protein FAM136A

Overview
Nameprotein FAM136A
Smed IDSMED30027070
Length (bp)508
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein FAM136A (SMED30027070) t-SNE clustered cells

Violin plots show distribution of expression levels for protein FAM136A (SMED30027070) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein FAM136A (SMED30027070) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein FAM136A (SMED30027070) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027070

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027070SMESG000021181.1 SmedASXL_003075SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027070SMESG000021181.1 SmedASXL_003075SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30027070SMESG000021181.1 dd_Smed_v4_6009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027070SMESG000021181.1 dd_Smed_v4_6009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027070SMESG000021181.1 dd_Smed_v4_6009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027070SMESG000021181.1 dd_Smed_v4_6009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027070SMESG000021181.1 dd_Smed_v4_6009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027070SMESG000021181.1 dd_Smed_v4_6009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027070SMESG000021181.1 dd_Smed_v4_6009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027070SMESG000021181.1 Contig34443newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027070SMESG000021181.1 Contig34443uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027070SMESG000021181.1 Contig46687newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027070SMESG000021181.1 Contig46687uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein FAM136A vs. Ensembl Human
Match: FAM136A (family with sequence similarity 136 member A [Source:HGNC Symbol;Acc:HGNC:25911])

HSP 1 Score: 94.3597 bits (233), Expect = 1.123e-24
Identity = 48/137 (35.04%), Postives = 87/137 (63.50%), Query Frame = 2
Query:   32 LNEMQQI-YQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKL 439
            + E+QQ+  Q A ++ + +++R+ +RK+Q   +RCSA CCE+  +S ++V +C+ +C  P+   Q+ + +E+  FQ+RL RC + C DK KD  S+     E+QV ++++  C   CVD H+ + +PT+ +K+K  L
Sbjct:    1 MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKD--SIDAGSKELQV-KQQLDSCVTKCVDDHM-HLIPTMTKKMKEAL 133          
BLAST of protein FAM136A vs. Ensembl Human
Match: FAM136A (family with sequence similarity 136 member A [Source:HGNC Symbol;Acc:HGNC:25911])

HSP 1 Score: 79.7221 bits (195), Expect = 4.756e-18
Identity = 43/138 (31.16%), Postives = 74/138 (53.62%), Query Frame = 2
Query:   26 RELNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKL 439
            R   ++   +  A       + R      Q   +RCSA CCE+  +S ++V +C+ +C  P+   Q+ + +E+  FQ+RL RC + C DK KD  S+     E+QV ++++  C   CVD H+ + +PT+ +K+K  L
Sbjct:  110 RPRRQVGSPWWQALAPPPSPLTRPL---PQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKD--SIDAGSKELQV-KQQLDSCVTKCVDDHM-HLIPTMTKKMKEAL 240          
BLAST of protein FAM136A vs. Ensembl Human
Match: FAM136A (family with sequence similarity 136 member A [Source:HGNC Symbol;Acc:HGNC:25911])

HSP 1 Score: 60.4622 bits (145), Expect = 1.775e-11
Identity = 26/64 (40.62%), Postives = 41/64 (64.06%), Query Frame = 2
Query:  113 QADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKD 304
            Q   +RCSA CCE+  +S ++V +C+ +C  P+   Q+ + +E+  FQ+RL RC + C DK KD
Sbjct:   99 QGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKD 162          
BLAST of protein FAM136A vs. Ensembl Celegans
Match: ZK637.2 (pep chromosome:WBcel235:III:8887751:8890143:1 gene:WBGene00014022.1 transcript:ZK637.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK637.2)

HSP 1 Score: 67.781 bits (164), Expect = 8.351e-15
Identity = 37/135 (27.41%), Postives = 68/135 (50.37%), Query Frame = 2
Query:   62 AFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEK-----EVSRCARSCVDSHLDNNLPTLVQKIKSKLKENV 451
            A    +D +D+ +LR +Q   ++CSA+CC+N  ++ + V+ C+  C+  +   Q Y+E E+   Q++L RC + C DK   +    P  N+   ++K     ++  C   C D H+      L+  IK +  +N 
Sbjct:   16 AVDEMIDDLDKTYLRDMQKSMFQCSARCCDNKKTTRDAVENCVESCNDGMKKAQGYLEKELGGLQDQLSRCAMTCYDKLVQQFG--PDVNKYSESQKLSFNEKLDSCVSVCADDHI-----KLIPAIKKRFAKNT 143          
BLAST of protein FAM136A vs. Ensembl Fly
Match: CG5323 (gene:FBgn0034362 transcript:FBtr0086706)

HSP 1 Score: 103.605 bits (257), Expect = 1.756e-28
Identity = 49/139 (35.25%), Postives = 85/139 (61.15%), Query Frame = 2
Query:   32 LNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKEN 448
            + + +Q  + A    +D +D+  LRK+Q + + C+AKCC++  SS + VQRC+ +CS P+   Q+Y+++E+  FQ RLQRC++ C D  K +M   P E++I     +  RCA  CVD H+   +P +++ +K+ L + 
Sbjct:    2 IQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSVQRCVDRCSAPMTRAQNYVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPNEDQIAKYTDQFERCAIQCVDKHV-GLIPGMMKTMKAVLSKG 139          
BLAST of protein FAM136A vs. Ensembl Fly
Match: CG5327 (gene:FBgn0034363 transcript:FBtr0086707)

HSP 1 Score: 89.7373 bits (221), Expect = 4.693e-23
Identity = 40/128 (31.25%), Postives = 78/128 (60.94%), Query Frame = 2
Query:   56 QNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKL 439
            + A    ++ + R  LR++Q+  +RC+A+CC++   + E VQ C+ KC+ P+++ Q ++++E+  FQNRLQ C+ DC    + +M   P++ ++  ++     C  +CVD ++ N +P L++ IK  L
Sbjct:   10 EGAISEMIEDMYRTHLRRMQSTMHRCAARCCDDDRGTLESVQNCIEKCAGPLMDAQDFLQHELGQFQNRLQNCVRDCNSDARSQMPSNPSDRDMSRSQHMFESCTNNCVDKYI-NLIPGLLKSIKQTL 136          
BLAST of protein FAM136A vs. Ensembl Fly
Match: CG12661 (gene:FBgn0030071 transcript:FBtr0071265)

HSP 1 Score: 62.3882 bits (150), Expect = 8.320e-13
Identity = 38/140 (27.14%), Postives = 77/140 (55.00%), Query Frame = 2
Query:   32 LNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKENV 451
            L E ++   NA   +M+ +DRD+LRK+Q + +RC+  CC +  ++ E V+RC+ +C   +   + +++  ++ F+NRL++C+  C                +  ++  + RC  +CVDSH+   LP + + ++  L++ V
Sbjct:    8 LEEKRERVDNAILTAMEDLDRDYLRKLQIEMHRCATACCADADANAEAVERCIDRCQIRLTRSRCFVQQGISDFENRLEKCIQQC---------------RLNGSDYSLERCTSNCVDSHV-GLLPEMFRAMRDTLEKGV 131          
BLAST of protein FAM136A vs. Ensembl Fly
Match: CG12661 (gene:FBgn0030071 transcript:FBtr0333603)

HSP 1 Score: 62.3882 bits (150), Expect = 8.320e-13
Identity = 38/140 (27.14%), Postives = 77/140 (55.00%), Query Frame = 2
Query:   32 LNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKENV 451
            L E ++   NA   +M+ +DRD+LRK+Q + +RC+  CC +  ++ E V+RC+ +C   +   + +++  ++ F+NRL++C+  C                +  ++  + RC  +CVDSH+   LP + + ++  L++ V
Sbjct:    8 LEEKRERVDNAILTAMEDLDRDYLRKLQIEMHRCATACCADADANAEAVERCIDRCQIRLTRSRCFVQQGISDFENRLEKCIQQC---------------RLNGSDYSLERCTSNCVDSHV-GLLPEMFRAMRDTLEKGV 131          
BLAST of protein FAM136A vs. Ensembl Zebrafish
Match: fam136a (family with sequence similarity 136 member A [Source:NCBI gene;Acc:406709])

HSP 1 Score: 55.0694 bits (131), Expect = 2.150e-10
Identity = 22/67 (32.84%), Postives = 42/67 (62.69%), Query Frame = 2
Query:   56 QNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQ 256
            QNA +  +  ++++ +RK+Q   +RCSA+CCE+  +S  +V +C+ +C  P+   Q  + +E+  FQ
Sbjct:   10 QNAVEEMVQNLEKEHIRKMQGRMFRCSAECCEHPGNSMNQVHQCIERCHTPLAKAQGLVTSELEQFQ 76          
BLAST of protein FAM136A vs. Ensembl Xenopus
Match: lamb2 (laminin subunit beta 2 [Source:Xenbase;Acc:XB-GENE-5935962])

HSP 1 Score: 97.8265 bits (242), Expect = 1.393e-25
Identity = 49/142 (34.51%), Postives = 84/142 (59.15%), Query Frame = 2
Query:   32 LNEMQQIYQNAFQNSMD----AIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKE 445
            L++M +  QN  QN++D    +++RD +RK+Q   +RCSA+CCE+  +S ++V  C+ +C  P+   QS + NE+  FQNRL RC + C DK KD       E +++    ++  C   C + H+ N +P++ +K+K  L +
Sbjct:   38 LSDMAEEQQNRLQNAIDTMVKSLERDNIRKMQGKMFRCSAQCCEDNGASMQQVHHCIERCHTPLAQAQSLVTNELERFQNRLARCTMHCNDKAKDSFDSGSKEAQVKA---QLEGCVIKCAEEHM-NLIPSMTKKLKDALAQ 175          
BLAST of protein FAM136A vs. Ensembl Mouse
Match: Fam136a (family with sequence similarity 136, member A [Source:MGI Symbol;Acc:MGI:1913738])

HSP 1 Score: 93.5893 bits (231), Expect = 1.695e-24
Identity = 46/137 (33.58%), Postives = 83/137 (60.58%), Query Frame = 2
Query:   32 LNEMQQI-YQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKL 439
            + E+QQ+  Q A    + +++R+ +RK+Q   +RCSA CCE+  +S ++V +C+ +C  P+   Q+ + +E+  FQ+RL RC + C DK KD M     E +++   +++  C   CVD H+ + +PT+ +K+K  L
Sbjct:    1 MAEVQQLRVQEAVDAMVKSVERENIRKMQGLMFRCSANCCEDTQASMQQVHQCIERCHAPLAQAQALVTSELERFQDRLARCTMHCNDKAKDSMDAGTKELQVK---RQLDSCVTKCVDDHM-HLIPTMTKKMKESL 133          
BLAST of protein FAM136A vs. Ensembl Mouse
Match: Fam136a (family with sequence similarity 136, member A [Source:MGI Symbol;Acc:MGI:1913738])

HSP 1 Score: 56.225 bits (134), Expect = 1.164e-10
Identity = 26/78 (33.33%), Postives = 49/78 (62.82%), Query Frame = 2
Query:   32 LNEMQQI-YQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNR 262
            + E+QQ+  Q A    + +++R+ +RK+Q   +RCSA CCE+  +S ++V +C+ +C  P+   Q+ + +E+  FQ R
Sbjct:    1 MAEVQQLRVQEAVDAMVKSVERENIRKMQGLMFRCSANCCEDTQASMQQVHQCIERCHAPLAQAQALVTSELERFQVR 78          
BLAST of protein FAM136A vs. UniProt/SwissProt
Match: sp|A4QNC6|F136A_XENTR (Protein FAM136A OS=Xenopus tropicalis OX=8364 GN=fam136a PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.493e-24
Identity = 47/136 (34.56%), Postives = 78/136 (57.35%), Query Frame = 2
Query:   38 EMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKE 445
            E Q   QNA    + +++RD +RK+Q   +RCSA+CCE+  +S ++V  C+ +C  P+   QS + NE+  FQNRL RC + C DK KD       E +++    ++  C   C + H+ N +P++ +K+K  L +
Sbjct:    4 EQQNRLQNAIDTMVKSLERDNIRKMQGKMFRCSAQCCEDNGASMQQVHHCIERCHTPLAQAQSLVTNELERFQNRLARCTMHCNDKAKDSFDSGSKEAQVKA---QLEGCVIKCAEEHM-NLIPSMTKKLKDALAQ 135          
BLAST of protein FAM136A vs. UniProt/SwissProt
Match: sp|Q63ZH8|F136A_XENLA (Protein FAM136A OS=Xenopus laevis OX=8355 GN=fam136a PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.427e-24
Identity = 46/139 (33.09%), Postives = 83/139 (59.71%), Query Frame = 2
Query:   41 MQQIYQNAFQNSMDA----IDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKE 445
            M + +QN  QN++D+    ++RD +RK+Q   +RCSA+CCE+  +S ++V  C+ +C  P+   QS +  E+  FQNRL RC ++C+D+ KD       E +++    ++  C   C + H+ N +P++ +K+K  L +
Sbjct:    1 MAEEHQNRLQNAVDSMVKSLERDNIRKMQGKMFRCSAQCCEDNGASMQQVHHCIERCHTPLAQAQSLVTTELERFQNRLSRCTMNCSDQAKDAFDSGSKEAQVKA---QLEGCVIKCAEEHM-NLIPSMTKKLKDALAQ 135          
BLAST of protein FAM136A vs. UniProt/SwissProt
Match: sp|Q96C01|F136A_HUMAN (Protein FAM136A OS=Homo sapiens OX=9606 GN=FAM136A PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 5.395e-24
Identity = 48/137 (35.04%), Postives = 87/137 (63.50%), Query Frame = 2
Query:   32 LNEMQQI-YQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKL 439
            + E+QQ+  Q A ++ + +++R+ +RK+Q   +RCSA CCE+  +S ++V +C+ +C  P+   Q+ + +E+  FQ+RL RC + C DK KD  S+     E+QV ++++  C   CVD H+ + +PT+ +K+K  L
Sbjct:    1 MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKD--SIDAGSKELQV-KQQLDSCVTKCVDDHM-HLIPTMTKKMKEAL 133          
BLAST of protein FAM136A vs. UniProt/SwissProt
Match: sp|Q9CR98|F136A_MOUSE (Protein FAM136A OS=Mus musculus OX=10090 GN=Fam136a PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.186e-23
Identity = 46/137 (33.58%), Postives = 83/137 (60.58%), Query Frame = 2
Query:   32 LNEMQQI-YQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKL 439
            + E+QQ+  Q A    + +++R+ +RK+Q   +RCSA CCE+  +S ++V +C+ +C  P+   Q+ + +E+  FQ+RL RC + C DK KD M     E +++   +++  C   CVD H+ + +PT+ +K+K  L
Sbjct:    1 MAEVQQLRVQEAVDAMVKSVERENIRKMQGLMFRCSANCCEDTQASMQQVHQCIERCHAPLAQAQALVTSELERFQDRLARCTMHCNDKAKDSMDAGTKELQVK---RQLDSCVTKCVDDHM-HLIPTMTKKMKESL 133          
BLAST of protein FAM136A vs. UniProt/SwissProt
Match: sp|Q2HJI3|F136A_BOVIN (Protein FAM136A OS=Bos taurus OX=9913 GN=FAM136A PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.657e-23
Identity = 48/137 (35.04%), Postives = 84/137 (61.31%), Query Frame = 2
Query:   32 LNEMQQI-YQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKL 439
            + E+QQ+  Q A  + + +++R+ +RK+Q   +RCSA CCE   +S ++V +C+ +C  P+   Q+ + +E+  FQ+RL RC + C DK KD  S+     E+ V ++++  C   CVD H+ N +PT+ +K+K  L
Sbjct:    1 MAELQQLRVQEAVDSMVKSLERENIRKMQGLMFRCSAACCEESQASMQQVHQCIERCHAPLAQAQALVTSELEKFQDRLARCTMYCNDKAKD--SIDAGSKELHV-KRQLETCVTKCVDDHM-NLIPTMTRKMKESL 133          
BLAST of protein FAM136A vs. TrEMBL
Match: A0A4E0RWF9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_009757 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.417e-38
Identity = 58/140 (41.43%), Postives = 101/140 (72.14%), Query Frame = 2
Query:   26 RELNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKE 445
            RE+N+MQ+ YQ   QN+M  +D+++LRK+QA  +RC  KCC++  SS  EVQRC+  C  P+    S+++NE+ +FQNRLQ+C  +C+++ +D +   PT+ +I+ A+++   C+++C+DSHL   LP LV++++S+L++
Sbjct:   11 REVNKMQEHYQKTVQNAMTQLDKEYLRKMQAAYFRCGMKCCDDQSSSVSEVQRCIEHCEAPLSQAHSFMQNELAAFQNRLQQCSTECSNRARDNLKSDPTDEDIKKAQRQAFDCSKTCLDSHLSKGLPALVERLQSQLRK 150          
BLAST of protein FAM136A vs. TrEMBL
Match: A0A504YW91 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_06259 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.036e-38
Identity = 58/140 (41.43%), Postives = 102/140 (72.86%), Query Frame = 2
Query:   26 RELNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKE 445
            RE+N+MQ+ YQ + QN+M  +D++FLRK+QA  +RC  KCC++  S+  EVQRC+  C  P+    S+++NE+ +FQNRLQ+C  +C+++ +D +   PT+ +I+ A+++   C+++C+DSHL   LP LV++++S+L++
Sbjct:   40 REVNKMQEHYQKSVQNAMTQLDKEFLRKMQAAYFRCGMKCCDDQSSTVSEVQRCIEHCEAPLSQAHSFMQNELAAFQNRLQQCSTECSNRARDNLKSDPTDEDIKKAQRQAFDCSKTCLDSHLSKGLPALVERLQSQLRK 179          
BLAST of protein FAM136A vs. TrEMBL
Match: A0A3Q0J574 (protein FAM136A-like isoform X1 OS=Diaphorina citri OX=121845 GN=LOC113469852 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.610e-33
Identity = 62/130 (47.69%), Postives = 82/130 (63.08%), Query Frame = 2
Query:   59 NAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKEN 448
            NA    M  ID+ FLRK+QAD +RCS KCCEN  ++ E VQ CL  CS P +  Q Y++ E   +Q RLQRC+LDC D+ KD+M V P ++++    ++   CA  CVD H+   LPTL QKIK  L +N
Sbjct:   11 NAVMKIMVDIDKQFLRKMQADMHRCSVKCCENKDATMEGVQECLEVCSAPFMRAQKYLQMEFEQYQTRLQRCVLDCNDEIKDKMGVNPKQSDMDAYTRQFESCAEKCVDKHI-ALLPTLFQKIKKYLSDN 139          
BLAST of protein FAM136A vs. TrEMBL
Match: C1LKI1 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.154e-32
Identity = 55/140 (39.29%), Postives = 96/140 (68.57%), Query Frame = 2
Query:   26 RELNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKE 445
            R+L+ +Q  YQ A + ++  +D  +LRKIQA+ +RC  KCCE+L +S  EVQRC+ +C  P+      +++EV++FQ RLQ C  +CA++ +D++S   TE++++ A++EV  C++ CVD+ L   LP L+ ++K +L++
Sbjct:   10 RDLSRLQTDYQKAVEKALGNLDATYLRKIQANYFRCGLKCCEDLDASIAEVQRCVERCETPLSQAHELMQSEVSTFQTRLQVCASECANQARDKLSSDTTESQLKNAQREVLACSQKCVDNQLSTGLPALITRLKDQLQK 149          
BLAST of protein FAM136A vs. TrEMBL
Match: A0A1I8HS81 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.942e-32
Identity = 57/140 (40.71%), Postives = 89/140 (63.57%), Query Frame = 2
Query:   29 ELNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENL--VSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLK 442
            E+NE+Q+++Q+     +  ID+ +LRK+QAD +RCS +C E++    S  + Q CL +C Q V   +  IE E++ FQNR+QRCM+DC D+ KD +   P+ ++I  A      CA  CV +HL+ +LPT ++KI  +LK
Sbjct:    4 EMNEIQKVFQDEVHKQIGLIDKQYLRKLQADTFRCSIRCVEDVQAYPSPRDSQSCLERCGQVVQQAEKDIEVELSGFQNRVQRCMMDCGDRAKDGLPASPSSDQIAKARVASEACAEKCVRTHLEQHLPTAMKKIGERLK 143          
BLAST of protein FAM136A vs. Ensembl Cavefish
Match: fam136a (family with sequence similarity 136 member A [Source:NCBI gene;Acc:103037603])

HSP 1 Score: 85.8853 bits (211), Expect = 1.104e-21
Identity = 45/138 (32.61%), Postives = 75/138 (54.35%), Query Frame = 2
Query:   32 LNEMQQI-YQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLK 442
            + E  Q+  Q A +  +  ++++ +RK+Q   +RCSA CCE    S  +V +C+  C  P+   Q  + +E+  FQ+RL RC + C DK KD       E  ++     + +C  SCVD HL + LP++ +K+K  L+
Sbjct:    1 MAEAHQVRVQKAVEGMVQNLEKEHIRKMQGRMFRCSADCCERSSDSMAQVHQCIEVCHTPLAKAQGLVTHELEQFQDRLTRCTMHCNDKAKDLFDSGAKEPAVRSL---MEKCVGSCVDDHL-SLLPSMTRKLKESLQ 134          
BLAST of protein FAM136A vs. Ensembl Sea Lamprey
Match: fam136a (family with sequence similarity 136 member A [Source:NCBI gene;Acc:406709])

HSP 1 Score: 101.679 bits (252), Expect = 1.586e-28
Identity = 50/132 (37.88%), Postives = 77/132 (58.33%), Query Frame = 2
Query:   44 QQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKL 439
            Q   Q+A    +D ++R+ +RK+QA  +RCSA+CCEN  +S   V  C+ +C  P++  QS + NE+  FQNRLQRC + C+DK KD       E   QV ++++  C R+C D H D  +P   +++   L
Sbjct:    5 QTKVQDAVNGMVDKLEREHIRKMQARMFRCSAECCENSAASMSAVHHCIERCHAPLVQAQSIVTNELERFQNRLQRCAMSCSDKAKDSFDSGTKE---QVVKQQLESCVRACADEHQD-LIPNATRRLHDTL 132          
BLAST of protein FAM136A vs. Ensembl Nematostella
Match: EDO34117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ76])

HSP 1 Score: 78.5666 bits (192), Expect = 3.332e-19
Identity = 37/128 (28.91%), Postives = 77/128 (60.16%), Query Frame = 2
Query:   65 FQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKEN 448
             + +++++++  LR IQ   + C+AKCC+N  +S   VQ+C+T+C QP+ +IQ ++E E+  FQ RL RC   C D  +D++    +++++   ++++ +C   C +  +   + T+  K+K  ++E 
Sbjct:   13 LEKTLESLEQHQLRPIQHKSHLCAAKCCDNQSASKASVQQCMTRCFQPLQDIQKFMETELQRFQGRLSRCAQQCQDDIQDKVDTNTSQSDMNKYQEQLEKCVEKCCNDSIP-VISTMHDKMKKIIRET 139          
BLAST of protein FAM136A vs. Ensembl Medaka
Match: fam136a (family with sequence similarity 136 member A [Source:NCBI gene;Acc:101172669])

HSP 1 Score: 85.8853 bits (211), Expect = 1.248e-21
Identity = 43/136 (31.62%), Postives = 73/136 (53.68%), Query Frame = 2
Query:   44 QQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKENV 451
            Q   QN  +  + +++++ +RK+Q   ++CSA CC+    S  +V +C+ +C  P+   QS + +E+  FQ+RL RC + C DK KD       E  ++     + RC  SCVD H+      L+  +  +LKEN+
Sbjct:    6 QTRVQNVVEEMVQSLEKEHIRKMQGRMFKCSADCCDRPTDSMSQVHQCIERCHTPLAQAQSLVTSELEKFQDRLSRCTMHCNDKAKDLFDSGAKEPAVRSL---MDRCVGSCVDDHI-----ALIPSVTRRLKENL 133          
BLAST of protein FAM136A vs. Planmine SMEST
Match: SMESG000021181.1 (SMESG000021181.1)

HSP 1 Score: 289.271 bits (739), Expect = 7.270e-102
Identity = 143/143 (100.00%), Postives = 143/143 (100.00%), Query Frame = 2
Query:   26 RELNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKENVL 454
            RELNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKENVL
Sbjct:    3 RELNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSSGEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSVKPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKENVL 145          
The following BLAST results are available for this feature:
BLAST of protein FAM136A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FAM136A1.123e-2435.04family with sequence similarity 136 member A [Sour... [more]
FAM136A4.756e-1831.16family with sequence similarity 136 member A [Sour... [more]
FAM136A1.775e-1140.63family with sequence similarity 136 member A [Sour... [more]
back to top
BLAST of protein FAM136A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZK637.28.351e-1527.41pep chromosome:WBcel235:III:8887751:8890143:1 gene... [more]
back to top
BLAST of protein FAM136A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG53231.756e-2835.25gene:FBgn0034362 transcript:FBtr0086706[more]
CG53274.693e-2331.25gene:FBgn0034363 transcript:FBtr0086707[more]
CG126618.320e-1327.14gene:FBgn0030071 transcript:FBtr0071265[more]
CG126618.320e-1327.14gene:FBgn0030071 transcript:FBtr0333603[more]
back to top
BLAST of protein FAM136A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam136a2.150e-1032.84family with sequence similarity 136 member A [Sour... [more]
back to top
BLAST of protein FAM136A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lamb21.393e-2534.51laminin subunit beta 2 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of protein FAM136A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fam136a1.695e-2433.58family with sequence similarity 136, member A [Sou... [more]
Fam136a1.164e-1033.33family with sequence similarity 136, member A [Sou... [more]
back to top
BLAST of protein FAM136A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4QNC6|F136A_XENTR1.493e-2434.56Protein FAM136A OS=Xenopus tropicalis OX=8364 GN=f... [more]
sp|Q63ZH8|F136A_XENLA2.427e-2433.09Protein FAM136A OS=Xenopus laevis OX=8355 GN=fam13... [more]
sp|Q96C01|F136A_HUMAN5.395e-2435.04Protein FAM136A OS=Homo sapiens OX=9606 GN=FAM136A... [more]
sp|Q9CR98|F136A_MOUSE1.186e-2333.58Protein FAM136A OS=Mus musculus OX=10090 GN=Fam136... [more]
sp|Q2HJI3|F136A_BOVIN1.657e-2335.04Protein FAM136A OS=Bos taurus OX=9913 GN=FAM136A P... [more]
back to top
BLAST of protein FAM136A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RWF91.417e-3841.43Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A504YW912.036e-3841.43Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A3Q0J5742.610e-3347.69protein FAM136A-like isoform X1 OS=Diaphorina citr... [more]
C1LKI12.154e-3239.29Uncharacterized protein OS=Schistosoma japonicum O... [more]
A0A1I8HS812.942e-3240.71Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of protein FAM136A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam136a1.104e-2132.61family with sequence similarity 136 member A [Sour... [more]
back to top
BLAST of protein FAM136A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam136a1.586e-2837.88family with sequence similarity 136 member A [Sour... [more]
back to top
BLAST of protein FAM136A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein FAM136A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO341173.332e-1928.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein FAM136A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam136a1.248e-2131.62family with sequence similarity 136 member A [Sour... [more]
back to top
BLAST of protein FAM136A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000021181.17.270e-102100.00SMESG000021181.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027070 ID=SMED30027070|Name=protein FAM136A|organism=Schmidtea mediterranea sexual|type=transcript|length=508bp
TTTTATATAAAATTGAATGATGAATAGAGAACTAAATGAAATGCAACAGA
TTTACCAAAACGCTTTTCAAAATTCCATGGACGCAATTGATAGGGACTTT
CTCAGGAAAATACAAGCGGATCAATATCGGTGCTCGGCAAAATGTTGTGA
AAATTTAGTCAGCTCAGGTGAAGAAGTTCAAAGATGTTTAACAAAATGTA
GTCAGCCTGTTATCAATATTCAATCTTATATTGAAAATGAAGTTAATTCA
TTTCAAAATAGGCTACAGCGATGTATGCTAGACTGTGCTGATAAACAAAA
GGATAGAATGTCTGTGAAACCAACTGAAAATGAAATACAAGTTGCAGAAA
AAGAAGTTAGTCGTTGTGCTAGAAGCTGTGTGGATTCTCATTTGGATAAT
AATTTGCCAACTTTGGTGCAAAAAATTAAATCAAAATTGAAAGAAAATGT
ATTATAAATATTTAGGAAACGTCTTACAGTTAAATATATATTTTAGTTCT
TCATGAAA
back to top

protein sequence of SMED30027070-orf-1

>SMED30027070-orf-1 ID=SMED30027070-orf-1|Name=SMED30027070-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MMNRELNEMQQIYQNAFQNSMDAIDRDFLRKIQADQYRCSAKCCENLVSS
GEEVQRCLTKCSQPVINIQSYIENEVNSFQNRLQRCMLDCADKQKDRMSV
KPTENEIQVAEKEVSRCARSCVDSHLDNNLPTLVQKIKSKLKENVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR008560DUF842_euk
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008560Protein of unknown function DUF842, eukaryoticPFAMPF05811DUF842coord: 9..138
e-value: 3.6E-36
score: 123.7
IPR008560Protein of unknown function DUF842, eukaryoticPANTHERPTHR21096UNCHARACTERIZEDcoord: 8..142
NoneNo IPR availablePANTHERPTHR21096:SF0PROTEIN FAM136Acoord: 8..142