVSGDYDALSDRLKT-LPDRLSYDIMVPFGPLAFTPGKLVRTNEVTVLLGDNWFAKCSAKQAQAVVDHRMKHVKKELD 115          
BLAST of Prefoldin subunit 5 vs. Planmine SMEST
Match: SMESG000081207.1 (SMESG000081207.1)

HSP 1 Score: 323.939 bits (829), Expect = 8.552e-115
Identity = 163/163 (100.00%), Postives = 163/163 (100.00%), Query Frame = 2
Query:   47 MASNTLQKKQEVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESSPIKA 535
            MASNTLQKKQEVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESSPIKA
Sbjct:    1 MASNTLQKKQEVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQFQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFIDLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINELIKNAKSESSPIKA 163          
The following BLAST results are available for this feature:
BLAST of Prefoldin subunit 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PFDN51.311e-3840.82prefoldin subunit 5 [Source:HGNC Symbol;Acc:HGNC:8... [more]
PFDN51.311e-3840.82prefoldin subunit 5 [Source:HGNC Symbol;Acc:HGNC:8... [more]
PFDN51.899e-3137.16prefoldin subunit 5 [Source:HGNC Symbol;Acc:HGNC:8... [more]
PFDN55.438e-1837.80prefoldin subunit 5 [Source:HGNC Symbol;Acc:HGNC:8... [more]
URI15.767e-826.61URI1 prefoldin like chaperone [Source:HGNC Symbol;... [more]
back to top
BLAST of Prefoldin subunit 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pfd-51.134e-1527.41Probable prefoldin subunit 5 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Prefoldin subunit 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Pfdn52.138e-2734.01gene:FBgn0038976 transcript:FBtr0084257[more]
Pfdn52.138e-2734.01gene:FBgn0038976 transcript:FBtr0301486[more]
Uxt1.222e-726.92gene:FBgn0259982 transcript:FBtr0310430[more]
Uxt1.222e-726.92gene:FBgn0259982 transcript:FBtr0080708[more]
back to top
BLAST of Prefoldin subunit 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pfdn58.553e-4241.72prefoldin 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6858][more]
pfdn55.133e-2835.10prefoldin 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6858][more]
pfdn55.133e-2835.10prefoldin 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6858][more]
pfdn55.656e-2835.10prefoldin 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6858][more]
back to top
BLAST of Prefoldin subunit 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pfdn55.536e-4041.43prefoldin subunit 5 [Source:NCBI gene;Acc:548939][more]
back to top
BLAST of Prefoldin subunit 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pfdn58.807e-3940.82prefoldin 5 [Source:MGI Symbol;Acc:MGI:1928753][more]
Pfdn53.489e-1837.80prefoldin 5 [Source:MGI Symbol;Acc:MGI:1928753][more]
Pfdn53.489e-1837.80prefoldin 5 [Source:MGI Symbol;Acc:MGI:1928753][more]
Pfdn53.938e-1837.80prefoldin 5 [Source:MGI Symbol;Acc:MGI:1928753][more]
Pfdn53.504e-1741.67prefoldin 5 [Source:MGI Symbol;Acc:MGI:1928753][more]
back to top
BLAST of Prefoldin subunit 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WU28|PFD5_MOUSE6.160e-3840.82Prefoldin subunit 5 OS=Mus musculus OX=10090 GN=Pf... [more]
sp|Q99471|PFD5_HUMAN6.296e-3840.82Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFD... [more]
sp|Q5RAY0|PFD5_PONAB7.329e-3840.82Prefoldin subunit 5 OS=Pongo abelii OX=9601 GN=PFD... [more]
sp|Q8HYI9|PFD5_BOVIN1.375e-3740.14Prefoldin subunit 5 OS=Bos taurus OX=9913 GN=PFDN5... [more]
sp|Q9VCZ8|PFD5_DROME2.144e-2634.01Probable prefoldin subunit 5 OS=Drosophila melanog... [more]
back to top
BLAST of Prefoldin subunit 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZDY54.254e-4143.62Prefoldin, alpha subunit OS=Opisthorchis viverrini... [more]
H2KSI64.691e-4143.62Prefoldin subunit 5 OS=Clonorchis sinensis OX=7992... [more]
A0A4S2LIB05.346e-4143.62Uncharacterized protein OS=Opisthorchis felineus O... [more]
Q86F251.267e-3944.30SJCHGC02568 protein OS=Schistosoma japonicum OX=61... [more]
H3B3A92.873e-3941.83Prefoldin subunit 5 OS=Latimeria chalumnae OX=7897... [more]
back to top
BLAST of Prefoldin subunit 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pfdn54.980e-3742.54prefoldin subunit 5 [Source:NCBI gene;Acc:10304700... [more]
back to top
BLAST of Prefoldin subunit 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prefoldin subunit 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GIM52.048e-1628.46Subunit of the heterohexameric cochaperone prefold... [more]
back to top
BLAST of Prefoldin subunit 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO447501.607e-3538.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339197.455e-926.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Prefoldin subunit 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pfdn53.744e-3640.30prefoldin subunit 5 [Source:NCBI gene;Acc:10115875... [more]
uri11.139e-825.71URI1 prefoldin like chaperone [Source:NCBI gene;Ac... [more]
back to top
BLAST of Prefoldin subunit 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000081207.18.552e-115100.00SMESG000081207.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027093 ID=SMED30027093|Name=Prefoldin subunit 5|organism=Schmidtea mediterranea sexual|type=transcript|length=592bp
TGTTTATATATAATTATTTCAAAATCTTTTATAAATCAGTAATATTATGG
CCTCTAATACATTGCAAAAAAAGCAAGAAGTTATTAATATAAATGATCTA
CCTGCTCCTTATTTAAATAAATTGAATGAACAACTTGAAGAAGAAATCAA
ATTTTTAGCTGAATCTGTTCAGCAATTGAAATATTTACAAGCTCAATTTC
AAAAAGCTAAAGATACACTTAAAGCGTATGTTCCTGAAAATGAAAATAAA
GAAATACTTGTGCCATTTTCATCGACTTTATATGTCCCTGGGAAAATGAA
GAAAGTTGATACAGTTCGTATTGATGTTGGCACGGGTTACTTTATTGATT
TGAGTATTGATCAAGCTAAGTCGTACTATGATAGGCGAAGTGAGTATATT
GAAAAACAGATTGATAAAGTCCGACCAAGTTTAAATGAAAAAACTGAAAT
GAAGAAGAAAGTTGCAGAAGTCTTAACTGTCAAAATTAATGAATTAATTA
AAAACGCTAAATCTGAAAGTTCACCAATTAAAGCTTAAAATCTTTATTGT
AAATAAAAAGTGTTTATTCAAATCGTTAAACATGAATAAATT
back to top

protein sequence of SMED30027093-orf-1

>SMED30027093-orf-1 ID=SMED30027093-orf-1|Name=SMED30027093-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MASNTLQKKQEVININDLPAPYLNKLNEQLEEEIKFLAESVQQLKYLQAQ
FQKAKDTLKAYVPENENKEILVPFSSTLYVPGKMKKVDTVRIDVGTGYFI
DLSIDQAKSYYDRRSEYIEKQIDKVRPSLNEKTEMKKKVAEVLTVKINEL
IKNAKSESSPIKA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR011599PFD_alpha_archaea
IPR004127Prefoldin_subunit_alpha
IPR009053Prefoldin
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
Vocabulary: cellular component
TermDefinition
GO:0016272prefoldin complex
Vocabulary: molecular function
TermDefinition
GO:0051082unfolded protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 27..47
NoneNo IPR availablePANTHERPTHR12674PREFOLDIN SUBUNIT 5coord: 11..157
NoneNo IPR availablePANTHERPTHR12674:SF2PREFOLDIN SUBUNIT 5coord: 11..157
NoneNo IPR availableCDDcd00584Prefoldin_alphacoord: 22..148
e-value: 5.17202E-24
score: 88.8259
NoneNo IPR availableSUPERFAMILYSSF46579Prefoldincoord: 24..143
IPR011599Prefoldin alpha subunit, archaea-typeTIGRFAMTIGR00293TIGR00293coord: 23..144
e-value: 5.4E-28
score: 95.7
IPR009053PrefoldinGENE3DG3DSA:1.10.287.370coord: 20..158
e-value: 5.4E-33
score: 115.7
IPR004127Prefoldin alpha-likePFAMPF02996Prefoldincoord: 30..143
e-value: 1.7E-23
score: 82.8