FAD-binding PCMH-type domain-containing protein

Overview
NameFAD-binding PCMH-type domain-containing protein
Smed IDSMED30027076
Uniprot Best hitD-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALO1 PE=3 SV=1 (E=3.12814e-11)
Length (bp)1792
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FAD-binding PCMH-type domain-containing protein (SMED30027076) t-SNE clustered cells

Violin plots show distribution of expression levels for FAD-binding PCMH-type domain-containing protein (SMED30027076) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FAD-binding PCMH-type domain-containing protein (SMED30027076) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FAD-binding PCMH-type domain-containing protein (SMED30027076) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027076

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027076SMESG000066568.1 SmedASXL_002507SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027076SMESG000066568.1 dd_Smed_v4_10292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30027076SMESG000066568.1 dd_Smed_v4_10292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027076SMESG000066568.1 dd_Smed_v6_10292_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30027076SMESG000066568.1 Contig39696newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30027076SMESG000066568.1 Contig39696uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30027076SMESG000066568.1 dd_Smed_v4_10292_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30027076SMESG000066568.1 dd_Smed_v4_10292_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30027076SMESG000066568.1 dd_Smed_v4_10292_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FAD-binding PCMH-type domain-containing protein vs. UniProt
Match: sp|O93852|ALO_CANAL (D-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALO1 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.128e-11
Identity = 55/212 (25.94%), Postives = 99/212 (46.70%), Query Frame = 2
Query:  233 IQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLD---------LRFLSDSERIERVQIRMKDLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLDRTVVGVIVSGSHGAITSAHSSLADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFSNFKDL 841
             QP ++ EI  +I+ AR     I  +G+G S + + +  ++   LD           +   S   +  +I+  DL+      V AG  I EL EY  +N L         D+++ G+I +G+HG+ T  H  ++  V+ V+ ++  GE+ T + +      D   Y ++++  LG +GI+  V L+     T+K   E    E L +N+ +L
Sbjct:   33 FQPRNVEEIQELIKQARLHGKTIMTVGSGHSPSDLTMTTEWLCNLDKFNHVLLEEPYYAPKSPTDDTPEIKFVDLT------VEAGTRIFELNEYLKRNNLAIQNLGSISDQSIAGLISTGTHGS-TQYHGLVSQQVVSVKFLNSAGELITCSSV------DKPEYFRAILLSLGKIGIITHVTLRTCPKYTIKSKQEIINFETLLNNWDNL 231          
BLAST of FAD-binding PCMH-type domain-containing protein vs. UniProt
Match: sp|Q6BZA0|ALO_DEBHA (D-arabinono-1,4-lactone oxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALO1 PE=3 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 2.190e-9
Identity = 52/208 (25.00%), Postives = 94/208 (45.19%), Query Frame = 2
Query:  233 IQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDL--------RFLSDSERIERVQIRMKDLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLDRTVVGVIVSGSHGAITSAHSSLADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFSNF 832
             QP ++ EI  ++  AR     I  +G+G S + + +  ++   LD          F   +   E  +++  DL+      V AG  I+EL  Y  +N+L         D+++ GVI +G+HG+ T  H  ++  V+ + IM+  G++ T + M   +        K+ +  LG +GI+  V L+     T+K   E    + L  N+
Sbjct:   34 FQPRTVDEIRELVDQARINGKTIMTVGSGHSPSDMTMTKEWLCNLDRFNQVLKKEEFSGPTRNGEGEEVKFVDLT------VQAGCRIYELNRYLKENELAIQNLGSISDQSMAGVISTGTHGS-TQYHGLVSQQVVSIEIMNSAGKLITCSSMENTQL------FKAAMLSLGKIGIITHVTLRTIPKYTIKSKQEIIKFDTLLKNW 228          
BLAST of FAD-binding PCMH-type domain-containing protein vs. UniProt
Match: sp|Q7SGY1|ALO_NEUCR (Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alo-1 PE=3 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.059e-7
Identity = 53/217 (24.42%), Postives = 104/217 (47.93%), Query Frame = 2
Query:  122 IIELATELQKRIGILPLVKVDAYALPNESGIIYRI--MRIQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQIRMKDLSYVEGLRVL-AGVTIHELCEYQVQNQLCFPTNSEPLDRTVVGVIVSGSHGAITSAHSSLADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILK 763
            IIELA++   R G +P     A+     +G    +  + IQP S+SEI +V+R AR  +  +   G G S + +   + + V LD  F            ++  + ++ GL V+ AG+ +++L +   +  L  P+     ++++ G I +G+HG+    H  + + + +++I   +GE  + +        D  +  ++ +  LG LGI+ +V  K
Sbjct:   19 IIELASQ---RDGGIPFRAKTAHVHRTWAGTFTSLPELYIQPESVSEIQKVVRLARHARRRVTTTGCGHSPSDITCTSSWLVNLD-NF-----------NKVISVDHLTGLVVVQAGIRLYQLSDELDRRGLALPSLGSINEQSIAGAISTGTHGSGIK-HGLVGESITELKITLANGETLSCSP------EDKPDLFRAALISLGALGIITEVTFK 213          
BLAST of FAD-binding PCMH-type domain-containing protein vs. UniProt
Match: sp|P54783|ALO_YEAST (D-arabinono-1,4-lactone oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALO1 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.333e-7
Identity = 49/222 (22.07%), Postives = 106/222 (47.75%), Query Frame = 2
Query:  188 YALPNESGIIYRIMR--IQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQ--IRMKDLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLDRTVVGVIVSGSHGAITSAHSSLADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFSNFKDL 841
            Y   N +GI         QPSS+ E+  ++++AR  +  +  +G+G S + + + +++ V LD        R+++VQ  +   +L Y + + V AG+ +++L E+               +++V G+I +GSHG+ +  H  ++   + + I++  GE++      +++  +     K+ +  +G +GI+    ++      +K   E  T ENL   +  L
Sbjct:   10 YVFKNWAGIYSAKPERYFQPSSIDEVVELVKSARLAEKSLVTVGSGHSPSNMCVTDEWLVNLD--------RLDKVQKFVEYPELHYAD-VTVDAGMRLYQLNEFLGAKGYSIQNLGSISEQSVAGIISTGSHGS-SPYHGLISSQYVNLTIVNGKGELK------FLDAENDPEVFKAALLSVGKIGIIVSATIRVVPGFNIKSTQEVITFENLLKQWDTL 215          
BLAST of FAD-binding PCMH-type domain-containing protein vs. UniProt
Match: sp|Q752Y3|ALO_ASHGO (D-arabinono-1,4-lactone oxidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ALO1 PE=3 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 5.265e-6
Identity = 51/220 (23.18%), Postives = 96/220 (43.64%), Query Frame = 2
Query:  188 YALPNESGIIYRIMRI--QPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQIRMKDLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLDRTVVGVIVSGSHGAITSAHSSLADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFSNFKDL 841
            Y   N +GI     R+  QP S  E+  ++RAAR     I  +G+G S + +   +D+ V LD R     E  E  Q R  D++      V AG+ ++EL  Y               +++V G+I +G+HG+ +  H  ++   + + +++  GE      + +++        ++ +  LG LGI+    ++      +    E    E L  N++ +
Sbjct:   16 YVFKNWAGIYSARPRLYFQPRSEDEVVAIVRAAREQGRTIVTVGSGHSPSDMCATDDWMVNLD-RLNGVLELQEDEQGRYADVT------VAAGIRVYELHRYLSARGYALQNLGSISEQSVGGIISTGTHGS-SPYHGLVSSQYVNLTLVNGRGE------LVFLDSEHEPEVFRAAMLSLGKLGIIVRATIRVVPAFNIHSTQEVINFETLLDNWETI 221          
BLAST of FAD-binding PCMH-type domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|21504930 (tr|A0A075AIR6|A0A075AIR6_9TREM FAD-binding PCMH-type domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_01724 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 3.973e-83
Identity = 189/567 (33.33%), Postives = 305/567 (53.79%), Query Frame = 2
Query:  110 DPTLIIELATELQKRIGILPLVKVDAYALPNESGIIYRIMRIQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQIRMK-DLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLD--RTVVGVIVSGSHGAITSAHSS----LADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFS-NFKDLHEKINTNLSTQLVYVPFNSIEYDCKTAEIKLDEWKSEKDEIMIRTMTE------------TDVDSDMRQFITVIDEEKGC-LDTVLKESHLTPLILKESHRIMHRNFIQPHN---QYLPWAIHCFPTISTGFHDVTITL-TLGDLTEFGKAFRLILDKIEHFARS-----KNFSVNGGVRVNFTKGT------NITLCPGQKGPDSDKSVHIKVLGVISSPG----WRDISFQIMDEILRHNPSATLQWSSEWIDRPIVIERVLELEGQYLDKLKEEIEKMDRDGVFLNDHLQRIFYPFLQSYRSTYKHLQTEYL 1690
            DP ++I+L  ELQKR+G+LP+V+V A+ L ++ G I R++R+QP S SEI+RV+RAARTMKL +R  G  +  +  I     +V++D   L+DS R+E V +R K D   + GLRVLA V I+EL ++Q+ N++    + E      TVVG + S + G +    ++    L+D V+ +RI+D HG++  Y+         S   + + +S LG+LGIVYD+ L+Y  L   +V+Y F    NL   +   L + I   L T+L+Y+P+NS + + +   ++L EW +E+DE+++RT               + VDS  RQ + +ID+  G      + +   TP +L  +H  +   F QP     QY PWAI+    I+     +  T+ T  DL EF +A +++ + +E  AR      KN+S+N G+RV+FT  T       +    G+   +++   H   +G I+SPG    W   +    + +LR  P    QW SEW     +++R  +   + ++ LK+ +E  DRDGVFLN+ +  I YP    Y+  Y+  + + L
Sbjct:    8 DPNVVIKLGRELQKRVGLLPVVEVHAFHLDSQPGQIVRMLRVQPQSYSEIARVVRAARTMKLTVRACGERTGGDIGIYGTPSTVLVDCGLLADSPRLEFVNVRRKGDDEEIPGLRVLACVGINELVQFQINNRIEIAQSVETASIWGTVVGAVTSSAPGIVGPCSNAQGGCLSDEVIGIRIVDCHGDLIQYS---------SKEELSAALSTLGVLGIVYDITLRYTPLSLTRVDYRFLKWSNLLDMDNSILRKSIEEKLFTELIYLPYNSCDLEEQDI-VELPEWSAEQDEVILRTGKHLGEAVNPGADDPSVVDSCPRQLVYLIDQVFGPEPKEFITQISKTPWLLGRAHHHLRCRF-QPEPSQIQYTPWAINALGKIAEPIRTLRFTMETDKDLKEFAEAMKVVFELLEDLARGGRRYHKNYSINLGLRVHFTGRTKTGRLLGVGFDSGEDQYNTNILAHFTFVG-ITSPGPSTLWTRAANHTTNVLLRSIPRCMPQWRSEWYGITELVKRFQDALCKQIEPLKKLVELADRDGVFLNELMASILYPEPTFYQKLYQSQRNDAL 562          
BLAST of FAD-binding PCMH-type domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16172347 (tr|A0A4S2MC92|A0A4S2MC92_OPIFE FAD-binding PCMH-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001070 PE=4 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 1.613e-79
Identity = 188/567 (33.16%), Postives = 295/567 (52.03%), Query Frame = 2
Query:  110 DPTLIIELATELQKRIGILPLVKVDAYALPNESGIIYRIMRIQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQIRMK-DLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLD--RTVVGVIVSGSHGAITSAHSS----LADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFS-NFKDLHEKINTNLSTQLVYVPFNSIEYDCKTAEIKLDEWKSEKDEIMIRTMTETD------------VDSDMRQFITVIDEEKGCLDTVLK-ESHLTPLILKESHRIMHRNFIQPHN---QYLPWAIHCFPTISTGFHDVTITL-TLGDLTEFGKAFRLILDKIEHFARS-----KNFSVNGGVRVNFTKGT------NITLCPGQKGPDSDKSVHIKVLGVISSPG----WRDISFQIMDEILRHNPSATLQWSSEWIDRPIVIERVLELEGQYLDKLKEEIEKMDRDGVFLNDHLQRIFYPFLQSYRSTYKHLQTEYL 1690
            DP ++I+L  ELQKRIG+LP+V V A+ L ++ G I R++R+QP S SEI+RV+RAARTMKL +R  G  +  +  I     +V++D   L+DS R+E V +R K D   + GLRVLA V I+EL ++Q+ N++    + E      TVVG + S + G +    ++    L+D V+ +RI+D HG++  Y+         S   + + +S LG+LGIVYD+ L+Y  L   +V+Y F     L   +   L E I   L T+L+Y+P+NS + + +   ++L EW +EKDE+++RT                 VDS  RQ + +ID+  G        +   TP +L  +H  +   F QP     QY PWAI+    I+     +  T+ T  +L EF +A +++   +E  A       KN+++N G+RV+FT  T       +    G+   ++    H   +G I+ PG    W   +    + +LR  P    QW SEW     +++R  E   + ++ LK+  E  DRDGVFLN+ +  I YP    Y+  Y   + + L
Sbjct:    8 DPNVVIKLGRELQKRIGLLPVVDVHAFHLDSQPGQIVRMLRVQPQSYSEIARVVRAARTMKLTVRACGERTGGDVGIYGTPSTVLVDCGLLADSPRLEFVNVRRKGDNEEIPGLRVLACVGINELVQFQISNRIEIAQSVETASVWGTVVGAVTSSAPGIVGPCSNAQGGCLSDEVISIRIVDCHGDLIQYS---------SKEELSAALSTLGLLGIVYDITLRYSPLSLTRVDYRFLKWSELLELDNSILRESIEEKLFTELIYLPYNSCDLEEQDI-VELPEWSAEKDEVILRTGKHLGEAVNPGVDDPSVVDSCPRQLVYLIDQVFGPEPKEFSTQISKTPWLLGRAHHHLRCRF-QPEPSQIQYTPWAINALGKIAEPIRTLRFTMETDKNLKEFAEAMKVVFQLLEDLAHGGKRYRKNYAMNLGLRVHFTGRTKTGRLLGVGFDSGEDQFNTTILAHFTFVG-ITPPGPSTLWTRAANHTTNVLLRSIPRCMPQWRSEWYGITELVKRFQEALCKQIEPLKKLAELADRDGVFLNELMASIIYPEPTFYQKLYHSQRNDAL 562          
BLAST of FAD-binding PCMH-type domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16259106 (tr|A0A183ABH3|A0A183ABH3_9TREM FAD-binding PCMH-type domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS4308 PE=4 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 9.325e-76
Identity = 185/566 (32.69%), Postives = 292/566 (51.59%), Query Frame = 2
Query:  110 DPTLIIELATELQKRIGILPLVKVDAYALPNESGIIYRIMRIQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQI-RMKDLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLD--RTVVGVIVSGSHGAITSAHSS----LADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLF-SNFKDLHEKINTNLSTQLVYVPFNSIEYDCKTAEIKLDEWKSEKDEIMIRT-----------MTETDVDSDMRQFITVIDEEKGC-LDTVLKESHLTPLILKESHRIMHRNFIQPH---NQYLPWAIHCFPTISTGFHDVTITLTLG-DLTEFGKAFRLILDKIEHFA-----RSKNFSVNGGVRVNFTKGTNITLCPGQK-GPDSDKSV--HIKVLGVISSPG----WRDISFQIMDEILRHNPSATLQWSSEWIDRPIVIERVLELEGQYLDKLKEEIEKMDRDGVFLNDHLQRIFYPFLQSYRSTYKHLQTEYLSTL 1699
            DP L I+L  ELQKRIG LP V+V A+ L  + G I R++R+QP S SEI+R IRAARTMKL +R  G  +  +  I     +V++D   L+DS R+E V I R  +     GLRVL+GV+I+EL  +Q+ +++    + E      TVVG I + + G +  A  +    L+D V+ +RI+D HG++ TY+         S   + S +S LG+LG+VYDV L+Y  +    VNY+F     L   N + L + +  ++ T+L+Y+PFNS     +     L+ W    DE+++RT              +  DS  R+ + ++D   G      ++    TP +L  +H  +   F QP+    Q+ PWA++    I+     +  T      L EF      IL+ I+  A     +  NF+VN G+R++FT GT      G    P+++ S+  HI   G I++PG    W   + ++   IL+  P    QW +EW    ++ +R  E+  + +D LK+ +   DRDGVFLN+ ++ I Y     Y++ Y+  + + LS L
Sbjct:   24 DPNLTIKLGKELQKRIGTLPRVEVHAFHLEFQPGEIVRMLRVQPQSYSEIARAIRAARTMKLTVRACGQRTGGDTSIYGTTPTVLVDCTQLADSPRMEFVNIHRKGEQEETPGLRVLSGVSINELVTFQLIHKIEIAQSVETTSVWGTVVGAITATTPGLVGPAGGATGGCLSDEVICIRIVDCHGDLITYS---------SPTELSSALSTLGLLGVVYDVTLRYKPITLTNVNYKFIRWSELCDPNSQLLRDSLANDMFTELIYLPFNSCNVSAEKELTDLNNWDPMNDEVVVRTGQRVIPPDEDPSNPSVSDSKPREQVHLLDPVFGPEPKAFVRTPEKTPWLLASAHHYLRCRF-QPNPNSTQFTPWAVNALGKITEPLRQLRFTTECDQQLNEFPNVVSQILELIKELALGGSHKLPNFAVNLGMRIHFTGGTQTGRLLGVGFEPEAESSILAHITFNG-ITNPGPNTMWTQAATRMTAMILKQLPRCVPQWKTEWHGLELITQRYHEVLSKQVDPLKQLVAIADRDGVFLNELVKSILYTESTFYQNLYRKQRIDALSRL 578          
BLAST of FAD-binding PCMH-type domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20354161 (tr|A0A419Q0E0|A0A419Q0E0_CLOSI LIM domain-binding protein 1 OS=Clonorchis sinensis OX=79923 GN=LDB1 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 5.365e-75
Identity = 186/569 (32.69%), Postives = 298/569 (52.37%), Query Frame = 2
Query:  113 PTLIIELATELQKRIGILPLVKVDAYALPNESGIIYRIMRIQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQIRMK-DLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLD--RTVVGVIVSGSHGAITSAHSS----LADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFS-NFKDLHEKINTNLSTQLVYVPFNSIEYDCKTAEIKLDEWKSEKDEIMIRTMTETD------------VDSDMRQFITVIDEEKGC-LDTVLKESHLTPLILKESHRIMHRNFIQPHN---QYLPWAIHCFPTISTGFHDVTITL-TLGDLTEFGKAFRLILDKIEHFARS-----KNFSVNGGVRVNFTKGT------NITLCPGQKGPDSDKSVHIKVLGVISSPG----WRDISFQIMDEILRHNPSATLQWSSEWIDRPIVIERVLELEGQYLDKLKEEIEKMDRDGVFLNDHLQRIFYPFLQSYRSTYKHLQTEYLSTL 1699
            P ++I+L  ELQKRIG+LP+V V A+ L ++ G I R++R+QP S SEI+RV+RAARTMKL +R  G  +  +  I     +V++D   L+DS R+E V ++ K D   + GLRVLA V I+EL ++Q+ N++    + E      TVVG + S + G +    ++    L+D V+ VRI+D HG++  Y+             + + +S LG+LGIVYD+ L+Y  L   +V+Y F     L   +   L   I   L T+L+Y+P+NS + + +   ++L EW +E+DE+++RT    +            VDS  RQ + +ID+  G      + +   TP +L  +H  +   F QP     QY PWAI+    I+     +  T+ T  +L EF +A +++   +E FA       KN+++N G+RV+FT  T       +    G+   ++    H   +G I+ PG    W   +    + +LR  P    QW SEW     +++R  E   + ++ LK+  E  DRDGVFLN+ +  I YP    Y+  Y+  + + L T+
Sbjct:  461 PNVVIKLGRELQKRIGLLPVVDVHAFHLDSQPGQIVRMLRVQPQSYSEIARVVRAARTMKLTVRACGERTGGDIGIYGTPSTVLVDCGLLADSPRLEFVNVKPKGDDEEIPGLRVLACVGINELVQFQINNRIEIAQSVETASVWGTVVGAVTSSAPGIVGPCSNAQGGCLSDEVIGVRIVDCHGDLIQYSGK---------KELSAALSTLGVLGIVYDITLRYSPLSLTRVDYRFLKWSKLLELDNSILRNSIEEKLFTELIYLPYNSCDLEEQDV-VELPEWSAEQDEVILRTGKHLEEAVNQGADDPSVVDSCPRQLVYLIDQVFGPEPKEFITQISKTPWLLGRAHHHLRCRF-QPEPSQIQYTPWAINALGKITEPIRTLRFTMETDKNLKEFAEAMKIVFQLLEDFAHGGGGYRKNYAMNLGLRVHFTGRTKTGRLLGVGFDSGEDQLNTTILAHFTFVG-ITPPGPSTLWTRAANHTTNVLLRSIPRCMPQWRSEWYGITELVKRFQEALCKQIEPLKKLAELADRDGVFLNELMASIIYPEPTFYQKLYQSQRNDALYTI 1017          
BLAST of FAD-binding PCMH-type domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20370404 (tr|G7YET9|G7YET9_CLOSI LIM domain-binding protein 1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_106225 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 8.139e-75
Identity = 186/569 (32.69%), Postives = 298/569 (52.37%), Query Frame = 2
Query:  113 PTLIIELATELQKRIGILPLVKVDAYALPNESGIIYRIMRIQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQIRMK-DLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLD--RTVVGVIVSGSHGAITSAHSS----LADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFS-NFKDLHEKINTNLSTQLVYVPFNSIEYDCKTAEIKLDEWKSEKDEIMIRTMTETD------------VDSDMRQFITVIDEEKGC-LDTVLKESHLTPLILKESHRIMHRNFIQPHN---QYLPWAIHCFPTISTGFHDVTITL-TLGDLTEFGKAFRLILDKIEHFARS-----KNFSVNGGVRVNFTKGT------NITLCPGQKGPDSDKSVHIKVLGVISSPG----WRDISFQIMDEILRHNPSATLQWSSEWIDRPIVIERVLELEGQYLDKLKEEIEKMDRDGVFLNDHLQRIFYPFLQSYRSTYKHLQTEYLSTL 1699
            P ++I+L  ELQKRIG+LP+V V A+ L ++ G I R++R+QP S SEI+RV+RAARTMKL +R  G  +  +  I     +V++D   L+DS R+E V ++ K D   + GLRVLA V I+EL ++Q+ N++    + E      TVVG + S + G +    ++    L+D V+ VRI+D HG++  Y+             + + +S LG+LGIVYD+ L+Y  L   +V+Y F     L   +   L   I   L T+L+Y+P+NS + + +   ++L EW +E+DE+++RT    +            VDS  RQ + +ID+  G      + +   TP +L  +H  +   F QP     QY PWAI+    I+     +  T+ T  +L EF +A +++   +E FA       KN+++N G+RV+FT  T       +    G+   ++    H   +G I+ PG    W   +    + +LR  P    QW SEW     +++R  E   + ++ LK+  E  DRDGVFLN+ +  I YP    Y+  Y+  + + L T+
Sbjct:  477 PNVVIKLGRELQKRIGLLPVVDVHAFHLDSQPGQIVRMLRVQPQSYSEIARVVRAARTMKLTVRACGERTGGDIGIYGTPSTVLVDCGLLADSPRLEFVNVKPKGDDEEIPGLRVLACVGINELVQFQINNRIEIAQSVETASVWGTVVGAVTSSAPGIVGPCSNAQGGCLSDEVIGVRIVDCHGDLIQYSGK---------KELSAALSTLGVLGIVYDITLRYSPLSLTRVDYRFLKWSKLLELDNSILRNSIEEKLFTELIYLPYNSCDLEEQDV-VELPEWSAEQDEVILRTGKHLEEAVNQGADDPSVVDSCPRQLVYLIDQVFGPEPKEFITQISKTPWLLGRAHHHLRCRF-QPEPSQIQYTPWAINALGKITEPIRTLRFTMETDKNLKEFAEAMKIVFQLLEDFAHGGGGYRKNYAMNLGLRVHFTGRTKTGRLLGVGFDSGEDQLNTTILAHFTFVG-ITPPGPSTLWTRAANHTTNVLLRSIPRCMPQWRSEWYGITELVKRFQEALCKQIEPLKKLAELADRDGVFLNELMASIIYPEPTFYQKLYQSQRNDALYTI 1033          
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Yeast
Match: ALO1 (D-Arabinono-1,4-lactone oxidase; catalyzes the final step in biosynthesis of dehydro-D-arabinono-1,4-lactone, which is protective against oxidative stress [Source:SGD;Acc:S000004551])

HSP 1 Score: 58.151 bits (139), Expect = 1.920e-9
Identity = 49/222 (22.07%), Postives = 106/222 (47.75%), Query Frame = 2
Query:  188 YALPNESGIIYRIMR--IQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQ--IRMKDLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLDRTVVGVIVSGSHGAITSAHSSLADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFSNFKDL 841
            Y   N +GI         QPSS+ E+  ++++AR  +  +  +G+G S + + + +++ V LD        R+++VQ  +   +L Y + + V AG+ +++L E+               +++V G+I +GSHG+ +  H  ++   + + I++  GE++      +++  +     K+ +  +G +GI+    ++      +K   E  T ENL   +  L
Sbjct:   10 YVFKNWAGIYSAKPERYFQPSSIDEVVELVKSARLAEKSLVTVGSGHSPSNMCVTDEWLVNLD--------RLDKVQKFVEYPELHYAD-VTVDAGMRLYQLNEFLGAKGYSIQNLGSISEQSVAGIISTGSHGS-SPYHGLISSQYVNLTIVNGKGELK------FLDAENDPEVFKAALLSVGKIGIIVSATIRVVPGFNIKSTQEVITFENLLKQWDTL 215          
BLAST of FAD-binding PCMH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000066568.1 (SMESG000066568.1)

HSP 1 Score: 1109.75 bits (2869), Expect = 0.000e+0
Identity = 536/537 (99.81%), Postives = 537/537 (100.00%), Query Frame = 2
Query:   92 MVERGADPTLIIELATELQKRIGILPLVKVDAYALPNESGIIYRIMRIQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQIRMKDLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLDRTVVGVIVSGSHGAITSAHSSLADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFSNFKDLHEKINTNLSTQLVYVPFNSIEYDCKTAEIKLDEWKSEKDEIMIRTMTETDVDSDMRQFITVIDEEKGCLDTVLKESHLTPLILKESHRIMHRNFIQPHNQYLPWAIHCFPTISTGFHDVTITLTLGDLTEFGKAFRLILDKIEHFARSKNFSVNGGVRVNFTKGTNITLCPGQKGPDSDKSVHIKVLGVISSPGWRDISFQIMDEILRHNPSATLQWSSEWIDRPIVIERVLELEGQYLDKLKEEIEKMDRDGVFLNDHLQRIFYPFLQSYRSTYKHLQTEYLSTLR 1702
            MVERGADPTLIIELATELQKRIGILPLVKVDAYALPNESGIIYRIMRIQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQIRMKDLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLDRTVVGVIVSGSHGAITSAHSSLADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFSNFKDLH+KINTNLSTQLVYVPFNSIEYDCKTAEIKLDEWKSEKDEIMIRTMTETDVDSDMRQFITVIDEEKGCLDTVLKESHLTPLILKESHRIMHRNFIQPHNQYLPWAIHCFPTISTGFHDVTITLTLGDLTEFGKAFRLILDKIEHFARSKNFSVNGGVRVNFTKGTNITLCPGQKGPDSDKSVHIKVLGVISSPGWRDISFQIMDEILRHNPSATLQWSSEWIDRPIVIERVLELEGQYLDKLKEEIEKMDRDGVFLNDHLQRIFYPFLQSYRSTYKHLQTEYLSTLR
Sbjct:    1 MVERGADPTLIIELATELQKRIGILPLVKVDAYALPNESGIIYRIMRIQPSSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDSERIERVQIRMKDLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLDRTVVGVIVSGSHGAITSAHSSLADYVLQVRIMDIHGEIQTYTDMSYVEFNDSFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFSNFKDLHKKINTNLSTQLVYVPFNSIEYDCKTAEIKLDEWKSEKDEIMIRTMTETDVDSDMRQFITVIDEEKGCLDTVLKESHLTPLILKESHRIMHRNFIQPHNQYLPWAIHCFPTISTGFHDVTITLTLGDLTEFGKAFRLILDKIEHFARSKNFSVNGGVRVNFTKGTNITLCPGQKGPDSDKSVHIKVLGVISSPGWRDISFQIMDEILRHNPSATLQWSSEWIDRPIVIERVLELEGQYLDKLKEEIEKMDRDGVFLNDHLQRIFYPFLQSYRSTYKHLQTEYLSTLR 537          
The following BLAST results are available for this feature:
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O93852|ALO_CANAL3.128e-1125.94D-arabinono-1,4-lactone oxidase OS=Candida albican... [more]
sp|Q6BZA0|ALO_DEBHA2.190e-925.00D-arabinono-1,4-lactone oxidase OS=Debaryomyces ha... [more]
sp|Q7SGY1|ALO_NEUCR1.059e-724.42Putative D-arabinono-1,4-lactone oxidase OS=Neuros... [more]
sp|P54783|ALO_YEAST1.333e-722.07D-arabinono-1,4-lactone oxidase OS=Saccharomyces c... [more]
sp|Q752Y3|ALO_ASHGO5.265e-623.18D-arabinono-1,4-lactone oxidase OS=Ashbya gossypii... [more]
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|215049303.973e-8333.33tr|A0A075AIR6|A0A075AIR6_9TREM FAD-binding PCMH-ty... [more]
gnl|BL_ORD_ID|161723471.613e-7933.16tr|A0A4S2MC92|A0A4S2MC92_OPIFE FAD-binding PCMH-ty... [more]
gnl|BL_ORD_ID|162591069.325e-7632.69tr|A0A183ABH3|A0A183ABH3_9TREM FAD-binding PCMH-ty... [more]
gnl|BL_ORD_ID|203541615.365e-7532.69tr|A0A419Q0E0|A0A419Q0E0_CLOSI LIM domain-binding ... [more]
gnl|BL_ORD_ID|203704048.139e-7532.69tr|G7YET9|G7YET9_CLOSI LIM domain-binding protein ... [more]
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ALO11.920e-922.07D-Arabinono-1,4-lactone oxidase; catalyzes the fin... [more]
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAD-binding PCMH-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000066568.10.000e+099.81SMESG000066568.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027076 ID=SMED30027076|Name=FAD-binding PCMH-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1792bp
TACAGAGATTTCTCAACAAACTATAGTAACCAGCGCTTGGTTTTAATTTC
AAAAAATAATTTTTGTTTTTTAAATTTGAAATCTATTTCTGATGGTTGAA
CGAGGTGCTGATCCAACATTGATAATTGAATTGGCCACAGAATTGCAAAA
GCGAATCGGAATATTACCATTGGTTAAAGTCGATGCGTATGCTCTACCGA
ATGAAAGTGGAATCATTTACCGAATTATGCGAATCCAACCAAGCTCAATG
TCAGAAATTTCAAGAGTGATTAGAGCAGCCAGAACAATGAAATTACATAT
TCGCTGCATTGGCGCTGGTTCAAGTTTGAATCGGGTGATATTGATGAATG
ATTTCAGTGTGGTTTTGGATCTGAGATTTCTGAGCGATAGTGAAAGAATT
GAAAGAGTGCAAATTCGAATGAAAGACCTATCATATGTTGAAGGTTTGCG
AGTATTGGCTGGAGTGACAATTCATGAATTATGCGAATATCAAGTTCAAA
ATCAATTATGTTTCCCAACGAATTCTGAGCCACTAGATCGCACTGTTGTT
GGGGTTATTGTTTCAGGAAGTCACGGTGCAATTACCAGTGCTCATAGTTC
ATTGGCGGATTATGTTTTACAAGTCCGTATTATGGATATCCACGGTGAAA
TTCAGACTTACACCGACATGTCTTATGTGGAATTTAACGATTCTTTTAAT
TACATTAAATCAGTAATATCGGGTCTTGGAATGCTTGGCATTGTTTACGA
TGTCATTCTAAAGTATGACTGGCTAAAAACTGTTAAAGTAAATTATGAAT
TTCCAACAATCGAAAATCTCTTTTCCAACTTCAAGGATTTACACGAAAAA
ATTAACACAAATCTGTCGACTCAACTGGTCTATGTGCCATTCAATTCGAT
TGAATATGATTGTAAAACCGCAGAAATTAAGCTCGATGAATGGAAAAGCG
AAAAAGATGAGATTATGATTAGAACAATGACAGAAACTGATGTCGATAGC
GACATGAGACAGTTCATTACGGTCATTGATGAAGAGAAAGGTTGTCTTGA
TACAGTATTAAAAGAATCTCACCTAACTCCATTAATTCTCAAGGAAAGTC
ACAGAATAATGCATAGGAATTTTATACAGCCACATAACCAATATTTACCA
TGGGCCATTCATTGTTTTCCAACGATTTCCACTGGATTTCATGATGTAAC
AATAACATTAACTCTCGGGGACCTGACGGAATTCGGAAAAGCATTCAGAT
TAATTTTAGATAAAATTGAACATTTTGCCCGAAGTAAAAACTTCTCTGTA
AATGGTGGTGTCAGAGTAAATTTCACAAAGGGAACAAATATAACTCTATG
TCCAGGACAGAAAGGACCTGATTCTGATAAAAGTGTCCATATTAAAGTTT
TAGGAGTCATTTCTTCTCCTGGGTGGAGAGATATATCTTTTCAAATTATG
GATGAAATATTGAGGCATAATCCATCTGCAACATTGCAATGGAGTTCAGA
GTGGATAGACCGCCCGATTGTAATTGAAAGAGTTCTTGAACTTGAAGGTC
AATATCTAGATAAATTGAAGGAGGAGATTGAAAAGATGGACCGTGATGGT
GTATTCCTGAATGATCACTTACAAAGAATATTTTATCCCTTTTTACAATC
CTATCGGAGTACTTACAAACATCTTCAAACCGAATATTTGTCAACATTAA
GATAGAATAGAATTTTATATATTTTAAAAATAGTATAACAATTTTAATCA
GCTTGAAAACATTTTTCGCAAGGATTTAATGTAATATTGGTT
back to top

protein sequence of SMED30027076-orf-1

>SMED30027076-orf-1 ID=SMED30027076-orf-1|Name=SMED30027076-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=538bp
MVERGADPTLIIELATELQKRIGILPLVKVDAYALPNESGIIYRIMRIQP
SSMSEISRVIRAARTMKLHIRCIGAGSSLNRVILMNDFSVVLDLRFLSDS
ERIERVQIRMKDLSYVEGLRVLAGVTIHELCEYQVQNQLCFPTNSEPLDR
TVVGVIVSGSHGAITSAHSSLADYVLQVRIMDIHGEIQTYTDMSYVEFND
SFNYIKSVISGLGMLGIVYDVILKYDWLKTVKVNYEFPTIENLFSNFKDL
HEKINTNLSTQLVYVPFNSIEYDCKTAEIKLDEWKSEKDEIMIRTMTETD
VDSDMRQFITVIDEEKGCLDTVLKESHLTPLILKESHRIMHRNFIQPHNQ
YLPWAIHCFPTISTGFHDVTITLTLGDLTEFGKAFRLILDKIEHFARSKN
FSVNGGVRVNFTKGTNITLCPGQKGPDSDKSVHIKVLGVISSPGWRDISF
QIMDEILRHNPSATLQWSSEWIDRPIVIERVLELEGQYLDKLKEEIEKMD
RDGVFLNDHLQRIFYPFLQSYRSTYKHLQTEYLSTLR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0071949FAD binding
GO:0016899oxidoreductase activity, acting on the CH-OH group of donors, oxygen as acceptor
GO:0050660flavin adenine dinucleotide binding
GO:0003824catalytic activity
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR010031FAD_lactone_oxidase
IPR036318FAD-bd_PCMH-like_sf
IPR016169FAD-bd_PCMH_sub2
IPR016167FAD-bd_PCMH_sub1
IPR006094Oxid_FAD_bind_N
IPR016166FAD-bd_PCMH
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 482..502
NoneNo IPR availableCOILSCoilCoilcoord: 274..294
NoneNo IPR availableGENE3DG3DSA:3.30.465.40coord: 45..242
e-value: 1.6E-14
score: 55.3
IPR006094FAD linked oxidase, N-terminalPFAMPF01565FAD_binding_4coord: 48..189
e-value: 6.2E-14
score: 51.9
IPR010031L-gulonolactone/D-arabinono-1,4-lactone oxidasePANTHERPTHR43762FAMILY NOT NAMEDcoord: 48..515
IPR016166FAD-binding domain, PCMH-typePROSITEPS51387FAD_PCMHcoord: 40..228
score: 12.444
IPR036318FAD-binding, type PCMH-like superfamilySUPERFAMILYSSF56176FAD-binding/transporter-associated domain-likecoord: 43..224