Tensin 1

Overview
NameTensin 1
Smed IDSMED30027069
Length (bp)3847
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tensin 1 (SMED30027069) t-SNE clustered cells

Violin plots show distribution of expression levels for Tensin 1 (SMED30027069) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tensin 1 (SMED30027069) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tensin 1 (SMED30027069) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027069

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30027069SMESG000060707.1 dd_Smed_v4_4494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027069SMESG000060707.1 dd_Smed_v4_4494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027069SMESG000060707.1 dd_Smed_v4_4494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027069SMESG000060707.1 Contig29471newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30027069SMESG000060707.1 Contig29471uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
glial cellSMED30027069SMESG000060707.1 dd_Smed_v6_4494_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tensin 1 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 211.846 bits (538), Expect = 7.426e-56
Identity = 124/326 (38.04%), Postives = 185/326 (56.75%), Query Frame = 3
Query: 2604 TSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +    K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P+R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct:  538 TVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTA-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQ 844          
BLAST of Tensin 1 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 211.46 bits (537), Expect = 8.892e-55
Identity = 124/326 (38.04%), Postives = 185/326 (56.75%), Query Frame = 3
Query: 2604 TSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +    K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P+R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct: 1057 TVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTA-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQ 1363          
BLAST of Tensin 1 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 211.46 bits (537), Expect = 1.295e-54
Identity = 124/326 (38.04%), Postives = 185/326 (56.75%), Query Frame = 3
Query: 2604 TSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +    K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P+R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct: 1406 TVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTA-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQ 1712          

HSP 2 Score: 73.1738 bits (178), Expect = 3.654e-12
Identity = 69/291 (23.71%), Postives = 126/291 (43.30%), Query Frame = 3
Query:  396 LYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFK---NAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            L  + E I  +  P          E   S L ++ Q  K        ++ L+E  PD  KL    + F + DL  P  L+ I   C+++  WL     N  ++  +G    I ++I AY  + +     D     AL  F  K   E + +PI       Y+  +S +    ++     ++L+ +I++  P  E  S    + F + Y  + +  V+T+ +Y++       V +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D +D ++
Sbjct:   15 LVYVTERIIAVSFPST-----ANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTP-ALEKICSICKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASAD----QALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFE--SKGGCRPFLRIY--QAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTC-AIHDLGVVFGKEDLDDAFK 290          
BLAST of Tensin 1 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 211.075 bits (536), Expect = 1.670e-54
Identity = 124/326 (38.04%), Postives = 185/326 (56.75%), Query Frame = 3
Query: 2604 TSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +    K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P+R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct: 1427 TVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTA-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQ 1733          

HSP 2 Score: 73.1738 bits (178), Expect = 3.664e-12
Identity = 69/291 (23.71%), Postives = 126/291 (43.30%), Query Frame = 3
Query:  396 LYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFK---NAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            L  + E I  +  P          E   S L ++ Q  K        ++ L+E  PD  KL    + F + DL  P  L+ I   C+++  WL     N  ++  +G    I ++I AY  + +     D     AL  F  K   E + +PI       Y+  +S +    ++     ++L+ +I++  P  E  S    + F + Y  + +  V+T+ +Y++       V +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D +D ++
Sbjct:   15 LVYVTERIIAVSFPST-----ANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTP-ALEKICSICKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASAD----QALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFE--SKGGCRPFLRIY--QAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTC-AIHDLGVVFGKEDLDDAFK 290          
BLAST of Tensin 1 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 211.075 bits (536), Expect = 1.874e-54
Identity = 124/326 (38.04%), Postives = 185/326 (56.75%), Query Frame = 3
Query: 2604 TSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +    K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P+R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct: 1519 TVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTA-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQ 1825          

HSP 2 Score: 73.1738 bits (178), Expect = 3.290e-12
Identity = 69/291 (23.71%), Postives = 126/291 (43.30%), Query Frame = 3
Query:  396 LYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFK---NAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            L  + E I  +  P          E   S L ++ Q  K        ++ L+E  PD  KL    + F + DL  P  L+ I   C+++  WL     N  ++  +G    I ++I AY  + +     D     AL  F  K   E + +PI       Y+  +S +    ++     ++L+ +I++  P  E  S    + F + Y  + +  V+T+ +Y++       V +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D +D ++
Sbjct:  115 LVYVTERIIAVSFPST-----ANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTP-ALEKICSICKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASAD----QALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFE--SKGGCRPFLRIY--QAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTC-AIHDLGVVFGKEDLDDAFK 390          
BLAST of Tensin 1 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 166.007 bits (419), Expect = 5.847e-45
Identity = 106/300 (35.33%), Postives = 163/300 (54.33%), Query Frame = 3
Query: 2691 VEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYS--VYYLGCYDVEYITGPSVINKAI----ERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKG-----VKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQIL 3557
            V++  KYWY+P ISRE+AI ML++  PG F++RDSN++ GA+GLA+KV+  P  V        SE VRH+LIE S  +GV  KG   EP+F SLS LV  ++  A  LP  LVLPD     T                     L++ +   E G +  V Y+G  DVE +TG   + ++I    +R + N D+R+ +    +++S +G+ LTD  RK+FFRRH    S+ +  +DP +R+   E  ++ G     + + ++F  + +   + EN C +F EL+P      +V  IN+ +L
Sbjct:   39 VKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDG---SELVRHFLIEPS-PKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLPDFDPAATPE------------------HLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAI-NGDSRAVS-VHFKVSS-QGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERR--FENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFINKVML 311          
BLAST of Tensin 1 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 166.777 bits (421), Expect = 3.656e-44
Identity = 106/300 (35.33%), Postives = 163/300 (54.33%), Query Frame = 3
Query: 2691 VEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYS--VYYLGCYDVEYITGPSVINKAI----ERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKG-----VKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQIL 3557
            V++  KYWY+P ISRE+AI ML++  PG F++RDSN++ GA+GLA+KV+  P  V        SE VRH+LIE S  +GV  KG   EP+F SLS LV  ++  A  LP  LVLPD     T                     L++ +   E G +  V Y+G  DVE +TG   + ++I    +R + N D+R+ +    +++S +G+ LTD  RK+FFRRH    S+ +  +DP +R+   E  ++ G     + + ++F  + +   + EN C +F EL+P      +V  IN+ +L
Sbjct:  139 VKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDG---SELVRHFLIEPS-PKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLPDFDPAATPE------------------HLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAI-NGDSRAVS-VHFKVSS-QGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERR--FENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFINKVML 411          
BLAST of Tensin 1 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 166.777 bits (421), Expect = 3.656e-44
Identity = 106/300 (35.33%), Postives = 163/300 (54.33%), Query Frame = 3
Query: 2691 VEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYS--VYYLGCYDVEYITGPSVINKAI----ERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKG-----VKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQIL 3557
            V++  KYWY+P ISRE+AI ML++  PG F++RDSN++ GA+GLA+KV+  P  V        SE VRH+LIE S  +GV  KG   EP+F SLS LV  ++  A  LP  LVLPD     T                     L++ +   E G +  V Y+G  DVE +TG   + ++I    +R + N D+R+ +    +++S +G+ LTD  RK+FFRRH    S+ +  +DP +R+   E  ++ G     + + ++F  + +   + EN C +F EL+P      +V  IN+ +L
Sbjct:  139 VKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDG---SELVRHFLIEPS-PKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLPDFDPAATPE------------------HLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAI-NGDSRAVS-VHFKVSS-QGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERR--FENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFINKVML 411          
BLAST of Tensin 1 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 168.318 bits (425), Expect = 1.851e-43
Identity = 106/300 (35.33%), Postives = 164/300 (54.67%), Query Frame = 3
Query: 2691 VEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYS--VYYLGCYDVEYITGPSVINKAI----ERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKG-----VKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQIL 3557
            V++  KYWY+P ISRE+AI ML++  PG F++RDSN++ GA+GLA+KV+  P  V        SE VRH+LIE S  +GV  KG   EP+F SLS LV  ++  A  LP  LVLPD   D     +                 L++ +   E G +  V Y+G  DVE +TG   + ++I    +R + N D+R+ +    +++S +G+ LTD  RK+FFRRH    S+ +  +DP +R+   E  ++ G     + + ++F  + +   + EN C +F EL+P      +V  IN+ +L
Sbjct:  292 VKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDG---SELVRHFLIEPSP-KGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLPD--FDPAATPE----------------HLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAI-NGDSRAVS-VHFKVSS-QGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERR--FENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFINKVML 564          
BLAST of Tensin 1 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 168.703 bits (426), Expect = 3.196e-42
Identity = 106/300 (35.33%), Postives = 164/300 (54.67%), Query Frame = 3
Query: 2691 VEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYS--VYYLGCYDVEYITGPSVINKAI----ERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKG-----VKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQIL 3557
            V++  KYWY+P ISRE+AI ML++  PG F++RDSN++ GA+GLA+KV+  P  V        SE VRH+LIE S  +GV  KG   EP+F SLS LV  ++  A  LP  LVLPD   D     +                 L++ +   E G +  V Y+G  DVE +TG   + ++I    +R + N D+R+ +    +++S +G+ LTD  RK+FFRRH    S+ +  +DP +R+   E  ++ G     + + ++F  + +   + EN C +F EL+P      +V  IN+ +L
Sbjct:  671 VKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDG---SELVRHFLIEPSP-KGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLPD--FDPAATPE----------------HLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAI-NGDSRAVS-VHFKVSS-QGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERR--FENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFINKVML 943          
BLAST of Tensin 1 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0302382)

HSP 1 Score: 160.614 bits (405), Expect = 3.649e-40
Identity = 96/292 (32.88%), Postives = 152/292 (52.05%), Query Frame = 3
Query: 2679 TLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQI 3554
            ++Q      ++WY+P+++RE+AIA+L +  PG FL+RDS TY  +YGL ++V+  P            E VRH+LIE +   GV  KG  +EP+F SLS LV  ++ +   LPC L LPDR     D    ++          ++P    L         ++   C D E +TG   I KAI ++ G       TE   +++S +GI LTD  RK FFR+H+    I++CA+DP++R   +   + +  KKT    +  +++ + +N+C +F +L  S  A  IV   N  +
Sbjct:  447 SVQFARSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRVSQPPPG--------SQELVRHFLIEPTKG-GVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDR-----DIVPPVRA---------TTPAQQHLLAHGAATNVLWLYSC-DTESLTGNEAIRKAIRQMYGQQPLPQPTEVHFKVSS-QGITLTDNTRKKFFRKHYKADVISHCAIDPENR---MWTSEGESDKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSFANRTL 710          
BLAST of Tensin 1 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0082119)

HSP 1 Score: 160.614 bits (405), Expect = 3.649e-40
Identity = 96/292 (32.88%), Postives = 152/292 (52.05%), Query Frame = 3
Query: 2679 TLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQI 3554
            ++Q      ++WY+P+++RE+AIA+L +  PG FL+RDS TY  +YGL ++V+  P            E VRH+LIE +   GV  KG  +EP+F SLS LV  ++ +   LPC L LPDR     D    ++          ++P    L         ++   C D E +TG   I KAI ++ G       TE   +++S +GI LTD  RK FFR+H+    I++CA+DP++R   +   + +  KKT    +  +++ + +N+C +F +L  S  A  IV   N  +
Sbjct:  447 SVQFARSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRVSQPPPG--------SQELVRHFLIEPTKG-GVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDR-----DIVPPVRA---------TTPAQQHLLAHGAATNVLWLYSC-DTESLTGNEAIRKAIRQMYGQQPLPQPTEVHFKVSS-QGITLTDNTRKKFFRKHYKADVISHCAIDPENR---MWTSEGESDKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSFANRTL 710          
BLAST of Tensin 1 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0301093)

HSP 1 Score: 160.614 bits (405), Expect = 3.649e-40
Identity = 96/292 (32.88%), Postives = 152/292 (52.05%), Query Frame = 3
Query: 2679 TLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQI 3554
            ++Q      ++WY+P+++RE+AIA+L +  PG FL+RDS TY  +YGL ++V+  P            E VRH+LIE +   GV  KG  +EP+F SLS LV  ++ +   LPC L LPDR     D    ++          ++P    L         ++   C D E +TG   I KAI ++ G       TE   +++S +GI LTD  RK FFR+H+    I++CA+DP++R   +   + +  KKT    +  +++ + +N+C +F +L  S  A  IV   N  +
Sbjct:  447 SVQFARSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRVSQPPPG--------SQELVRHFLIEPTKG-GVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDR-----DIVPPVRA---------TTPAQQHLLAHGAATNVLWLYSC-DTESLTGNEAIRKAIRQMYGQQPLPQPTEVHFKVSS-QGITLTDNTRKKFFRKHYKADVISHCAIDPENR---MWTSEGESDKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSFANRTL 710          
BLAST of Tensin 1 vs. Ensembl Fly
Match: CG33993 (gene:FBgn0053993 transcript:FBtr0301034)

HSP 1 Score: 65.0846 bits (157), Expect = 6.111e-11
Identity = 55/180 (30.56%), Postives = 85/180 (47.22%), Query Frame = 3
Query: 2553 SLSPLSSRKFPMQNKVETSS--FSRLNSEISSPPMSYNGQQQ----NLTLQSVEE-KMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKG 3071
            SLS L S    +Q ++  +S  + R     +S P  + G       NL+L   +E K   W+Q  I RE ++  L   +PG FL+R S+T  G + L+++V               S +V HYLI L   +G   KGF +E  F SL  L+ +++    +LP  L LP  P  ++   +G
Sbjct:   63 SLSALESATQRLQVELPAASKKYLRETCSANSSPKLFPGHSALRLDNLSLAEQQELKGAAWFQAGIPREISLEALSRQSPGAFLVRQSSTKPGCFALSLRVPP------------PSPRVAHYLI-LRTQRGYKIKGFTKE--FSSLKALITHHSVMPELLPVPLTLPRPPSTRSQRSQG 227          
BLAST of Tensin 1 vs. Ensembl Fly
Match: CG33993 (gene:FBgn0053993 transcript:FBtr0100046)

HSP 1 Score: 65.855 bits (159), Expect = 1.287e-10
Identity = 55/180 (30.56%), Postives = 85/180 (47.22%), Query Frame = 3
Query: 2553 SLSPLSSRKFPMQNKVETSS--FSRLNSEISSPPMSYNGQQQ----NLTLQSVEE-KMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKG 3071
            SLS L S    +Q ++  +S  + R     +S P  + G       NL+L   +E K   W+Q  I RE ++  L   +PG FL+R S+T  G + L+++V               S +V HYLI L   +G   KGF +E  F SL  L+ +++    +LP  L LP  P  ++   +G
Sbjct:  226 SLSALESATQRLQVELPAASKKYLRETCSANSSPKLFPGHSALRLDNLSLAEQQELKGAAWFQAGIPREISLEALSRQSPGAFLVRQSSTKPGCFALSLRVPP------------PSPRVAHYLI-LRTQRGYKIKGFTKE--FSSLKALITHHSVMPELLPVPLTLPRPPSTRSQRSQG 390          
BLAST of Tensin 1 vs. Ensembl Zebrafish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 202.601 bits (514), Expect = 9.769e-54
Identity = 125/323 (38.70%), Postives = 186/323 (57.59%), Query Frame = 3
Query: 2613 FSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYS--VYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            FS+LN    SP       +  + ++ V++  K+WY+P ISR++AI MLK+ +PG F+IRDS+++ GAYGLA+KVA  P     T K+ D+ +E VRH+LIE S  +GV  KG P EP F  LS LV  ++     LPC LV+P R PL+++     I T  +  + ++   K  + +KS   G++  V Y+   D+E +TGP  I KAI   +    A S T    ++ S +GI LTD +RKLFFRRH+P  ++T+C +DP++RK      K +G    K FG +  K     +N   LF E+DP   A  IV  +++ ++ S
Sbjct:  417 FSKLNMCDGSP-------ETRMNVKFVQDTSKFWYKPDISRDQAINMLKDQDPGAFVIRDSHSFRGAYGLAMKVASPPPTTQPTKKAGDVTNELVRHFLIETS-PKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRDPLEESPE---IATPTNPAADML---KQGAGQKSSADGHACNVLYINSVDMESLTGPQAIAKAISETMNASPAPSATIVHFKV-SAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERKWN----KPEG-GTAKFFGFVARKQGSTTDNVSHLFAEMDPDQPATAIVNFVSKVMISS 719          
BLAST of Tensin 1 vs. Ensembl Zebrafish
Match: tns3.2 (tensin 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-081031-95])

HSP 1 Score: 202.986 bits (515), Expect = 3.833e-53
Identity = 123/337 (36.50%), Postives = 189/337 (56.08%), Query Frame = 3
Query: 2580 FPMQNKVETSSFSRLNSEIS-SPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV---TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTEN 3572
            FP+     ++S++  N+  S S P       +   ++ V++  K+WY+P ISRE+AI++LK+  PG+F+IRDS+++ GAYGLA+KVA  P  V   + K  DL +E VRH+LIE +  +GV  KG P EP F SL+ LV  ++     LPC L++P R PL++ +      +  S+  ++      N           V++LG  D+E +TG   + KA           + T    ++ S +GI LTD +RKLFFRRH+  S++ +CALDP+DRK + + C +      KIFG I  K+  + EN C LF E DP   A  IV  +++ ++ S +N
Sbjct:  537 FPLSRSTVSTSYASHNTSPSRSTPSPDFMASKPENVKFVQDTSKFWYKPDISREQAISVLKDKEPGSFIIRDSHSFRGAYGLAMKVATPPPTVLQTSRKVGDLSNELVRHFLIECT-PKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLIIPSRDPLEEFNESPTQTSTNSAAELLKQGAACN-----------VWFLGSVDLESLTGVQGVQKATTVTFNKDPPPTSTVVHFKV-SAQGITLTDNQRKLFFRRHYAVSTVIFCALDPQDRKWKRDGCTA-----AKIFGFIARKSGSSTENVCHLFAEHDPEQPASAIVNFVSKVMIGSQKN 855          
BLAST of Tensin 1 vs. Ensembl Zebrafish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 199.134 bits (505), Expect = 5.371e-51
Identity = 124/321 (38.63%), Postives = 182/321 (56.70%), Query Frame = 3
Query: 2613 FSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            FS+LN    SP       +  + ++ V++  K+WY+P ISR++AI MLK+ +PG F+IRDS+++ GAYGLA+KVA  P     T K+ D+ +E VRH+LIE S  +GV  KG P EP F  LS LV  ++     LPC LV+P R PL+++     I T         ++P  + LK+      +V Y+   D+E +TGP  I KAI   +    A S T    ++ S +GI LTD +RKLFFRRH+P  ++T+C +DP++RK      K +G    K FG +  K     +N   LF E+DP   A  IV  +++ ++ S
Sbjct: 1411 FSKLNMCDGSP-------ETRMNVKFVQDTSKFWYKPDISRDQAINMLKDQDPGAFVIRDSHSFRGAYGLAMKVASPPPTTQPTKKAGDVTNELVRHFLIETS-PKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRDPLEESPE---IAT--------PTNPAADMLKQG--AACNVLYINSVDMESLTGPQAIAKAISETMNASPAPSATIVHFKV-SAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERKWN----KPEG-GTAKFFGFVARKQGSTTDNVSHLFAEMDPDQPATAIVNFVSKVMISS 1704          

HSP 2 Score: 64.6994 bits (156), Expect = 9.566e-10
Identity = 52/243 (21.40%), Postives = 109/243 (44.86%), Query Frame = 3
Query:  528 MYCLTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            ++ L+E   D  KL    ++F       P L  I   C+++  W+   + N  +I  +G      +++ AY  + +     D     AL  F  K   E + +P+       Y+  +S +    ++     ++L+ +I++  P  E  S    + F K Y  + +  V+T+ +Y++Q      + +     + L+ D ++ CYH+   +  R  +FR+ FHTC A+ D+ + F   + ++ ++
Sbjct:  109 LFNLSEKRLDISKLNPKVLDFGWPDHHAPALDKICSICKAMDTWMNAGSHNVVVIHNKGNRGRTGVVVAAYMHYSNISASAD----QALDRFAMKRFYEDKVLPVGQPSQRRYVQYFSGLLSGHIKINNKPLFLHHVIMHGIPNFE--SKGGCRPFLKIY--QAMQPVYTSGIYNVQGDSQTSICITIEPGLLLKGDILLKCYHKRFRSPCRDVIFRVQFHTC-AVHDLGIVFGKDELDETFK 342          
BLAST of Tensin 1 vs. Ensembl Zebrafish
Match: tns1a (tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32])

HSP 1 Score: 191.045 bits (484), Expect = 1.692e-48
Identity = 116/297 (39.06%), Postives = 168/297 (56.57%), Query Frame = 3
Query: 2676 LTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQIL 3557
            + ++ V++  KYWY+P I+RE+AI +LK+  PG F+IRDSN++ GAYGLA+KVA  P  V    K  D+ +E VRH+LIE S  +GV  KG P EP F  LS LV  +      LPC L++P R  D  +    + T  SS   ++           D    +V Y+   D+E +TGP  + KAI   L      + T  Q ++ S +GI LTD +RK+FFRRH+P + ITYC +DP++RK      K++G    K+FG +  K     +N   LF EL+P + A  IV  +++ +L
Sbjct: 1386 INIKFVQDTSKYWYKPEITREQAICILKDREPGAFVIRDSNSFRGAYGLAMKVASPPPTVQQNKKVGDITNELVRHFLIETSA-KGVRLKGCPNEPYFGCLSALVYQHAITPLALPCKLMIPTR--DPNEEALELATPTSSTMDLLKQGAGPPKPTEDFYACNVLYINSVDMESLTGPQAVAKAITETLAAKSTPTATIVQFKV-STQGITLTDNQRKVFFRRHYPINLITYCNMDPQERKWN----KAEG-GVAKLFGFVARKQGSTTDNVSHLFAELEPDNSASAIVSFVSKLML 1673          

HSP 2 Score: 63.929 bits (154), Expect = 1.610e-9
Identity = 74/346 (21.39%), Postives = 138/346 (39.88%), Query Frame = 3
Query:  237 NVCQNQNKSTEN---EIKRLTSYQCSLCKMDHEKKKYDASFSLSVNQPSFPDEKSKLYTIFENIFVICCPEAEIRHKVQHEIIYSALLK-ITQCFKNAKIKMYC---LTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQ 1247
            N  QNQ  ST++   ++KR  S + SL +   E  + D                  L  I E I  +  P     +K      YS  L+ +T   ++   + Y    L+E   D  K     ++F       P L  I   C+++  WL     N  ++  +G      +++ AY  + +     D     AL  F  K   E + +P+       Y+  ++ +    ++     ++L+ +I++  P  E  S    + F K Y  + +  V+T+ +Y+++      + +     + L+ D ++ CYH+      R  +FR+ FHTC      L F   D +D ++
Sbjct:   95 NPNQNQQASTKSPNMDLKRRPSRRLSLMQTLEENNEVD------------------LLYITERIIALSFPGGTEENK------YSVHLREVTSMLRSKHQQHYLMLNLSERRHDITKQNPRVLDFGWPDHHAPALDKICSICKAMDTWLNADPHNVVVLHNKGNWGRTGVVVGAYMHYSNISASAD----QALDRFAMKRFYEDKAMPVGQPSQRRYVQYFAGLLSGHIKINNKPLFLHHVIMHGIPNFE--SIGGCRPFLKIY--QAMQPVYTSGIYNVKGDSHTSICITIEPGLLLKGDILLKCYHKRYQNPSRDVIFRVQFHTCALHNLALVFTKNDLDDTFK 408          
BLAST of Tensin 1 vs. Ensembl Zebrafish
Match: tns1a (tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32])

HSP 1 Score: 191.045 bits (484), Expect = 1.992e-48
Identity = 116/297 (39.06%), Postives = 168/297 (56.57%), Query Frame = 3
Query: 2676 LTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQIL 3557
            + ++ V++  KYWY+P I+RE+AI +LK+  PG F+IRDSN++ GAYGLA+KVA  P  V    K  D+ +E VRH+LIE S  +GV  KG P EP F  LS LV  +      LPC L++P R  D  +    + T  SS   ++           D    +V Y+   D+E +TGP  + KAI   L      + T  Q ++ S +GI LTD +RK+FFRRH+P + ITYC +DP++RK      K++G    K+FG +  K     +N   LF EL+P + A  IV  +++ +L
Sbjct: 1360 INIKFVQDTSKYWYKPEITREQAICILKDREPGAFVIRDSNSFRGAYGLAMKVASPPPTVQQNKKVGDITNELVRHFLIETSA-KGVRLKGCPNEPYFGCLSALVYQHAITPLALPCKLMIPTR--DPNEEALELATPTSSTMDLLKQGAGPPKPTEDFYACNVLYINSVDMESLTGPQAVAKAITETLAAKSTPTATIVQFKV-STQGITLTDNQRKVFFRRHYPINLITYCNMDPQERKWN----KAEG-GVAKLFGFVARKQGSTTDNVSHLFAELEPDNSASAIVSFVSKLML 1647          

HSP 2 Score: 63.929 bits (154), Expect = 1.605e-9
Identity = 74/346 (21.39%), Postives = 138/346 (39.88%), Query Frame = 3
Query:  237 NVCQNQNKSTEN---EIKRLTSYQCSLCKMDHEKKKYDASFSLSVNQPSFPDEKSKLYTIFENIFVICCPEAEIRHKVQHEIIYSALLK-ITQCFKNAKIKMYC---LTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQ 1247
            N  QNQ  ST++   ++KR  S + SL +   E  + D                  L  I E I  +  P     +K      YS  L+ +T   ++   + Y    L+E   D  K     ++F       P L  I   C+++  WL     N  ++  +G      +++ AY  + +     D     AL  F  K   E + +P+       Y+  ++ +    ++     ++L+ +I++  P  E  S    + F K Y  + +  V+T+ +Y+++      + +     + L+ D ++ CYH+      R  +FR+ FHTC      L F   D +D ++
Sbjct:   95 NPNQNQQASTKSPNMDLKRRPSRRLSLMQTLEENNEVD------------------LLYITERIIALSFPGGTEENK------YSVHLREVTSMLRSKHQQHYLMLNLSERRHDITKQNPRVLDFGWPDHHAPALDKICSICKAMDTWLNADPHNVVVLHNKGNWGRTGVVVGAYMHYSNISASAD----QALDRFAMKRFYEDKAMPVGQPSQRRYVQYFAGLLSGHIKINNKPLFLHHVIMHGIPNFE--SIGGCRPFLKIY--QAMQPVYTSGIYNVKGDSHTSICITIEPGLLLKGDILLKCYHKRYQNPSRDVIFRVQFHTCALHNLALVFTKNDLDDTFK 408          
BLAST of Tensin 1 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 197.593 bits (501), Expect = 1.501e-50
Identity = 116/321 (36.14%), Postives = 182/321 (56.70%), Query Frame = 3
Query: 2613 FSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV---TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            FS++ SE    P+S N   +++T++ V++  K+WY+P ISR++AIA+LK+  PG+F++RDS+++ GAYGLA+KVA  P +V   + K  DL +E VRH+LIE   ++GV  KG P EP F SL+ LV  ++     LPC L++PD+ PL++           S+  ++      N           V+YL   ++E +TG   + KA+            T    ++ S +GI LTD +RKLFFRRH+P +++ +CALDP+DRK       ++     K+FG + +      N C LF E DP   A  IV  +++ ++ S
Sbjct:  934 FSQVLSEF---PVSENSSDKHMTVKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECV-HKGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLEEIPAATPQSAANSAAELLKQGAACN-----------VWYLNSVEMESLTGYQAVQKALSITQLQEPPPISTVVHFKV-SAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKW------TRDGLSAKVFGFVARKGAGNHNICHLFAEHDPEQPASAIVNFVSKVMIGS 1232          

HSP 2 Score: 66.6254 bits (161), Expect = 3.220e-10
Identity = 71/277 (25.63%), Postives = 125/277 (45.13%), Query Frame = 3
Query:  591 YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLST-ALKIFITKNIKELEKIPISYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISL-QNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFE--DVYQACPMKMKLDLYFRETAVFGQGESDLFVETSHSDLSSIERTDSYTFLENDENSN 1406
            + D   PP L  +   C+++  WL     +  +I C+G    I ++I +Y  F +     D  L   A+K FI   +  L  +  S KRY ++++ L S + ++  +   ++L+ +IL+  P    DS    Q F K Y    +  V+T+ +Y L    ++  I  +  P  L + D M+ CYH S +   R  +FRL FHT       + F  +D +  ++    P   +++L F        G+ ++ V   ++    + R DSY      EN+N
Sbjct:   77 WPDFHAPP-LDKMCTICKAMESWLNSDPLHVVVIHCRGERGRIGVVISSYMHFTNISASADQALDRFAMKKFIDDKVSVL--LQPSQKRYVNFLNELLSGLEKMNVM--PLFLHSVILHGIPNF--DSADRCQFFLKIYIA--MQPVYTSGIY-LVGPENQGKIYIEIEPAQLIKGDIMLKCYHPSVT---RDLVFRLQFHTGAIHSHRVIFCKEDLDHANIDDRFPEYGRIELVFSGGPEKNPGKQNIGVTIDYNTSDPLIRWDSY------ENTN 334          
BLAST of Tensin 1 vs. Ensembl Xenopus
Match: adamts12 (ADAM metallopeptidase with thrombospondin type 1 motif 12 [Source:Xenbase;Acc:XB-GENE-959575])

HSP 1 Score: 194.512 bits (493), Expect = 1.441e-49
Identity = 124/317 (39.12%), Postives = 176/317 (55.52%), Query Frame = 3
Query: 2613 FSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQI 3554
            FS+ +   SSP    N       ++ V++  KYWY+P ISR++AI++LK+ +PG F+IRDS+++ GAYGLA+KVA  P N     K  D+ +E VRH+LIE S  +GV  KG   EP F  LS LV  ++     LPC LV+P R  D +D  K      +S S        + LK+      +V ++   D+E +TGP  I K I   L      +      ++ S +GI LTD +RKLFFRRH+P SS+T+C LDP++RK      K+ G  + K+FG +  K     +N C LF ELDP+  A  IV  ++  I
Sbjct: 1004 FSKFSMPDSSPETRAN-------VKFVQDTSKYWYKPDISRDQAISLLKDKDPGAFIIRDSHSFRGAYGLAMKVATPPPNAGQPSKKGDVTNELVRHFLIETS-PRGVKLKGCQNEPYFGCLSALVYQHSITPLALPCKLVIPCR--DPSDETKETAVPANSAS--------DLLKQG--AACNVLFINSIDMESLTGPQAIAKTIAESLAADPPPAAAIVHFKV-SAQGITLTDNQRKLFFRRHYPLSSVTFCDLDPQERKW----MKADGT-QAKLFGFVARKQGSTTDNMCHLFAELDPNQPATAIVNFVSRVI 1294          
BLAST of Tensin 1 vs. Ensembl Xenopus
Match: adamts12 (ADAM metallopeptidase with thrombospondin type 1 motif 12 [Source:Xenbase;Acc:XB-GENE-959575])

HSP 1 Score: 193.356 bits (490), Expect = 4.636e-49
Identity = 124/317 (39.12%), Postives = 176/317 (55.52%), Query Frame = 3
Query: 2613 FSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQI 3554
            FS+ +   SSP    N       ++ V++  KYWY+P ISR++AI++LK+ +PG F+IRDS+++ GAYGLA+KVA  P N     K  D+ +E VRH+LIE S  +GV  KG   EP F  LS LV  ++     LPC LV+P R  D +D  K      +S S        + LK+      +V ++   D+E +TGP  I K I   L      +      ++ S +GI LTD +RKLFFRRH+P SS+T+C LDP++RK      K+ G  + K+FG +  K     +N C LF ELDP+  A  IV  ++  I
Sbjct: 1334 FSKFSMPDSSPETRAN-------VKFVQDTSKYWYKPDISRDQAISLLKDKDPGAFIIRDSHSFRGAYGLAMKVATPPPNAGQPSKKGDVTNELVRHFLIETS-PRGVKLKGCQNEPYFGCLSALVYQHSITPLALPCKLVIPCR--DPSDETKETAVPANSAS--------DLLKQG--AACNVLFINSIDMESLTGPQAIAKTIAESLAADPPPAAAIVHFKV-SAQGITLTDNQRKLFFRRHYPLSSVTFCDLDPQERKW----MKADGT-QAKLFGFVARKQGSTTDNMCHLFAELDPNQPATAIVNFVSRVI 1624          

HSP 2 Score: 60.4622 bits (145), Expect = 2.662e-8
Identity = 66/276 (23.91%), Postives = 125/276 (45.29%), Query Frame = 3
Query:  528 MYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALIC--CQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPI---SYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVY--QACPMKMKLDLYFRETAVFGQGESDLF 1325
            ++ L+E   D  KL    ++F + DL  P  L+ +   C+++  WL     N  +I    +        +I+ ++ +             AL  F  +   E + +P+   S KRY +Y S L S   ++ S    ++L+ +I++  P  E  S    + F K Y  + +  V+T+ +Y++Q      + +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D ++ +  +  P   K++  F       QG+  LF
Sbjct:   57 IFNLSERRHDISKLHSKVLDFGWPDLHAP-ALEKVCSICKAMDTWLNADPHNVVVIHNKVRDLKGKFTFLIFPFNVYC---------ADQALDRFAMRRFYEDKVLPVAQPSQKRYINYFSGLLSGAMKMNS--KPLFLHHVIMHGIPNFE--SKGGCRPFLKIY--QAMQPVYTSGIYNVQGDSQTSICITIEPGLLLKGDILLKCYHKKFRSPTRDVIFRVQFHTC-AIHDLGIVFGKEDLDEAFKDERFPEYGKVEFVFSYGPEKIQGQIFLF 315          
BLAST of Tensin 1 vs. Ensembl Xenopus
Match: adamts12 (ADAM metallopeptidase with thrombospondin type 1 motif 12 [Source:Xenbase;Acc:XB-GENE-959575])

HSP 1 Score: 193.356 bits (490), Expect = 5.531e-49
Identity = 124/317 (39.12%), Postives = 176/317 (55.52%), Query Frame = 3
Query: 2613 FSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQI 3554
            FS+ +   SSP    N       ++ V++  KYWY+P ISR++AI++LK+ +PG F+IRDS+++ GAYGLA+KVA  P N     K  D+ +E VRH+LIE S  +GV  KG   EP F  LS LV  ++     LPC LV+P R  D +D  K      +S S        + LK+      +V ++   D+E +TGP  I K I   L      +      ++ S +GI LTD +RKLFFRRH+P SS+T+C LDP++RK      K+ G  + K+FG +  K     +N C LF ELDP+  A  IV  ++  I
Sbjct: 1355 FSKFSMPDSSPETRAN-------VKFVQDTSKYWYKPDISRDQAISLLKDKDPGAFIIRDSHSFRGAYGLAMKVATPPPNAGQPSKKGDVTNELVRHFLIETS-PRGVKLKGCQNEPYFGCLSALVYQHSITPLALPCKLVIPCR--DPSDETKETAVPANSAS--------DLLKQG--AACNVLFINSIDMESLTGPQAIAKTIAESLAADPPPAAAIVHFKV-SAQGITLTDNQRKLFFRRHYPLSSVTFCDLDPQERKW----MKADGT-QAKLFGFVARKQGSTTDNMCHLFAELDPNQPATAIVNFVSRVI 1645          

HSP 2 Score: 59.6918 bits (143), Expect = 3.708e-8
Identity = 59/248 (23.79%), Postives = 115/248 (46.37%), Query Frame = 3
Query:  528 MYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALIC--CQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPI---SYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            ++ L+E   D  KL    ++F + DL  P  L+ +   C+++  WL     N  +I    +        +I+ ++ +             AL  F  +   E + +P+   S KRY +Y S L S   ++ S    ++L+ +I++  P  E  S    + F K Y  + +  V+T+ +Y++Q      + +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D ++ ++
Sbjct:   51 IFNLSERRHDISKLHSKVLDFGWPDLHAP-ALEKVCSICKAMDTWLNADPHNVVVIHNKVRDLKGKFTFLIFPFNVYC---------ADQALDRFAMRRFYEDKVLPVAQPSQKRYINYFSGLLSGAMKMNS--KPLFLHHVIMHGIPNFE--SKGGCRPFLKIY--QAMQPVYTSGIYNVQGDSQTSICITIEPGLLLKGDILLKCYHKKFRSPTRDVIFRVQFHTC-AIHDLGIVFGKEDLDEAFK 281          
BLAST of Tensin 1 vs. Ensembl Xenopus
Match: adamts12 (ADAM metallopeptidase with thrombospondin type 1 motif 12 [Source:Xenbase;Acc:XB-GENE-959575])

HSP 1 Score: 192.586 bits (488), Expect = 6.590e-49
Identity = 124/317 (39.12%), Postives = 176/317 (55.52%), Query Frame = 3
Query: 2613 FSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQI 3554
            FS+ +   SSP    N       ++ V++  KYWY+P ISR++AI++LK+ +PG F+IRDS+++ GAYGLA+KVA  P N     K  D+ +E VRH+LIE S  +GV  KG   EP F  LS LV  ++     LPC LV+P R  D +D  K      +S S        + LK+      +V ++   D+E +TGP  I K I   L      +      ++ S +GI LTD +RKLFFRRH+P SS+T+C LDP++RK      K+ G  + K+FG +  K     +N C LF ELDP+  A  IV  ++  I
Sbjct: 1046 FSKFSMPDSSPETRAN-------VKFVQDTSKYWYKPDISRDQAISLLKDKDPGAFIIRDSHSFRGAYGLAMKVATPPPNAGQPSKKGDVTNELVRHFLIETS-PRGVKLKGCQNEPYFGCLSALVYQHSITPLALPCKLVIPCR--DPSDETKETAVPANSAS--------DLLKQG--AACNVLFINSIDMESLTGPQAIAKTIAESLAADPPPAAAIVHFKV-SAQGITLTDNQRKLFFRRHYPLSSVTFCDLDPQERKW----MKADGT-QAKLFGFVARKQGSTTDNMCHLFAELDPNQPATAIVNFVSRVI 1336          

HSP 2 Score: 60.077 bits (144), Expect = 3.358e-8
Identity = 60/251 (23.90%), Postives = 114/251 (45.42%), Query Frame = 3
Query:  528 MYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALIC-----CQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPI---SYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            ++ L+E   D  KL    ++F + DL  P  L+ +   C+++  WL     N  +I       +G  + ++     Y                AL  F  +   E + +P+   S KRY +Y S L S   ++ S    ++L+ +I++  P  E  S    + F K Y  + +  V+T+ +Y++Q      + +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D ++ ++
Sbjct:   51 IFNLSERRHDISKLHSKVLDFGWPDLHAP-ALEKVCSICKAMDTWLNADPHNVVVIHNKVRDLKGKFTFLIFPFNVYCA------------DQALDRFAMRRFYEDKVLPVAQPSQKRYINYFSGLLSGAMKMNS--KPLFLHHVIMHGIPNFE--SKGGCRPFLKIY--QAMQPVYTSGIYNVQGDSQTSICITIEPGLLLKGDILLKCYHKKFRSPTRDVIFRVQFHTC-AIHDLGIVFGKEDLDEAFK 281          
BLAST of Tensin 1 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 215.312 bits (547), Expect = 1.242e-58
Identity = 126/332 (37.95%), Postives = 187/332 (56.33%), Query Frame = 3
Query: 2586 MQNKVETSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVT--VKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            M +   T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +T   K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct:  310 MASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTT-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLSAGQ 622          
BLAST of Tensin 1 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 214.542 bits (545), Expect = 1.066e-55
Identity = 126/332 (37.95%), Postives = 187/332 (56.33%), Query Frame = 3
Query: 2586 MQNKVETSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            M +   T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +T   K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct: 1405 MASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTT-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLSAGQ 1717          

HSP 2 Score: 70.0922 bits (170), Expect = 1.987e-11
Identity = 67/291 (23.02%), Postives = 126/291 (43.30%), Query Frame = 3
Query:  396 LYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFK---NAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            L  + E I  +  P          E   S L ++ Q  K        ++ L+E  PD  KL    + F + DL  P  L+ I   C+++  WL     N  ++  +G    I ++I AY  + +     D     AL  F  K   E + +PI       Y+  +S +    ++     ++L+ +I++  P  E  S    + F + Y  + +  V+T+ +Y++       + +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D ++ ++
Sbjct:   17 LVYVTERIIAVSFPST-----ANEENFRSNLREVAQMLKSKHGGNYLLFNLSEQRPDITKLHAKVLEFGWPDLHTP-ALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYLHYSNISASAD----QALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFE--SKGGCRPFLRIY--QAMQPVYTSGIYNIPGDSQASICITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTC-AIHDLGVVFGKEDLDEAFK 292          
BLAST of Tensin 1 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 213.772 bits (543), Expect = 1.596e-55
Identity = 125/331 (37.76%), Postives = 187/331 (56.50%), Query Frame = 3
Query: 2586 MQNKVETSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKS-DDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            M +   T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +T +   D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct: 1392 MASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTT-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLSAGQ 1703          

HSP 2 Score: 70.0922 bits (170), Expect = 2.105e-11
Identity = 67/291 (23.02%), Postives = 126/291 (43.30%), Query Frame = 3
Query:  396 LYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFK---NAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            L  + E I  +  P          E   S L ++ Q  K        ++ L+E  PD  KL    + F + DL  P  L+ I   C+++  WL     N  ++  +G    I ++I AY  + +     D     AL  F  K   E + +PI       Y+  +S +    ++     ++L+ +I++  P  E  S    + F + Y  + +  V+T+ +Y++       + +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D ++ ++
Sbjct:   17 LVYVTERIIAVSFPST-----ANEENFRSNLREVAQMLKSKHGGNYLLFNLSEQRPDITKLHAKVLEFGWPDLHTP-ALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYLHYSNISASAD----QALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFE--SKGGCRPFLRIY--QAMQPVYTSGIYNIPGDSQASICITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTC-AIHDLGVVFGKEDLDEAFK 292          
BLAST of Tensin 1 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 213.772 bits (543), Expect = 1.857e-55
Identity = 126/332 (37.95%), Postives = 187/332 (56.33%), Query Frame = 3
Query: 2586 MQNKVETSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            M +   T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +T   K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct: 1509 MASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTT-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLSAGQ 1821          

HSP 2 Score: 70.0922 bits (170), Expect = 2.097e-11
Identity = 67/291 (23.02%), Postives = 126/291 (43.30%), Query Frame = 3
Query:  396 LYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFK---NAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            L  + E I  +  P          E   S L ++ Q  K        ++ L+E  PD  KL    + F + DL  P  L+ I   C+++  WL     N  ++  +G    I ++I AY  + +     D     AL  F  K   E + +PI       Y+  +S +    ++     ++L+ +I++  P  E  S    + F + Y  + +  V+T+ +Y++       + +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D ++ ++
Sbjct:  142 LVYVTERIIAVSFPST-----ANEENFRSNLREVAQMLKSKHGGNYLLFNLSEQRPDITKLHAKVLEFGWPDLHTP-ALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYLHYSNISASAD----QALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFE--SKGGCRPFLRIY--QAMQPVYTSGIYNIPGDSQASICITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTC-AIHDLGVVFGKEDLDEAFK 417          
BLAST of Tensin 1 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 202.601 bits (514), Expect = 6.191e-52
Identity = 126/332 (37.95%), Postives = 187/332 (56.33%), Query Frame = 3
Query: 2586 MQNKVETSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            M +   T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +T   K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct: 1566 MASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTT-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLSAGQ 1878          

HSP 2 Score: 67.781 bits (164), Expect = 1.150e-10
Identity = 72/293 (24.57%), Postives = 130/293 (44.37%), Query Frame = 3
Query:  396 LYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKN---AKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPI---SYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            L  + E I  +  P          E   S L ++ Q  K+       ++ L+E  PD  KL    + F + DL  P  L+ I   C+++  WL     N  ++  +G    I ++I AY  + +     D     AL  F  K   E + +PI   S +RY  Y S L S    ++     ++L+ +I++  P  E  S    + F + Y  + +  V+T+ +Y++       + +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D ++ ++
Sbjct:  186 LVYVTERIIAVSFPST-----ANEENFRSNLREVAQMLKSKHGGNYLLFNLSEQRPDITKLHAKVLEFGWPDLHTP-ALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYLHYSNISASAD----QALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLS--GSIKMNNKPLFLHHVIMHGIPNFE--SKGGCRPFLRIY--QAMQPVYTSGIYNIPGDSQASICITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTC-AIHDLGVVFGKEDLDEAFK 461          
BLAST of Tensin 1 vs. UniProt/SwissProt
Match: sp|Q9GLM4|TENS1_BOVIN (Tensin-1 OS=Bos taurus OX=9913 GN=TNS1 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 3.579e-55
Identity = 127/326 (38.96%), Postives = 187/326 (57.36%), Query Frame = 3
Query: 2604 TSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +    K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P+R P D++ +  G     S           + LK+      +V ++   D+E +TGP  I+KAI   L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K   A +N C LF ELDP+  A  IV  +++ +L + +
Sbjct: 1407 TVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTS-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKAISETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----TKTEGGAPAKLFGFVARKQGSATDNACHLFAELDPNQPASAIVSFVSKVMLSAGQ 1713          

HSP 2 Score: 74.3294 bits (181), Expect = 7.934e-12
Identity = 69/291 (23.71%), Postives = 127/291 (43.64%), Query Frame = 3
Query:  396 LYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFK---NAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            L  + E I  +  P          E   S L ++ Q  K        ++ L+E  PD  KL    + F + DL  P  L+ I   C+++  WL     N  ++  +G    I ++I AY  + +     D     AL  F  K   E + +PI       Y+  +S +    ++     ++L+ +I++  P  E  S    + F + Y  + +  V+T+ +Y++Q      + +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D +D ++
Sbjct:   15 LVYVTERIIAVSFPST-----ANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTP-ALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASAD----HALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFE--SKGGCRPFLRIY--QAMQPVYTSGIYNVQGDSQTSICITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTC-AIHDLGVVFGKEDLDDAFK 290          
BLAST of Tensin 1 vs. UniProt/SwissProt
Match: sp|Q9HBL0|TENS1_HUMAN (Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2)

HSP 1 Score: 211.075 bits (536), Expect = 8.020e-54
Identity = 124/326 (38.04%), Postives = 185/326 (56.75%), Query Frame = 3
Query: 2604 TSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +    K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P+R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct: 1427 TVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTA-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQ 1733          

HSP 2 Score: 73.1738 bits (178), Expect = 1.759e-11
Identity = 69/291 (23.71%), Postives = 126/291 (43.30%), Query Frame = 3
Query:  396 LYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFK---NAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            L  + E I  +  P          E   S L ++ Q  K        ++ L+E  PD  KL    + F + DL  P  L+ I   C+++  WL     N  ++  +G    I ++I AY  + +     D     AL  F  K   E + +PI       Y+  +S +    ++     ++L+ +I++  P  E  S    + F + Y  + +  V+T+ +Y++       V +     + L+ D ++ CYH+   +  R  +FR+ FHTC AI D+ + F  +D +D ++
Sbjct:   15 LVYVTERIIAVSFPST-----ANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTP-ALEKICSICKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASAD----QALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFE--SKGGCRPFLRIY--QAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTC-AIHDLGVVFGKEDLDDAFK 290          
BLAST of Tensin 1 vs. UniProt/SwissProt
Match: sp|Q04205|TENS_CHICK (Tensin OS=Gallus gallus OX=9031 GN=TNS PE=1 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 1.373e-50
Identity = 117/297 (39.39%), Postives = 170/297 (57.24%), Query Frame = 3
Query: 2691 VEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KVA  P  V    K  D+ +E VRH+LIE S  +GV  KG P EP F  LS LV  ++     LPC LV+PDR P+++  +        +           + LK+      +V ++   ++E +TGP  I+KA+   L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K+ G    K+FG +  K     +N C LF ELDP   A  IV  ++  +L S +
Sbjct: 1465 VQDTSKYWYKPDISREQAIALLKDREPGAFIIRDSHSFRGAYGLAMKVASPPPTVMQQNKKGDITNELVRHFLIETS-PRGVKLKGCPNEPNFGCLSALVYQHSIMPLALPCKLVIPDRDPMEEKKDAASTTNSAT-----------DLLKQG--AACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----TKTDGSGPAKLFGFVARKQGSTTDNVCHLFAELDPDQPAAAIVNFVSRVMLGSGQ 1742          

HSP 2 Score: 72.0182 bits (175), Expect = 4.133e-11
Identity = 90/384 (23.44%), Postives = 165/384 (42.97%), Query Frame = 3
Query:  396 LYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKNAKIKMYCL---TEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPI---SYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVY--QACPMKMKLDLYFRETAVFGQG----ESDLFVETSHSDLSSIERTDSYTFLENDENSNKMGSTIIIQRKADIQNQTIENKVPCDNGQRDI 1502
            L  I E I  +  P        + +   S L ++    K+     Y L   +E   D  KL    ++F + DL  P  L+ I   C+++  WL  A  N  ++  +G    + +++ AY  + +     D     AL  F  K   E + +P+   S KRY  Y S L S   ++ +    ++L+ +I++  P  E  S    + F K Y  + +  V+T+ +Y++Q      + +     + L+ D ++ CYH+   +  R  +FR+ FHTC A+ D+ + F  +D ++ +  +  P   K++  F       QG    E+   V   ++    + R DSY      EN N       IQR+   +    E  +P  + ++++
Sbjct:   69 LVYITERIIAVSYPST-----AEEQSFRSNLREVAHMLKSKHGDNYVLFNLSERRHDISKLHPKVLDFGWPDLHTP-ALEKICSICKAMDTWLNAAAHNVVVLHNKGNRGRLGVVVAAYMHYSNISASAD----QALDRFAMKRFYEDKVVPVGQPSQKRYIHYFSGLLSGSIKMNN--KPLFLHHVIMHGIPNFE--SKGGCRPFLKIY--QAMQPVYTSGIYNVQGDSQTGICITIEPGLLLKGDILLKCYHKKFRSPTRDVIFRVQFHTC-AVHDLDIVFGKEDLDEAFRDERFPEYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSY------ENFN-------IQREDSAEGTWAEPALPGKHLEKEV 422          
BLAST of Tensin 1 vs. UniProt/SwissProt
Match: sp|Q8CGB6|TNS2_MOUSE (Tensin-2 OS=Mus musculus OX=10090 GN=Tns2 PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 4.444e-48
Identity = 120/327 (36.70%), Postives = 184/327 (56.27%), Query Frame = 3
Query: 2583 PMQNKVETSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQIL 3557
            P ++  +  +F+    +++ PP  +  Q+    ++ V++  K+WY+PH+SR++AIA+LK+ +PG FLIRDS+++ GAYGLA+KVA  P +      D   + VRH+LIE +G +GV  KG P EP F SLS LV  ++ +   LPC L +P + PL++T     + T++S+ +        + L++      SV YL   + E +TGP  + KA    L             ++ S +GI LTD +RKLFFRRH+P +SIT+ + DP+DR+       +     +KIFG +  K     EN C LF ELDP   A  IV  I + +L
Sbjct: 1089 PARSTNQHVTFASPLPDVTQPP-EHPLQENQSNVKFVQDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPSEQLVRHFLIE-TGPKGVKIKGCPTEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEETPEAP-VPTNMSTAA--------DLLRQG--AACSVLYLTSVETESLTGPQAVAKASSAALSCSPVPVPAIVHFKV-SAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRW-----TNPDGATSKIFGFVAKKPGSPWENVCHLFAELDPDQPASAIVTFITKVLL 1396          

HSP 2 Score: 78.5666 bits (192), Expect = 3.872e-13
Identity = 75/316 (23.73%), Postives = 143/316 (45.25%), Query Frame = 3
Query:  486 LLKITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLST-ALKIFITKNIK-ELEKIPISYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVY--QACPMKMKLDLYFRETAVFGQGES---DLFVETSHSDLSSIERTDSY-TFLENDENS 1403
            L  + Q     K  ++ L+E   D  +L     +F + +L  PP L  +   C+++  WL+   ++  ++ C+G    + +++ AY  +       D  L+T  ++ F    +  EL+    S +RY SY S L S   ++ S  S ++L+ + +   P  EP++    Q F K Y +  +  V+T+ +Y +     + + +     + L+ D M+ CYH+    T R  +FR+ FHTC      LTF     ++ +  +  P +  ++  F  +    +G +   D  V   ++      R DSY  F ++ E+S
Sbjct:  161 LAHVLQSKHRDKYLLFNLSEKRHDLTRLNPKVQDFGWPELHAPP-LDKLCSICKAMETWLSADPQHVVVLYCKGSKGKLGVIVSAYMHYSKISAGADQALATLTMRKFCEDKVATELQP---SQRRYVSYFSGLLSGSIRMNS--SPLFLHYVFVPVLPAFEPNT--GFQPFLKIYQS--MQLVYTSGVYRIAGPGPQQLCISLEPALLLKGDVMVTCYHKGGQGTDRTLVFRVQFHTCTIHGSRLTFPKDQLDEAWADERFPFQASVEFVFSSSPEKVKGNTPRNDPSVSVDYNTTEPAVRWDSYENFNQHHEDS 466          
BLAST of Tensin 1 vs. UniProt/SwissProt
Match: sp|Q63HR2|TNS2_HUMAN (Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 1.802e-47
Identity = 115/300 (38.33%), Postives = 173/300 (57.67%), Query Frame = 3
Query: 2664 QQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMA-GENKCFLFGELDPSHKAHLIVKIINEQIL 3557
            Q+    ++ V++  K+WY+PH+SR++AIA+LK+ +PG FLIRDS+++ GAYGLA+KVA  P +      D   + VRH+LIE +G +GV  KG P EP F SLS LV  ++ +   LPC L +P + PL++T     + T++S+ +        + L++      SV YL   + E +TGP  + +A    L      +      ++ S +GI LTD +RKLFFRRH+P +SIT+ + DP+DR+       +     +KIFG + K   +  EN C LF ELDP   A  IV  I + +L
Sbjct: 1124 QESQSNVKFVQDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIE-TGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEETPEAP-VPTNMSTAA--------DLLRQG--AACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKV-SAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRW-----TNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVLL 1405          

HSP 2 Score: 74.3294 bits (181), Expect = 7.001e-12
Identity = 75/316 (23.73%), Postives = 143/316 (45.25%), Query Frame = 3
Query:  486 LLKITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLST-ALKIFITKNIK-ELEKIPISYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVY--QACPMKMKLDLYFRETAVFGQGES---DLFVETSHSDLSSIERTDSY-TFLENDENS 1403
            L  + Q     K  ++ L+E   D  +L     +F + +L  PP L  +   C+++  WL+   ++  ++ C+G    + +++ AY  +       D  L+T  ++ F    +  EL+    S +RY SY S L S   ++ S  S ++L+ +++   P  EP +    Q F K Y +  +  V+T+ +Y +     + + +     + L+ D M+ CYH+    T R  +FR+ FHTC      LTF     ++ +  +  P +  ++  F  +    +G +   D  V   ++      R DSY  F ++ E+S
Sbjct:  161 LAHVLQSKHRDKYLLFNLSEKRHDLTRLNPKVQDFGWPELHAPP-LDKLCSICKAMETWLSADPQHVVVLYCKGNKGKLGVIVSAYMHYSKISAGADQALATLTMRKFCEDKVATELQP---SQRRYISYFSGLLSGSIRMNS--SPLFLHYVLIPMLPAFEPGT--GFQPFLKIYQS--MQLVYTSGVYHIAGPGPQQLCISLEPALLLKGDVMVTCYHKGGRGTDRTLVFRVQFHTCTIHGPQLTFPKDQLDEAWTDERFPFQASVEFVFSSSPEKIKGSTPRNDPSVSVDYNTTEPAVRWDSYENFNQHHEDS 466          
BLAST of Tensin 1 vs. TrEMBL
Match: A0A1I8ID03 (SH2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 8.554e-58
Identity = 152/474 (32.07%), Postives = 226/474 (47.68%), Query Frame = 3
Query: 2301 SAHRENXXXXXXXXEKFIPH----ERISHQNFQDDREST----------DVFEEVETINLQPIGKGIQDLNKGNLQHRIPMGTAKI--ESTSHLFNENIGSLSPLSSRKFPMQNKVETSSFSRLNSEISSP-----------------PMSYNGQQQNLTL------QSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRP----LDQTDN-----GKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKA----------YMAGENKCFLFGELDPSHKAHLIVKIINE 3548
            ++HR +        E  + H    E  +H   Q +R +           +V++EVETI LQPIGKGI DL     +   P G  ++  +ST HL    +     L + K      +     + L S    P                 P  Y  QQ +LT        SV++ MK WY+P ISREEAI +L++  PG F++RDSN++ GA+GLA++VA IP+ +  KS+D+ +E VRH+LIE +   GV  KG   EPIFP+L+ LV  ++     LPC L++P RP     DQ D                      +P             +V Y+G  DVE ++G   + +A++  L +       ECQ+++   +G+ LTD  RKLFFRR++P +S+ YC LD +DR+        +G+K  ++FG + +           +   EN C L  E DP   A  IV  IN+
Sbjct:  198 ASHRASSVSHFRTSETPLVHRTAGEATTHSRHQQERRTLQQRTVTHTPGEVYQEVETITLQPIGKGIHDLEAP--KEATPAGGRRLMAQSTPHLPTATVVG-GGLQTAKQQQAMNISQRRIATLRSSTPQPQSAGGVAMATTAQVHLQPQQY--QQHSLTRGQQIHQMSVKDSMKLWYRPRISREEAINLLRHAQPGTFVVRDSNSFPGAFGLAVRVAQIPKGIQPKSNDIGAELVRHFLIEPTSG-GVRLKGCANEPIFPTLAALVQQHSVTQLALPCRLIVP-RPEAAVYDQPDRVAAQAQATGGAGGCVEQTAAGAPVEVRHPLQSSAACNVLYVGSVDVESLSGGDAVARAVDVALSSQAQLRTAECQLKVGQ-DGVTLTDNHRKLFFRRNYPLASVLYCGLDNQDRRFAHPELSVRGLKSPRLFGFVARKGGAVGGVGGHFGPSENTCVLACEFDPQQPAPAIVSFINK 663          
BLAST of Tensin 1 vs. TrEMBL
Match: A0A0P7Y7F9 (SH2 domain-containing protein OS=Scleropages formosus OX=113540 GN=Z043_120275 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 6.204e-56
Identity = 130/348 (37.36%), Postives = 192/348 (55.17%), Query Frame = 3
Query: 2556 LSPLSSRKFPMQNKVETSSFSRLNSEISSPPMS-------YNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKS---DDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            L PL  ++   Q +    S S   S  SSPP +        +G+Q+N     V++  K+WY+P ISR++AIA+LK   PG+F++RDS+++ GAYGLA+KVA  P  V  +S    DL +E VRH+LIE +  +GV  KG P EP F +L+ LV ++      LPC L++P+R PL++  N        S+  ++      N           V++LG  D+E +TG   + KA    L      + T    ++++ +GI LTD +RKLFFRRH+  S++ +CALDP+DRK   + C S      KIFG +  K+  A EN C LF E DP   A  IV  I++ ++ S
Sbjct:  126 LPPLPEKRRVSQGEQSLGSTSPAPSGFSSPPSAGFIGTPASDGKQENAKF--VQDTSKFWYKPDISRDQAIALLKEKEPGSFIVRDSHSFRGAYGLAMKVAAPPPTVLQQSKRGGDLSNELVRHFLIECT-QKGVRLKGCPNEPYFGNLTALVCHHAITPLALPCKLIIPERDPLEEVGNSSSQTAANSAAELLKQGAACN-----------VWFLGSMDMESLTGYQAVQKATSMTLSMDPPPTSTVVHFKVST-QGITLTDNQRKLFFRRHYAVSTVIFCALDPQDRKWTRDGCSS-----AKIFGFVARKSGSATENVCHLFAEHDPEQPASAIVNFISKVMIGS 453          
BLAST of Tensin 1 vs. TrEMBL
Match: Q6PJM3 (TNS1 protein (Fragment) OS=Homo sapiens OX=9606 GN=TNS1 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 7.920e-56
Identity = 124/326 (38.04%), Postives = 185/326 (56.75%), Query Frame = 3
Query: 2604 TSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +    K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P+R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct:  130 TVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTA-----------DLLKQG--AACNVLFINSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQ 436          
BLAST of Tensin 1 vs. TrEMBL
Match: A1A4J4 (TNS1 protein (Fragment) OS=Bos taurus OX=9913 GN=TNS1 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.240e-55
Identity = 127/326 (38.96%), Postives = 187/326 (57.36%), Query Frame = 3
Query: 2604 TSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV--KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +    K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P+R P D++ +  G     S           + LK+      +V ++   D+E +TGP  I+KAI   L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K   A +N C LF ELDP+  A  IV  +++ +L + +
Sbjct:  322 TVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTS-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKAISETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----TKTEGGAPAKLFGFVARKQGSATDNACHLFAELDPNQPASAIVSFVSKVMLSAGQ 628          
BLAST of Tensin 1 vs. TrEMBL
Match: Q9DBT6 (Tensin 1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.576e-55
Identity = 126/332 (37.95%), Postives = 187/332 (56.33%), Query Frame = 3
Query: 2586 MQNKVETSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVT--VKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTE 3569
            M +   T SFS    + S   M  N  +    ++ V++  KYWY+P ISRE+AIA+LK+  PG F+IRDS+++ GAYGLA+KV+  P  +T   K  D+  E VRH+LIE +G +GV  KG P EP F SLS LV  ++     LPC LV+P R P D++ +  G     +           + LK+      +V ++   D+E +TGP  I+KA    L      + T    ++ S +GI LTD +RKLFFRRH+P +++T+C LDP++RK      K++G    K+FG +  K     +N C LF ELDP+  A  IV  +++ +L + +
Sbjct:  310 MASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIE-TGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTT-----------DLLKQG--AACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLSAGQ 622          
BLAST of Tensin 1 vs. Ensembl Cavefish
Match: ENSAMXT00000049936.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:8188442:8199496:-1 gene:ENSAMXG00000013421.2 transcript:ENSAMXT00000049936.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 1.339e-51
Identity = 116/297 (39.06%), Postives = 170/297 (57.24%), Query Frame = 3
Query: 2676 LTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            L ++ V++  K+WY+P ISRE+AI +LK+  PG F+IRDS+++ GAYGLA+KVA  P  V     D+ +E VRH+LIE S ++GV  KG P EP F  LS LV  ++     LPC L++P R  D  +    + T  SS         ++ LK+      +V Y+   D+E +TGP  + KAI   L      S T    ++ S +GI LTD +RK+FFRRH+P +++TYC +DP++RK      K+ G    K+FG +  K     +N   LF EL+P   A  IV  +++ +L S
Sbjct:  272 LNVKFVQDTSKFWYKPDISREQAITLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTVQQNKKDMTNELVRHFLIETS-SKGVRLKGCPNEPHFGCLSALVYQHSITPLALPCKLMIPTR--DPNEEALELVTPTSSA--------MDLLKQG--AACNVLYINSVDMESLTGPQAVAKAISETLAANPPLSATVVHFKV-SLQGITLTDNQRKVFFRRHYPINTVTYCNIDPQERKWN----KADG-GLAKLFGFVARKQGSTTDNVSHLFAELEPDQPATAIVNYVSKVMLSS 549          
BLAST of Tensin 1 vs. Ensembl Cavefish
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:103027377])

HSP 1 Score: 196.823 bits (499), Expect = 1.478e-50
Identity = 124/334 (37.13%), Postives = 187/334 (55.99%), Query Frame = 3
Query: 2622 LNSEISSPPMSYNGQQQNLT------------LQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV---TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PL-DQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYS--VYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            LNS +S   +S NG     T             + V++  K+WY+P ISRE+AI +LK+  PG+F++RDS+++ GAYGLA+KVA  P ++   + K  DL +E VRH+LIE +  +GV  KG P EP F SL+ LV  ++     LPC L++P R PL D T++ +   T              NS  +  + G +  V++LG  ++E +TG   I KA   +LG     + T    ++ S +GI LTD +RKLFFRRH+  +++ +CALDP+DR+   + C +      KIFG +  K+  + EN C LF E DP   A  IV  +++ ++ S
Sbjct:  883 LNSSLSRTAVSNNGSPTGSTPSPDPLSGKPDNAKFVQDTSKFWYKPDISREQAITVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSILQQSKKVGDLTNELVRHFLIECT-QKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPSRDPLEDLTESQQQTST--------------NSATELLKQGAACNVWFLGSVELESLTGVQAIQKASTVILGQNPPATSTIVHFKV-SAQGITLTDNQRKLFFRRHYAVNTVIFCALDPQDRRWTKDGCLA-----AKIFGFVARKSGSSTENVCHLFAEHDPEQPASAIVNFVSKVMIGS 1195          

HSP 2 Score: 67.781 bits (164), Expect = 7.111e-11
Identity = 50/210 (23.81%), Postives = 89/210 (42.38%), Query Frame = 3
Query:  612 PKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCM--NQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFE 1235
            P L  +   C+S+ +WL    E+  L+ C+G    I ++I +Y       P        AL  +  K     +  P+       Y+ ++  +  +QL+   S ++ +C+ L+  P + P       LF + Y +    C  TT ++ +    +  V      P  L+ D MI+CYH+  S   R  +FR++FHT         F  +D +
Sbjct:   80 PSLHLLCSICKSIENWLNTQVEHVLLLHCRGGKDRIGVVISSYI----NLPSVSSSEEQALDCYTIKRFYSDKMAPLITPSQKRYVQMFGKLLSHQLKINSSPLFFHCISLHHIPKLHP---TVCHLFVRVYQSMQTVC--TTGVHQIAVGQTDRVYFALEPPQLLKGDIMIVCYHKDVSKGTREPVFRMHFHTGTVHGHPALFRKEDLD 280          
BLAST of Tensin 1 vs. Ensembl Cavefish
Match: tns2b (tensin 2b [Source:ZFIN;Acc:ZDB-GENE-101001-5])

HSP 1 Score: 194.126 bits (492), Expect = 1.369e-49
Identity = 121/334 (36.23%), Postives = 184/334 (55.09%), Query Frame = 3
Query: 2595 KVETSSFSRLNSEISS------PPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVT--VKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR----PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGE-NKCFLFGELDPSHKAHLIVKIINEQIL 3557
            +V+ S  +  N +IS       PP     ++  ++ + V++  K+WY+P ISR++AIA+LK+ +PG FLIRDS ++ GAYGLA+KVA+ P +V   V + + +   VRH+LIE SG +GV  KG   E  F SLS LV +++     LPC L +PD+     L +  +G    T              + LK+      +V YL   D+E +TGP  I+KAI+  L      S T    ++ S +GI LTD +R+LFFRRH+P  S+T+ ++DP+D++       +      K+FG + +   + + N C LF ELDP   A  IV  IN+ +L
Sbjct: 1092 EVQVSILTTANEQISPSRHKRVPPKGVENRESRVSSKFVQDSSKFWYKPGISRDQAIAVLKDKDPGCFLIRDSKSFQGAYGLALKVAIPPSHVINHVNNHNSQEHLVRHFLIE-SGAKGVKIKGCHNETYFGSLSALVYHHSIVPVSLPCTLRIPDKDLVGELQELQSGTNTSTAA------------DLLKQG--AACNVLYLNSVDIESLTGPQAISKAIKSTLNQDPCPSATTVHFKV-STQGITLTDNQRRLFFRRHYPIHSVTFSSVDPQDQRW-----TNADKTSNKMFGFVARRSGSSQGNACHLFAELDPEQPATAIVNFINKVML 1404          

HSP 2 Score: 67.3958 bits (163), Expect = 1.088e-10
Identity = 72/273 (26.37%), Postives = 117/273 (42.86%), Query Frame = 3
Query:  591 YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLST-ALKIFITKNIKELEKIPISYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQAC-----PMKMKLDLYFRETAVFGQGESDLFVETSHS-DLS---SIERTDSY 1376
            + DL  PP L  I   C+++  WL     N  ++ C+G      ++  AY  +       +  L+T A++ F    I     +  S  RY  Y + L S   ++ S  S + L  + + S P  +P    +   F K Y +  L  V+T+  Y+++ S S+ + +     + L+ D M+ CYHR      R  +FR+ FHTC      L F  ++ +   QAC     P    ++L F  +    +G   L  E   S D S    + R DSY
Sbjct:  118 WPDLHAPP-LDKICAVCKAMEAWLNSDPSNVVVLHCKGNKGKTGVITAAYMHYSKISAGAEQALATVAMRKFCEDKISP--SLQPSQSRYIYYFAGLLSGTIKINS--SPLLLQQVHIPSLPNYQPGGGYAP--FLKIYQS--LKLVYTSATYNIEDSRSKTLHISIEPALLLKGDIMVKCYHRRAGLCERECIFRVQFHTCTVHGAQLWFGKRELD---QACTDERYPADATVELVFSTSPQPAKGGDSLQSEPGGSVDFSCTDPVVRWDSY 378          
BLAST of Tensin 1 vs. Ensembl Cavefish
Match: tns2b (tensin 2b [Source:ZFIN;Acc:ZDB-GENE-101001-5])

HSP 1 Score: 191.43 bits (485), Expect = 9.509e-49
Identity = 120/334 (35.93%), Postives = 182/334 (54.49%), Query Frame = 3
Query: 2595 KVETSSFSRLNSEISS------PPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVT--VKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR----PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGE-NKCFLFGELDPSHKAHLIVKIINEQIL 3557
            +V+ S  +  N +IS       PP     ++  ++ + V++  K+WY+P ISR++AIA+LK+ +PG FLIRDS ++ GAYGLA+KVA+ P +V   V + + +   VRH+LIE SG +GV  KG   E  F SLS LV +++     LPC L +PD+     L +  +G    T              + LK+      +V YL   D+E +TGP  I+KAI+  L      S T    ++ S +GI LTD +R+LFFRRH+P  S+T+ ++DP+D+               ++FG + +   + + N C LF ELDP   A  IV  IN+ +L
Sbjct: 1092 EVQVSILTTANEQISPSRHKRVPPKGVENRESRVSSKFVQDSSKFWYKPGISRDQAIAVLKDKDPGCFLIRDSKSFQGAYGLALKVAIPPSHVINHVNNHNSQEHLVRHFLIE-SGAKGVKIKGCHNETYFGSLSALVYHHSIVPVSLPCTLRIPDKDLVGELQELQSGTNTSTAA------------DLLKQG--AACNVLYLNSVDIESLTGPQAISKAIKSTLNQDPCPSATTVHFKV-STQGITLTDNQRRLFFRRHYPIHSVTFSSVDPQDQ---------------RMFGFVARRSGSSQGNACHLFAELDPEQPATAIVNFINKVML 1394          

HSP 2 Score: 67.0106 bits (162), Expect = 1.286e-10
Identity = 72/273 (26.37%), Postives = 117/273 (42.86%), Query Frame = 3
Query:  591 YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLST-ALKIFITKNIKELEKIPISYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQAC-----PMKMKLDLYFRETAVFGQGESDLFVETSHS-DLS---SIERTDSY 1376
            + DL  PP L  I   C+++  WL     N  ++ C+G      ++  AY  +       +  L+T A++ F    I     +  S  RY  Y + L S   ++ S  S + L  + + S P  +P    +   F K Y +  L  V+T+  Y+++ S S+ + +     + L+ D M+ CYHR      R  +FR+ FHTC      L F  ++ +   QAC     P    ++L F  +    +G   L  E   S D S    + R DSY
Sbjct:  118 WPDLHAPP-LDKICAVCKAMEAWLNSDPSNVVVLHCKGNKGKTGVITAAYMHYSKISAGAEQALATVAMRKFCEDKISP--SLQPSQSRYIYYFAGLLSGTIKINS--SPLLLQQVHIPSLPNYQPGGGYAP--FLKIYQS--LKLVYTSATYNIEDSRSKTLHISIEPALLLKGDIMVKCYHRRAGLCERECIFRVQFHTCTVHGAQLWFGKRELD---QACTDERYPADATVELVFSTSPQPAKGGDSLQSEPGGSVDFSCTDPVVRWDSY 378          
BLAST of Tensin 1 vs. Ensembl Cavefish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 191.045 bits (484), Expect = 1.551e-48
Identity = 119/319 (37.30%), Postives = 175/319 (54.86%), Query Frame = 3
Query: 2613 FSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV-TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            FS+LN    SP       +  L ++ V++  K+WY+P ISRE+AI +LK   PG F+IRDS+++ GAYGLA+KV+  P      K  D+ +E VRH+LIE S  +GV  KG P EP F  LS LV  ++     LPC LV+P +  D  +    + T          +P    LK+      +V Y+   D+E +TGP  + KAI   +      + T    +++S +GI LTD +RKLFFRRH+P S++T+C LDP++RK      K++G    K FG +  K     +N   LF E+DP   A  IV  +++ ++ S
Sbjct: 1415 FSKLNMCDGSP-------ETRLNVKFVQDTSKFWYKPDISREQAINILKEREPGAFIIRDSHSFRGAYGLAMKVSSPPPTAQQAKKGDITNELVRHFLIETS-PKGVKLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTK--DPHEEVPEVAT--------PVNPATELLKQG--AACNVLYINSVDMESLTGPQAVAKAISETMAASPMPTATTVHFKVSS-QGITLTDNQRKLFFRRHYPISTVTFCDLDPQERKWN----KAEG-GTAKFFGFVARKQGSTTDNVSHLFAEMDPDQPATAIVNFVSKVMIGS 1707          

HSP 2 Score: 65.4698 bits (158), Expect = 4.764e-10
Identity = 69/313 (22.04%), Postives = 136/313 (43.45%), Query Frame = 3
Query:  330 KKYDASFSLSVNQPSFPDEKSKLYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKNAKIKMYCL---TEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPI---SYKRYSSYMSLYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDV-LTFHSQDFEDVYQ 1247
            +KY+   S+S+ Q    + +  L  I E I  +  P       V+ E   S L ++    ++     Y L   +E   D  +L    ++F       P L  I   C+++  W++  + N  ++  +G      +++ AY  + +     D     AL  F  K   E + +P+   S KRY  Y S       ++     ++L+ +I++  P  E  +    + F K Y  + +  V+T+ +Y++Q      + +     + L+ D ++ CYH+   +  R  +FR+ FHTC A+ D+ L F   + ++ ++
Sbjct:   23 EKYEGGGSVSLIQSMEENYEVDLVYITERIISVSFP-----GNVEEESYSSNLKEVATMLRSKHGDNYLLFNLSEKRYDISRLNPKVLDFGWPDHHAPALDKICSICKAMDTWMSADSHNVVVLHNKGNRGRTGVVVAAYMHYSNISASAD----QALDRFAMKRFYEDKVLPVGQPSQKRYVQYFSGL-LSGHIKINNKPLFLHHVIMHGIPNFE--AKGGCRPFLKIY--QAMQPVYTSGIYNVQGDSQTSICITIEPGLLLKGDILLKCYHKRFRSPSRDVIFRVQFHTC-AVHDLSLVFGKDELDETFK 320          
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 199.904 bits (507), Expect = 5.757e-52
Identity = 118/308 (38.31%), Postives = 180/308 (58.44%), Query Frame = 3
Query: 2655 YNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTV---KSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLP-DRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMA-GENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            Y   +    ++ V++  KYWY+  ISR++AIA+LK+  PG+F+IRDS+++ GAYGLA+KV+  P N+     K  D+ SE VRHYLIE + ++GV  KG P EP F SLS LV  ++     LPC +V+P + PL+ ++              + ++P+L  LK+      +V YLG  ++E +TGP  + KA+ + L      S T+   ++ S +G+ LTD +RKLFFRRH+P  ++TYC  DP++RK + +   S       IFG + K   +  +N+C LF ELDP   A  IV  I + ++ S
Sbjct: 1384 YGSIETRAQVKFVQDTTKYWYKKEISRDQAIALLKDKEPGSFVIRDSHSFRGAYGLAMKVSSPPPNIPQQGKKKGDVSSELVRHYLIECT-SKGVRLKGCPNEPYFGSLSALVYQHSITPLALPCKIVIPHEDPLEHSE------VDSIQSHPVNATPEL--LKQG--AACNVLYLGSVEMESLTGPQAVAKAVGQALSGSAPPSPTQVHFKV-SQQGVTLTDNQRKLFFRRHYPADTVTYCDQDPQNRKWKKDSGSS-----ANIFGFVAKKQGSVTDNQCHLFAELDPKQPASAIVSFITKVMMSS 1674          

HSP 2 Score: 70.8626 bits (172), Expect = 1.963e-12
Identity = 68/270 (25.19%), Postives = 122/270 (45.19%), Query Frame = 3
Query:  393 KLYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLST-ALKIFITKNIKELEKIPISYKRYSSYMS-LYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFY-TNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTC 1190
            +L  I E I  +C P     H   H+ +      +     N  + +  L+E   D  K      +F + DL  PP L  +   C+++  WL     +  +I C+G      +++ +Y  +          L   A+K F    + +L +   S +RY SY S L S   ++ +L   ++L+ ++++  P +E   D   + F K Y   +PL   HT+ +Y++  +  +L I  +   + L+ D ++ CYHR   A  R ++FR+ FHTC
Sbjct:   14 ELTYITERIISLCAPTGGDSHVAYHQQMRDVARMLHSKHANGYL-VINLSERRHDIEKFNVHVRDFGWPDLHAPP-LDVLCSICKAMDSWLNADPAHVVVIHCKGNKCRTGVVVASYMYYNGICASASQALDRYAMKKFYDDKVAKLSQP--SQRRYVSYFSELLSGRVKVNNL--PLFLHHIVIHGLPNLE--DDGGCRPFLKIYQAAQPL---HTSAVYNIPNNCKKLCITIEPG-LPLKGDILVKCYHRGCQAATRDEIFRVQFHTC 271          
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005743.1 (pep scaffold:Pmarinus_7.0:GL478791:187748:191319:1 gene:ENSPMAG00000005205.1 transcript:ENSPMAT00000005743.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.718 bits (452), Expect = 1.666e-50
Identity = 112/280 (40.00%), Postives = 160/280 (57.14%), Query Frame = 3
Query: 2742 AIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLD--QTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMA-GENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            AIA+LK+  PG+F+IRDS+++ GAYGLA+KVAM P +V    K  DL +E VRHYLIE S  +GV  KG P EP F SLS LV  ++     LPC L++PD+ P++  +TD+ +    + +S            LK+      +V +LG  ++E +TGP  I KA+  +L    A           S +GI LTD +RKLFFRRH+P  ++T+C LDP++RK +     + G     IFG + K   +  +N C LF EL+P   A  IV  + + +L S
Sbjct:    1 AIAVLKDSEPGSFIIRDSHSFRGAYGLAVKVAMPPPSVLQQTKKGDLANELVRHYLIE-STPKGVRLKGCPNEPFFGSLSALVYQHSITPLALPCQLIIPDKDPMECSETDSSEANTANSASEL----------LKQG--AACNVLFLGSVEMESLTGPQAIAKAVGEVLEASAATPAATAVHFKVSAQGITLTDNQRKLFFRRHYPSITVTFCDLDPQERKWQ-----NNGSNSANIFGFVAKKQASTTDNLCHLFAELEPEQPAGAIVNFVTKVMLGS 262          
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003653.1 (pep scaffold:Pmarinus_7.0:GL476944:428913:445548:-1 gene:ENSPMAG00000003337.1 transcript:ENSPMAT00000003653.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.496 bits (467), Expect = 3.096e-48
Identity = 113/307 (36.81%), Postives = 170/307 (55.37%), Query Frame = 3
Query: 2670 QNLTLQS----VEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIP-QNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYS--VYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            Q+ TL+S    V++  KYWY+P ISR++AI MLK  +PG F+IRDS+++ GAYGLA+KVA  P  ++  K  D  SE VRH+LIE S  +GV  KG   EP+F SLS LV  ++     LPC L++P+  PLD +                     +NS  +  + G +  V +LG  ++E +TGP  I KA   +L        T    ++ S +GI LTD +R +    H+P S++T+C +DP+ R       +++G   +++FG +  K   + +N C LF ELDP   A  IV  +++ +L S
Sbjct:  515 QDGTLESPVNFVQDTSKYWYKPDISRDQAITMLKGRDPGAFVIRDSSSFRGAYGLALKVATPPGPSLDSKKGDPASELVRHFLIE-STPKGVRLKGCSNEPVFGSLSALVYQHSITPLALPCKLLVPEHDPLDTS--------------------SVNSASELLKQGAACNVLFLGSVEMESLTGPQAIGKATAEILDMKPRPVATTVHFKV-SAQGITLTDNQRSILPPTHNPVSTVTFCNVDPETRTW----VQAEGTPGSRVFGFVARKPGSSSDNLCHLFAELDPEQPAAAIVNFVSKVLLTS 795          
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001958.1 (pep scaffold:Pmarinus_7.0:GL480048:14054:23824:1 gene:ENSPMAG00000001775.1 transcript:ENSPMAT00000001958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.073 bits (401), Expect = 1.588e-43
Identity = 102/293 (34.81%), Postives = 152/293 (51.88%), Query Frame = 3
Query: 2691 VEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSD-DLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGEL--DPSHKAHLIVKIINEQIL 3557
            V++  K+WY+P I+RE+A+ +L     G F+IR+S+++ G +GLA+KV  +P  V V++  D   E VRH+LIE +  QGV  KG P EP F SLS LV  +T     LP  L LPDR  D T             +     P         E   + ++L   ++E +TGP  + +A   ++G           +R+ +G+GI LTD+ RK FFRRH+P  SI++CA+ P   +  +    ++     K+FG +  KA     N C LF E    P H+A   V+  + QIL
Sbjct:    4 VQDTSKFWYKPGITREQAVTLLCPREAGAFVIRNSSSFHGDFGLAMKVENLPPGVPVQAGRDTVDELVRHFLIE-TKAQGVRLKGCPNEPFFGSLSALVNQHTVTPLALPGCLRLPDRDFDLTKAHDLCDALTGGSTGSSQPP---------EAVGTAFFLDSVEMESLTGPQAVARATSVIMGMATRSMPIHVHLRV-TGQGITLTDIYRKRFFRRHYPAESISFCAMVPDVTRWPM----AEDKPAAKMFGFVARKAGSVSHNVCHLFAEEADSPGHRAESWVQ-ASSQIL 280          
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010484.1 (pep scaffold:Pmarinus_7.0:GL477590:9709:49115:-1 gene:ENSPMAG00000009496.1 transcript:ENSPMAT00000010484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 8.119e-9
Identity = 74/320 (23.12%), Postives = 133/320 (41.56%), Query Frame = 3
Query:  405 IFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKNAKIKMYCLTEMCP---DSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLST-ALKIFITKNIKELEKIPISYKRYSSYM-SLYSCMNQLQSLRSSVYLYCLILYS--FPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNI--PISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQAC-----PMKMKLDLYFRETAVFGQGESDL 1322
            I E I     P     H  Q     S+L  I     +     Y +  +     + L+L    ++F       P L ++   C+++  WL     + A++ C G +    ++I A+  +       D  L   A+K F  +    L +   S +RY  Y   L S   ++ S  + VYL  ++L+    P     S    ++F + Y  + L   +T+ +Y+++A V     L  N+   + L+ D ++ CY RS+   R + +FR+ FHTC    + L F   D +   +AC     P   +++L F    +   G+ D+
Sbjct:   14 ITERIIATTLPPGIAEHAHQ-----SSLRDIAGMLTSKHADKYLIINLSGRRNEMLQLNPQVLDFGWPSRHAPHLDTLCSICKAIDSWLNSHPLHVAVLHCAGNSGSAGVVIAAFMHYSAICASADQALDRFAMKRFYVEKFASLTQP--SQQRYVYYFNGLLSGSIKMNS--APVYLSHILLHGAWGPPTTAFSGCGGRVFLRVY--QGLHLYYTSPVYTVRAEVRDGAPLCVNLSPGVVLKGDILVKCY-RSSEDGREV-VFRVQFHTCTLQGNRLKFTKHDLD---EACADPGFPDSGQVELLFSSGPIHDVGKGDV 317          
BLAST of Tensin 1 vs. Ensembl Nematostella
Match: EDO45783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM1])

HSP 1 Score: 176.792 bits (447), Expect = 1.374e-49
Identity = 99/286 (34.62%), Postives = 161/286 (56.29%), Query Frame = 3
Query: 2706 KYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVT---VKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQI 3554
            ++WY+P I+R++AI +LK+  PG F++RDS ++ GAYGLA+KVA+ P +V    +   DL +EK+RH+LIE S  +GV  KG   EP+F SL+  V  +T     LP  LV+P+             T       +     +N +  S      V ++G  +VE ++G + + + +E LL       FT    ++   EG+ +TDLERK+FFR+H P +SI +C +DP D++ +L +    G  K++ FG++V+      N C LF E+D  H  + ++ ++N+ I
Sbjct:    2 EFWYKPKITRDQAINVLKDKEPGLFVVRDSQSFPGAYGLAVKVAIPPPHVLQGDLTKVDLANEKIRHFLIE-STKKGVKLKGCDNEPVFGSLAAFVFQHTITPLSLPLRLVIPNE-----------GTWPRRCFSLTFMYAVNVV--SFFLAMKVMFVGESNVEMLSGSTAVQRTVEDLLKYKATPRFTPASFKVTR-EGVTITDLERKVFFRKHFPMTSILHCGIDPLDQRWDLHLPDYTG--KSRTFGMVVRRIGEAGNDCHLFAEVDDDHSVNTVINLVNKYI 270          
BLAST of Tensin 1 vs. Ensembl Nematostella
Match: EDO45782 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM0])

HSP 1 Score: 60.4622 bits (145), Expect = 1.457e-9
Identity = 71/278 (25.54%), Postives = 127/278 (45.68%), Query Frame = 3
Query:  492 KITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNF-YTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLST-ALKIFITKNIKELEKIPISYKRYSSYMSLYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICD-VLTFHSQDFEDVY--QACPMKMKLDLYFRETAVFGQG 1310
            K+ Q     K  ++ L+E   D  KL    ++F + D   PP L+ +    +S+  WL    ++  ++ C+G      ++I AY  F       +  L   A+K F    +  + + P S +RY  Y S Y    +++     ++L+ +I++  P    DS    + F + Y  + L  V+T+ ++ +   + R+ I  +   I L  D +I CYH++T ++ R  +FR  FHT  AI D VL     D ++ +  +  P   K++  F  T  F  G
Sbjct:   49 KMLQRKHQDKYMVFNLSERRYDISKLNHQVLDFGWPDHLAPP-LERLCSIIKSIDSWLKTDPQHVVVVHCKGGKGRTGVVISAYMHFSKMCSSPEAALDWFAIKRFYDDKLGGVTQ-P-SQRRYVHYFSDY-LEGKIKLSSEPMFLHHVIVHGIPNF--DSKGGCKPFLRVY--DGLKLVYTSGVFLVTQDMERVCITIEGGLI-LHGDVLIKCYHKNTLSSVRDIIFRCQFHT-GAIKDCVLVLDKTDLDEAHRDKRFPDNCKVEFVFSATGSFVAG 316          
BLAST of Tensin 1 vs. Ensembl Nematostella
Match: EDO45008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU23])

HSP 1 Score: 58.151 bits (139), Expect = 2.165e-8
Identity = 35/109 (32.11%), Postives = 54/109 (49.54%), Query Frame = 3
Query: 2706 KYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVL 3032
            +YWY P I RE  + ML+    G+F +RDS +  G + L ++V            ++ +    +YLI     +GV  +GF     F  L  L+ YY++ A  LPC L+L
Sbjct:  680 EYWYMPGIPREFIMEMLQASEEGSFFVRDSQSKPGCHALTVRVPT----------EVHASGFGNYLI-TPIPEGVKLEGFSR--TFTDLVSLIEYYSYHADGLPCRLLL 775          
BLAST of Tensin 1 vs. Ensembl Nematostella
Match: EDO27682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8K3])

HSP 1 Score: 54.6842 bits (130), Expect = 1.537e-7
Identity = 34/107 (31.78%), Postives = 52/107 (48.60%), Query Frame = 3
Query: 2712 WYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVL 3032
            WY P I RE  + ML+    G+F +RDS +  G + L ++V            ++ +    +YLI     +GV  +GF     F  L  L+ YY++ A  LPC L+L
Sbjct:  270 WYMPGIPREFIMEMLQASEEGSFFVRDSQSKPGCHALTVRVPT----------EVHASGFGNYLIT-PIPEGVKLEGFSR--TFTDLVSLIEYYSYHADGLPCRLLL 363          
BLAST of Tensin 1 vs. Ensembl Medaka
Match: ENSORLT00000002849.2 (pep primary_assembly:ASM223467v1:2:14075704:14085025:-1 gene:ENSORLG00000002301.2 transcript:ENSORLT00000002849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.134 bits (505), Expect = 5.954e-53
Identity = 115/296 (38.85%), Postives = 168/296 (56.76%), Query Frame = 3
Query: 2676 LTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQI 3554
            + ++ V++  K+WY+P ISRE+AI +LK+  PG F+IRDS+++ GAYGLA+KVA  P  +    K  DL +E VRH+LIE S  +GV  KG P EP F  LS LV  ++     LPC L++P +  D  +    + T         + P +  LK+  E   +V Y+   D+E +TGP  I KAI + L      + T    ++ + +GI LTD +RK+FFRRH+P S+ITYC +DP++RK   E     G    K+FG +  K     +N   LF ELDP   A  IV  +++ +
Sbjct:  397 MNVKFVQDTSKFWYKPDISREQAINLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTIQQNKKVGDLTNELVRHFLIETS-PKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPTK--DPNEEALELAT--------PTDPVVELLKQ--EAACNVLYINSVDMESLTGPQAIAKAISQTLATSPLPAATTVHFKVTT-QGITLTDSQRKIFFRRHYPISTITYCDMDPQNRKWGKE-----GGGSVKLFGFVARKQGSTTDNASHLFAELDPDQPASAIVSFVSKTL 673          
BLAST of Tensin 1 vs. Ensembl Medaka
Match: ENSORLT00000002851.2 (pep primary_assembly:ASM223467v1:2:14075704:14087112:-1 gene:ENSORLG00000002301.2 transcript:ENSORLT00000002851.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.519 bits (506), Expect = 9.840e-52
Identity = 115/291 (39.52%), Postives = 165/291 (56.70%), Query Frame = 3
Query: 2691 VEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV--TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQI 3554
            V++  K+WY+P ISRE+AI +LK+  PG F+IRDS+++ GAYGLA+KVA  P  +    K  DL +E VRH+LIE S  +GV  KG P EP F  LS LV  ++     LPC L++P +  D  +    + T         + P +  LK+  E   +V Y+   D+E +TGP  I KAI + L      + T    ++ + +GI LTD +RK+FFRRH+P S+ITYC +DP++RK   E     G    K+FG +  K     +N   LF ELDP   A  IV  +++ +
Sbjct:  708 VQDTSKFWYKPDISREQAINLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTIQQNKKVGDLTNELVRHFLIETS-PKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPTK--DPNEEALELAT--------PTDPVVELLKQ--EAACNVLYINSVDMESLTGPQAIAKAISQTLATSPLPAATTVHFKVTT-QGITLTDSQRKIFFRRHYPISTITYCDMDPQNRKWGKE-----GGGSVKLFGFVARKQGSTTDNASHLFAELDPDQPASAIVSFVSKTL 979          
BLAST of Tensin 1 vs. Ensembl Medaka
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:101166465])

HSP 1 Score: 191.43 bits (485), Expect = 5.767e-49
Identity = 112/300 (37.33%), Postives = 170/300 (56.67%), Query Frame = 3
Query: 2679 TLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV---TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            T++ V++  K+WY+P ISR++AIA+LK+  PG+F++RDS+++ GAYGLA+KVA  P  V   + K  DL +E VRH+LIE +  +GV  KG P EP F SL+ LV  ++     LPC L+LPDR P+++  +        S+  ++      N           V+YLG  ++E +TG   + KA    L        T    ++ S +GI LTD +RKLFFRRH+  +++ +C+LDP+ RK   +   +      KIFG +  K+    EN C LF E DP   A  IV  +++ ++ S
Sbjct:  893 TVKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPTVLQHSKKGGDLSNELVRHFLIECT-PKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLILPDRDPVEELSDSPAQTATNSAADLLKQGAACN-----------VWYLGSVELESLTGHQAVQKATTVTLTMDPPPPSTVVHFKV-SAQGITLTDNQRKLFFRRHYAVNTVIFCSLDPQGRKWTRDSGST-----AKIFGFVARKSQSDTENMCHLFAEHDPEQPASAIVNFVSKVMIGS 1174          

HSP 2 Score: 71.2478 bits (173), Expect = 6.673e-12
Identity = 67/262 (25.57%), Postives = 118/262 (45.04%), Query Frame = 3
Query:  618 LKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCMNQLQSLR-SSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQAS-VSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQ--ACPMKMKLDLYFRETAVFGQGESDLF-----VETSHSDLSSIERTDSY 1376
            L  IL  C  + +WL    ++  ++ C+G   ++ +++ +Y  F +     D+ L         K+    E  P S KRY+   +L S +     +R S  +L C++L+  P ++PD      LF + Y +  L  V T+ +Y   A+  +RL  +     + L  D  ++ YH+++ +  R  +FRL FHT       L+F   D +   +  + P   KL+L F E+     G  +L+     V   +  L  + R DSY
Sbjct:   30 LDQILHVCREMENWLQADPKHVLVLHCRGGKGLLGVLVASYIHFSNMSASADLSLDHFAMWRFYKDKLSTEMTP-SQKRYA--WTLGSVLKGGLRMRFSPCFLLCVVLHGLPKIDPDG--GCCLFLRVYQS--LQAVCTSPVYHANAAQTNRLYFVLQPAQL-LNGDITVVSYHKNSWSGSRQVVFRLQFHTGIIAGHTLSFSKADLDCACEDSSFPDDGKLELLFSESPERFAGR-ELWHNGPTVTVDYDTLDPLVRRDSY 282          
BLAST of Tensin 1 vs. Ensembl Medaka
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:101166465])

HSP 1 Score: 191.815 bits (486), Expect = 5.845e-49
Identity = 112/300 (37.33%), Postives = 170/300 (56.67%), Query Frame = 3
Query: 2679 TLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV---TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            T++ V++  K+WY+P ISR++AIA+LK+  PG+F++RDS+++ GAYGLA+KVA  P  V   + K  DL +E VRH+LIE +  +GV  KG P EP F SL+ LV  ++     LPC L+LPDR P+++  +        S+  ++      N           V+YLG  ++E +TG   + KA    L        T    ++ S +GI LTD +RKLFFRRH+  +++ +C+LDP+ RK   +   +      KIFG +  K+    EN C LF E DP   A  IV  +++ ++ S
Sbjct:  944 TVKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPTVLQHSKKGGDLSNELVRHFLIECT-PKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLILPDRDPVEELSDSPAQTATNSAADLLKQGAACN-----------VWYLGSVELESLTGHQAVQKATTVTLTMDPPPPSTVVHFKV-SAQGITLTDNQRKLFFRRHYAVNTVIFCSLDPQGRKWTRDSGST-----AKIFGFVARKSQSDTENMCHLFAEHDPEQPASAIVNFVSKVMIGS 1225          

HSP 2 Score: 72.4034 bits (176), Expect = 2.643e-12
Identity = 92/353 (26.06%), Postives = 151/353 (42.78%), Query Frame = 3
Query:  381 DEKSK--LYTIFENIFVICCP----EAEIRHKVQHEIIYSALLKITQCFK----NAKIKMYCLTEMCPDSLKLC--DTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCMNQLQSLR-SSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQAS-VSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQ--ACPMKMKLDLYFRETAVFGQGESDLF-----VETSHSDLSSIERTDSY 1376
            +E+S+  L  I E I  I CP    E    H +Q EII  ++L+    +     N   K   LT M    L  C  D  V           L  IL  C  + +WL    ++  ++ C+G   ++ +++ +Y  F +     D+ L         K+    E  P S KRY+   +L S +     +R S  +L C++L+  P ++PD      LF + Y +  L  V T+ +Y   A+  +RL  +     + L  D  ++ YH+++ +  R  +FRL FHT       L+F   D +   +  + P   KL+L F E+     G  +L+     V   +  L  + R DSY
Sbjct:    2 EERSQINLTYITERIITIFCPRGFPEDVYLHSLQ-EII--SMLQSKHGYNYMLLNLSQKHEALTRMNHKVLDTCWQDPLVT---------GLDQILHVCREMENWLQADPKHVLVLHCRGGKGLLGVLVASYIHFSNMSASADLSLDHFAMWRFYKDKLSTEMTP-SQKRYA--WTLGSVLKGGLRMRFSPCFLLCVVLHGLPKIDPDG--GCCLFLRVYQS--LQAVCTSPVYHANAAQTNRLYFVLQPAQL-LNGDITVVSYHKNSWSGSRQVVFRLQFHTGIIAGHTLSFSKADLDCACEDSSFPDDGKLELLFSESPERFAGR-ELWHNGPTVTVDYDTLDPLVRRDSY 333          
BLAST of Tensin 1 vs. Ensembl Medaka
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:101166465])

HSP 1 Score: 191.43 bits (485), Expect = 6.245e-49
Identity = 112/300 (37.33%), Postives = 170/300 (56.67%), Query Frame = 3
Query: 2679 TLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNV---TVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDR-PLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIV-KAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKS 3563
            T++ V++  K+WY+P ISR++AIA+LK+  PG+F++RDS+++ GAYGLA+KVA  P  V   + K  DL +E VRH+LIE +  +GV  KG P EP F SL+ LV  ++     LPC L+LPDR P+++  +        S+  ++      N           V+YLG  ++E +TG   + KA    L        T    ++ S +GI LTD +RKLFFRRH+  +++ +C+LDP+ RK   +   +      KIFG +  K+    EN C LF E DP   A  IV  +++ ++ S
Sbjct:  933 TVKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPTVLQHSKKGGDLSNELVRHFLIECT-PKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLILPDRDPVEELSDSPAQTATNSAADLLKQGAACN-----------VWYLGSVELESLTGHQAVQKATTVTLTMDPPPPSTVVHFKV-SAQGITLTDNQRKLFFRRHYAVNTVIFCSLDPQGRKWTRDSGST-----AKIFGFVARKSQSDTENMCHLFAEHDPEQPASAIVNFVSKVMIGS 1214          

HSP 2 Score: 55.8398 bits (133), Expect = 3.218e-7
Identity = 74/324 (22.84%), Postives = 129/324 (39.81%), Query Frame = 3
Query:  444 EIRHKVQHEIIYSALLKITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALI----CCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCMNQLQSLR-SSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQAS-VSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQ--ACPMKMKLDLYFRETAVFGQGESDLF-----VETSHSDLSSIERTDSY 1376
            E   ++ H++I+  L +   CF +  +    ++             V F+T + +         FC     W       R ++    CC           + +  F  A  + D+ L         K+    E  P S KRY+   +L S +     +R S  +L C++L+  P ++PD      LF + Y +  L  V T+ +Y   A+  +RL  +     + L  D  ++ YH+++ +  R  +FRL FHT       L+F   D +   +  + P   KL+L F E+     G  +L+     V   +  L  + R DSY
Sbjct:   24 EALTRMNHKVIFILLFR-AGCFSHVNVGYMGVS------------LVRFWTHVGRTLWSPVWTRFCMCAEKW---RTGYRLILSTSWCCIAGEEKAFWEFWWHLTFTSATCQPDLSLDHFAMWRFYKDKLSTEMTP-SQKRYA--WTLGSVLKGGLRMRFSPCFLLCVVLHGLPKIDPDG--GCCLFLRVYQS--LQAVCTSPVYHANAAQTNRLYFVLQPAQL-LNGDITVVSYHKNSWSGSRQVVFRLQFHTGIIAGHTLSFSKADLDCACEDSSFPDDGKLELLFSESPERFAGR-ELWHNGPTVTVDYDTLDPLVRRDSY 322          
BLAST of Tensin 1 vs. Planmine SMEST
Match: SMESG000060707.1 (SMESG000060707.1)

HSP 1 Score: 2215.65 bits (5740), Expect = 0.000e+0
Identity = 1116/1121 (99.55%), Postives = 1119/1121 (99.82%), Query Frame = 3
Query:  210 MNSKLERIENVCQNQNKSTENEIKRLTSYQCSLCKMDHEKKKYDASFSLSVNQPSFPDEKSKLYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQACPMKMKLDLYFRETAVFGQGESDLFVETSHSDLSSIERTDSYTFLENDENSNKMGSTIIIQRKADIQNQTIENKVPCDNGQRDITSITIYKTSVEDRREDVNEELTEKRNLKVINQSGQISGPVDSYHSTKLDTVRTSSSVLNGSGSMNTEFNHSTYNPGYHSYDSHSMSNNDRDKCSQQLDTLMKDLNLDNKSAFHGSRMNSSYYTSHADNANNDNSQNKIANRELQLMTELLEAQKEISNLRRSMNHLDLLEQSSTNRGFTNKNPNNNFLSTSKFKGMTKTSVSSSIPDTYNYXXXXXXXXXXXXXXXXXXXXXXIQRSTKFNAAPINAFTSETRTINDFLDNRQTKYSAHRENXXXXXXXXEKFIPHERISHQNFQDDRESTDVFEEVETINLQPIGKGIQDLNKGNLQHRIPMGTAKIESTSHLFNENIGSLSPLSSRKFPMQNKVETSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTEN 3572
            MNSKLERIENVCQNQNKSTENEIKRLTSYQCSLCKMDHEKKKYDASFSLSVNQPSFPDEKSKLYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFH QDFEDVYQACPMKMKLDLYFRETAVFGQG+SDLFVETSHSDLSSIERTDSYTFLENDENSNKMGSTIIIQRKADIQNQTIENKVPCDNGQRDITSITIYKTSVEDRREDVNEELTEKRNLKVINQSGQISGPVDSYHSTKLDTVRTSSSVLNGSGSMNTEFNHSTYNPGYHSYDSHSMSNNDRDKCSQQLDTLMKDLNLDNKSAFHGSRMNSSYYTSHADNANNDNSQNKIANRELQLMTELLEAQKEISNLRRSMNHLDLLEQSSTNRGFTNKNPNNNFLSTSKFKGMTKTSVSSSIPDTYNYSTPRSSNLSNNRLNNNSSVSPNIQRSTKFNAAPINAFTSETRTINDFLDNRQTKYSAHRENMDRDRMMREKFIPHER+SHQNFQDDRESTDVFEEVETINLQPIGKGIQDLNKGNLQHRIPMGTAKIESTSHLFNENIGSLSPLSSRKFPMQNKVETSSFSRLNSEISSPPMSY GQQQNLTLQSVEEKMKYWYQPHISREEAIA+LKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTHVSSHSVIISSPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTEN
Sbjct:    1 MNSKLERIENVCQNQNKSTENEIKRLTSYQCSLCKMDHEKKKYDASFSLSVNQPSFPDEKSKLYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHCQDFEDVYQACPMKMKLDLYFRETAVFGQGQSDLFVETSHSDLSSIERTDSYTFLENDENSNKMGSTIIIQRKADIQNQTIENKVPCDNGQRDITSITIYKTSVEDRREDVNEELTEKRNLKVINQSGQISGPVDSYHSTKLDTVRTSSSVLNGSGSMNTEFNHSTYNPGYHSYDSHSMSNNDRDKCSQQLDTLMKDLNLDNKSAFHGSRMNSSYYTSHADNANNDNSQNKIANRELQLMTELLEAQKEISNLRRSMNHLDLLEQSSTNRGFTNKNPNNNFLSTSKFKGMTKTSVSSSIPDTYNYSTPRSSNLSNNRLNNNSSVSPNIQRSTKFNAAPINAFTSETRTINDFLDNRQTKYSAHRENMDRDRMMREKFIPHERMSHQNFQDDRESTDVFEEVETINLQPIGKGIQDLNKGNLQHRIPMGTAKIESTSHLFNENIGSLSPLSSRKFPMQNKVETSSFSRLNSEISSPPMSYKGQQQNLTLQSVEEKMKYWYQPHISREEAIAILKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTHVSSHSVIISSPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTEN 1121          
BLAST of Tensin 1 vs. Planmine SMEST
Match: SMESG000060707.1 (SMESG000060707.1)

HSP 1 Score: 1270.37 bits (3286), Expect = 0.000e+0
Identity = 664/682 (97.36%), Postives = 668/682 (97.95%), Query Frame = 3
Query: 1530 VEDRREDVNEELTEKRNLK-VINQSGQISGPVDSYHSTKLDTVRTSSSVLNGSGSMNTEFNHSTYNPGYHSYDSHSMSNNDRDKCSQQLDTLMKDLNLDNKSAFHGSRMNSSYYTSHADNANNDNSQNKIANRELQLMTELLEAQKEISNLRRSMNHLDLLEQSSTNRGFTNKNPNNNFLSTSKFKGMTKTSVSSSIPDTYNYXXXXXXXXXXXXXXXXXXXXXXIQRSTKFNAAPINAFTSETRTINDFLDNRQTKYSAHRENXXXXXXXXEKFIPHERISHQNFQDDRESTDVFEEVETINLQPIGKGIQDLNKGNLQHRIPMGTAKIESTSHLFNENIGSLSPLSSRKFPMQNKVETSSFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTEN 3572
            V   R D++     K  L  VINQSGQISGPVDSYHSTKLDTVRTSSSVLNGSGSMNTEFNHSTYNPGYHSYDSHSMSNNDRDKCSQQLDTLMKDLNLDNKSAFHGSRMNSSYYTSHADNANNDNSQNKIANRELQLMTELLEAQKEISNLRRSMNHLDLLEQSSTNRGFTNKNPNNNFLSTSKFKGMTKTSVSSSIPDTYNYSTPRSSNLSNNRLNNNSSVSPNIQRSTKFNAAPINAFTSETRTINDFLDNRQTKYSAHRENMDRDRMMREKFIPHER+SHQNFQDDRESTDVFEEVETINLQPIGKGIQDLNKGNLQHRIPMGTAKIESTSHLFNENIGSLSPLSSRKFPMQNKVETSSFSRLNSEISSPPMSY GQQQNLTLQSVEEKMKYWYQPHISREEAIA+LKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTHVSSHSVIISSPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTEN
Sbjct:   15 VSGFRTDLDLSFLHKSKLNTVINQSGQISGPVDSYHSTKLDTVRTSSSVLNGSGSMNTEFNHSTYNPGYHSYDSHSMSNNDRDKCSQQLDTLMKDLNLDNKSAFHGSRMNSSYYTSHADNANNDNSQNKIANRELQLMTELLEAQKEISNLRRSMNHLDLLEQSSTNRGFTNKNPNNNFLSTSKFKGMTKTSVSSSIPDTYNYSTPRSSNLSNNRLNNNSSVSPNIQRSTKFNAAPINAFTSETRTINDFLDNRQTKYSAHRENMDRDRMMREKFIPHERMSHQNFQDDRESTDVFEEVETINLQPIGKGIQDLNKGNLQHRIPMGTAKIESTSHLFNENIGSLSPLSSRKFPMQNKVETSSFSRLNSEISSPPMSYKGQQQNLTLQSVEEKMKYWYQPHISREEAIAILKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTHVSSHSVIISSPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKIINEQILKSTEN 696          
BLAST of Tensin 1 vs. Planmine SMEST
Match: SMESG000060707.1 (SMESG000060707.1)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 457/459 (99.56%), Postives = 458/459 (99.78%), Query Frame = 3
Query:  210 MNSKLERIENVCQNQNKSTENEIKRLTSYQCSLCKMDHEKKKYDASFSLSVNQPSFPDEKSKLYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQACPMKMKLDLYFRETAVFGQGESDLFVETSHSDLSSIERTDSYTFLENDENSNKMGSTIIIQRKADIQNQTIENKVPCDNGQRDITSITIYKTSVEDRREDVNEELTEKRNLK 1586
            MNSKLERIENVCQNQNKSTENEIKRLTSYQCSLCKMDHEKKKYDASFSLSVNQPSFPDEKSKLYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFH QDFEDVYQACPMKMKLDLYFRETAVFGQG+SDLFVETSHSDLSSIERTDSYTFLENDENSNKMGSTIIIQRKADIQNQTIENKVPCDNGQRDITSITIYKTSVEDRREDVNEELTEKRNLK
Sbjct:    1 MNSKLERIENVCQNQNKSTENEIKRLTSYQCSLCKMDHEKKKYDASFSLSVNQPSFPDEKSKLYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCFKNAKIKMYCLTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDWLAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFITKNIKELEKIPISYKRYSSYMSLYSCMNQLQSLRSSVYLYCLILYSFPCMEPDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQNDSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHCQDFEDVYQACPMKMKLDLYFRETAVFGQGQSDLFVETSHSDLSSIERTDSYTFLENDENSNKMGSTIIIQRKADIQNQTIENKVPCDNGQRDITSITIYKTSVEDRREDVNEELTEKRNLK 459          
BLAST of Tensin 1 vs. Planmine SMEST
Match: SMESG000019881.1 (SMESG000019881.1)

HSP 1 Score: 187.963 bits (476), Expect = 2.501e-48
Identity = 114/294 (38.78%), Postives = 159/294 (54.08%), Query Frame = 3
Query: 2661 GQQQNLTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKII 3542
               QN    S+ +  K WYQP++SREEA+  LK   PG+F++R S+T++ +YGLA+ V   P+  TV+ DD     VRH+LIE S  +GV  +G   EP F SL+ LV  +T     LPC L+LP    D  D      +         ++PK++SL       +S  YLG  D E +TG + ++KA+E LL N      TE  +RI S EG+ LTD+ RKLFFRRH+P +SI+YC  +        E  +S+G  K+KIFG + +     EN C L  E  P   +  I   I
Sbjct:  652 ANHQNSQNSSLRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDD---RCVRHFLIE-SNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPISESDLDDQQSSYDS-----CNKNNTPKVSSLFA--PKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRI-SPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAET-RSRGFAKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFI 929          
BLAST of Tensin 1 vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 170.244 bits (430), Expect = 5.288e-43
Identity = 143/533 (26.83%), Postives = 239/533 (44.84%), Query Frame = 3
Query: 2250 SETRTINDFLDNRQT----KYSAHRENXXXXXXXXEKFIPHERISHQNFQDDRESTDVFEEVETINLQPIGK-------GIQDLNKGNLQHRIPMG--TAK----IESTSHLFNENIGSLSP-------------LSSRKFP---------------------MQNKVETSSFSRLNSEISSPPMS-----------YNGQQQN-LTLQSVEEKMKYWYQPHISREEAIAMLKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIEL---SGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRP---LDQTDNGKGIKTXXXXXXXXXXXPKLNSLKKSDETGY-------------------------SVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVK--AYMAGENKCFLFGELDPSHKAHLIVKIINEQILK 3560
            S+T T N ++  + +     YSA +EN+       ++ +     S +    +R   ++ EE+ETI LQPIGK       GI  L++   +   P    T++     E T    N N    +P             +SS   P                      Q + E+ +    N + +  P+S           ++G + N   LQ V      WYQPH++RE+ I  L++   G+F+IR+S+T+ GAYGLA+KVA +P+N  ++++D + + +RH+LIE    S   GV  KG P EPI+PSL+HLV  +   A  LP  L++  +    LDQ D G G+      +         +S  +   T +                         +  YLG +DV+ + G + I++AI +L G  + ++ T  ++R++S  GI  TD  + LF+ R  P   +     D + R+    + ++ G+ + +I GI+++    +  EN   L  ELD S+    I+  I E  L+
Sbjct:  274 SDTTTYNTYIQEKDSGPISSYSARKENIKT-----QQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGIATLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYSSARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA-IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGG-GMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKT-TTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLR 798          
The following BLAST results are available for this feature:
BLAST of Tensin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS17.426e-5638.04tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS18.892e-5538.04tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS11.295e-5438.04tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS11.670e-5438.04tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS11.874e-5438.04tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
back to top
BLAST of Tensin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns-15.847e-4535.33TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-13.656e-4435.33TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-13.656e-4435.33TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-11.851e-4335.33TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-13.196e-4235.33TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
back to top
BLAST of Tensin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
by3.649e-4032.88gene:FBgn0000244 transcript:FBtr0302382[more]
by3.649e-4032.88gene:FBgn0000244 transcript:FBtr0082119[more]
by3.649e-4032.88gene:FBgn0000244 transcript:FBtr0301093[more]
CG339936.111e-1130.56gene:FBgn0053993 transcript:FBtr0301034[more]
CG339931.287e-1030.56gene:FBgn0053993 transcript:FBtr0100046[more]
back to top
BLAST of Tensin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns1b9.769e-5438.70tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
tns3.23.833e-5336.50tensin 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-... [more]
tns1b5.371e-5138.63tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
tns1a1.692e-4839.06tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32][more]
tns1a1.992e-4839.06tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32][more]
back to top
BLAST of Tensin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS31.501e-5036.14tensin 3 [Source:NCBI gene;Acc:100492216][more]
adamts121.441e-4939.12ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts124.636e-4939.12ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts125.531e-4939.12ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts126.590e-4939.12ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Tensin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tns11.242e-5837.95tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns11.066e-5537.95tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns11.596e-5537.76tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns11.857e-5537.95tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns16.191e-5237.95tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
back to top
BLAST of Tensin 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9GLM4|TENS1_BOVIN3.579e-5538.96Tensin-1 OS=Bos taurus OX=9913 GN=TNS1 PE=2 SV=1[more]
sp|Q9HBL0|TENS1_HUMAN8.020e-5438.04Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2[more]
sp|Q04205|TENS_CHICK1.373e-5039.39Tensin OS=Gallus gallus OX=9031 GN=TNS PE=1 SV=2[more]
sp|Q8CGB6|TNS2_MOUSE4.444e-4836.70Tensin-2 OS=Mus musculus OX=10090 GN=Tns2 PE=1 SV=... [more]
sp|Q63HR2|TNS2_HUMAN1.802e-4738.33Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2[more]
back to top
BLAST of Tensin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8ID038.554e-5832.07SH2 domain-containing protein OS=Macrostomum ligna... [more]
A0A0P7Y7F96.204e-5637.36SH2 domain-containing protein OS=Scleropages formo... [more]
Q6PJM37.920e-5638.04TNS1 protein (Fragment) OS=Homo sapiens OX=9606 GN... [more]
A1A4J41.240e-5538.96TNS1 protein (Fragment) OS=Bos taurus OX=9913 GN=T... [more]
Q9DBT62.576e-5537.95Tensin 1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=... [more]
back to top
BLAST of Tensin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000049936.11.339e-5139.06pep primary_assembly:Astyanax_mexicanus-2.0:13:818... [more]
TNS31.478e-5037.13tensin-3 [Source:NCBI gene;Acc:103027377][more]
tns2b1.369e-4936.23tensin 2b [Source:ZFIN;Acc:ZDB-GENE-101001-5][more]
tns2b9.509e-4935.93tensin 2b [Source:ZFIN;Acc:ZDB-GENE-101001-5][more]
tns1b1.551e-4837.30tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
back to top
BLAST of Tensin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS15.757e-5238.31tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
ENSPMAT00000005743.11.666e-5040.00pep scaffold:Pmarinus_7.0:GL478791:187748:191319:1... [more]
ENSPMAT00000003653.13.096e-4836.81pep scaffold:Pmarinus_7.0:GL476944:428913:445548:-... [more]
ENSPMAT00000001958.11.588e-4334.81pep scaffold:Pmarinus_7.0:GL480048:14054:23824:1 g... [more]
ENSPMAT00000010484.18.119e-923.13pep scaffold:Pmarinus_7.0:GL477590:9709:49115:-1 g... [more]
back to top
BLAST of Tensin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tensin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO457831.374e-4934.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457821.457e-925.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450082.165e-832.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276821.537e-731.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tensin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002849.25.954e-5338.85pep primary_assembly:ASM223467v1:2:14075704:140850... [more]
ENSORLT00000002851.29.840e-5239.52pep primary_assembly:ASM223467v1:2:14075704:140871... [more]
TNS35.767e-4937.33tensin-3 [Source:NCBI gene;Acc:101166465][more]
TNS35.845e-4937.33tensin-3 [Source:NCBI gene;Acc:101166465][more]
TNS36.245e-4937.33tensin-3 [Source:NCBI gene;Acc:101166465][more]
back to top
BLAST of Tensin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060707.10.000e+099.55SMESG000060707.1[more]
SMESG000060707.10.000e+097.36SMESG000060707.1[more]
SMESG000060707.10.000e+099.56SMESG000060707.1[more]
SMESG000019881.12.501e-4838.78SMESG000019881.1[more]
SMESG000033851.15.288e-4326.83SMESG000033851.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027069 ID=SMED30027069|Name=Tensin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3847bp
GAATCGATCAGCACCGATAATTCAAAAATCGATTTCTGTGCCATTGTCAT
AGGATTTGTGTCAGTGCTAAGCCTAATCAATCTCACTATCAAATCGATGA
TCATAGTTCACAAATATTAAAATATTATTAGCACATTTTCACATAGTAGA
TTATAAAAATTTTAATATTAGCACATTCGTACCTGCTGGAATATTACAGA
AAAATTCGAATGAATTCCAAACTTGAAAGAATAGAAAATGTTTGTCAAAA
TCAAAATAAGTCCACAGAAAATGAAATTAAAAGACTCACTTCATATCAAT
GTAGTCTGTGCAAAATGGACCATGAAAAGAAAAAATATGATGCAAGTTTT
AGTCTGTCGGTAAACCAGCCATCATTTCCGGATGAAAAATCCAAACTCTA
TACAATATTTGAAAATATTTTTGTAATTTGCTGTCCGGAGGCTGAAATTC
GACATAAAGTTCAACATGAAATCATTTATTCTGCTTTATTGAAGATAACT
CAATGCTTTAAAAATGCCAAGATTAAGATGTATTGCTTGACAGAAATGTG
CCCAGACTCATTGAAATTATGCGATACAGCTGTCAATTTTTATACTGATT
TGTCAAAGCCCCCCAAATTGAAATCTATACTCATATTTTGTGAAAGCCTT
TTTGATTGGTTAGCAAAAGCGAATGAAAATCGCGCTCTCATTTGCTGCCA
GGGGCCAGCGTCAATTATTGTTTTGATGATTTACGCATATTCTTGTTTTT
ATGACGCATTTCCACGACGTGATATCAGATTGAGTACTGCACTAAAGATA
TTTATCACAAAAAATATCAAAGAGCTCGAAAAGATTCCAATATCATATAA
AAGATATAGTAGTTACATGAGTTTATATTCTTGCATGAATCAGTTACAAA
GTCTCCGGTCATCAGTTTATTTGTATTGCCTCATTCTTTACAGCTTTCCA
TGTATGGAACCCGACAGTGATAAATCTAGTCAATTATTTTTTAAGTTTTA
CACCAATGAACCTCTGACTTGCGTCCATACGACTAAGTTGTATTCTTTAC
AGGCAAGTGTCAGTCGATTAGTTATTTTATTTGATAACATTCCAATCTCC
TTACAAAATGATTCCATGATTCTTTGCTATCACAGATCTACTTCGGCAAC
TAGAAGGATCAAGTTATTCCGTTTGAACTTCCATACTTGCCAAGCGATTT
GCGATGTGTTGACTTTCCACAGCCAAGATTTTGAAGACGTATATCAAGCC
TGCCCGATGAAAATGAAACTCGATTTGTATTTTAGAGAAACGGCCGTATT
TGGACAAGGCGAAAGCGATTTGTTCGTAGAGACAAGTCACAGTGATTTAT
CATCAATTGAACGTACTGATTCATATACATTTCTGGAGAACGATGAGAAT
TCCAACAAAATGGGGTCAACTATTATCATTCAAAGAAAAGCAGACATTCA
AAACCAAACTATTGAAAATAAAGTTCCCTGTGACAATGGACAACGTGACA
TTACCTCTATAACTATTTACAAAACCTCAGTTGAAGACCGCCGTGAAGAT
GTAAATGAAGAACTGACAGAAAAACGAAATTTAAAAGTAATTAATCAAAG
TGGACAAATAAGTGGGCCCGTCGATTCTTATCATTCAACGAAATTGGATA
CTGTTCGTACTTCATCGTCGGTACTCAATGGATCGGGATCAATGAATACT
GAATTCAATCATTCGACTTATAATCCCGGCTATCATAGTTATGATTCGCA
TTCCATGTCAAATAACGATCGTGACAAATGCAGTCAACAACTAGATACTT
TGATGAAAGATCTAAATCTTGATAACAAGTCTGCATTTCATGGATCTAGA
ATGAATTCCAGCTACTACACGTCACATGCAGATAATGCAAACAATGACAA
TTCTCAGAATAAAATCGCAAATCGTGAGCTGCAATTAATGACGGAATTAT
TAGAAGCGCAAAAAGAAATTTCGAATTTGCGAAGATCCATGAATCATTTG
GATCTGCTTGAACAATCGTCAACAAATCGAGGATTTACTAACAAGAATCC
TAATAATAATTTCTTGTCGACATCCAAATTTAAAGGAATGACAAAAACTT
CAGTAAGCAGTTCAATTCCAGATACTTATAATTACAGTACACCAAGAAGC
AGCAATTTGTCAAATAATAGATTAAATAATAACTCAAGTGTAAGTCCTAA
TATACAAAGATCTACGAAATTCAACGCAGCTCCAATTAATGCGTTTACAA
GTGAAACAAGAACTATTAATGATTTCTTAGATAATCGACAAACCAAATAT
TCTGCCCATCGGGAAAATATGGATAGAGATAGAATGATGAGAGAGAAATT
TATACCCCATGAAAGAATTTCTCATCAAAATTTCCAAGATGACAGAGAAT
CAACTGATGTGTTTGAAGAGGTGGAAACGATTAATTTACAGCCGATTGGA
AAAGGTATTCAAGATTTGAATAAAGGTAATCTGCAGCATAGAATTCCAAT
GGGCACAGCAAAAATTGAAAGCACAAGTCATTTGTTCAATGAGAATATTG
GAAGTCTTTCTCCTTTGTCATCTAGAAAATTTCCGATGCAAAATAAGGTT
GAAACAAGTAGTTTTTCACGCCTCAATAGCGAAATTAGTTCACCTCCGAT
GAGTTACAACGGTCAACAACAAAATCTAACTTTACAATCGGTCGAGGAAA
AAATGAAATATTGGTACCAGCCTCACATATCGAGAGAGGAAGCTATTGCT
ATGTTAAAGAATTGTAATCCTGGAAATTTCCTAATTCGAGACAGCAATAC
ATATTCAGGAGCTTATGGACTTGCAATAAAGGTCGCCATGATTCCCCAAA
ACGTCACTGTCAAATCAGATGATCTCGAATCAGAAAAGGTGAGGCATTAT
TTAATAGAGCTTTCGGGAAATCAAGGTGTGAGTTTCAAAGGATTTCCAGA
AGAACCGATTTTTCCTTCACTTTCCCATCTGGTTTTATATTATACTCACG
CTGCAAGTGTGTTACCGTGCTTCCTTGTACTACCAGACAGACCTCTTGAT
CAAACTGATAACGGAAAAGGCATCAAAACCCATGTCAGTAGTCACTCAGT
GATTATCAGCTCTCCAAAATTGAACTCGTTGAAAAAATCTGATGAAACAG
GATATTCTGTCTATTATTTAGGATGCTACGATGTAGAATATATTACTGGG
CCATCGGTTATAAATAAAGCTATCGAACGACTGTTGGGAAACATCGATGC
GAGAAGTTTTACAGAATGTCAAATGCGGATTAATTCTGGAGAAGGAATTG
TGTTAACTGACTTGGAACGGAAATTATTCTTCCGACGTCATCATCCATTT
TCTTCCATCACATACTGTGCTTTAGATCCAAAGGACCGGAAGATCGAATT
GGAAGTGTGCAAATCGAAGGGAGTCAAAAAAACAAAAATCTTTGGCATCA
TAGTCAAGGCATATATGGCAGGAGAAAATAAATGTTTCCTGTTCGGAGAA
CTGGATCCATCACACAAGGCTCATCTGATAGTAAAAATTATCAACGAACA
AATACTGAAATCTACAGAAAATTAAATTTCAATTAAGAAATTATTTGTAA
AAAAATATTGTACTAATTTTTGGTTGGGAGAAAATTTTTATCCTCAATTG
TTTTACTGGTAGACTCATTGGCATGCTATATTTGATATAAATACATCTGA
TACATTTATATGATATTTGACATTTAATAAATATTTGATCACTTCTTCAC
TTCTTGGAGTTGAGCAGCTTGGAGCATGACAAGAGGCATTGGAATTTATA
TTATACCATATTTTCTGTTAGTATTTTGTCTTCATTGTGTGTGTTAA
back to top

protein sequence of SMED30027069-orf-1

>SMED30027069-orf-1 ID=SMED30027069-orf-1|Name=SMED30027069-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1122bp
MNSKLERIENVCQNQNKSTENEIKRLTSYQCSLCKMDHEKKKYDASFSLS
VNQPSFPDEKSKLYTIFENIFVICCPEAEIRHKVQHEIIYSALLKITQCF
KNAKIKMYCLTEMCPDSLKLCDTAVNFYTDLSKPPKLKSILIFCESLFDW
LAKANENRALICCQGPASIIVLMIYAYSCFYDAFPRRDIRLSTALKIFIT
KNIKELEKIPISYKRYSSYMSLYSCMNQLQSLRSSVYLYCLILYSFPCME
PDSDKSSQLFFKFYTNEPLTCVHTTKLYSLQASVSRLVILFDNIPISLQN
DSMILCYHRSTSATRRIKLFRLNFHTCQAICDVLTFHSQDFEDVYQACPM
KMKLDLYFRETAVFGQGESDLFVETSHSDLSSIERTDSYTFLENDENSNK
MGSTIIIQRKADIQNQTIENKVPCDNGQRDITSITIYKTSVEDRREDVNE
ELTEKRNLKVINQSGQISGPVDSYHSTKLDTVRTSSSVLNGSGSMNTEFN
HSTYNPGYHSYDSHSMSNNDRDKCSQQLDTLMKDLNLDNKSAFHGSRMNS
SYYTSHADNANNDNSQNKIANRELQLMTELLEAQKEISNLRRSMNHLDLL
EQSSTNRGFTNKNPNNNFLSTSKFKGMTKTSVSSSIPDTYNYSTPRSSNL
SNNRLNNNSSVSPNIQRSTKFNAAPINAFTSETRTINDFLDNRQTKYSAH
RENMDRDRMMREKFIPHERISHQNFQDDRESTDVFEEVETINLQPIGKGI
QDLNKGNLQHRIPMGTAKIESTSHLFNENIGSLSPLSSRKFPMQNKVETS
SFSRLNSEISSPPMSYNGQQQNLTLQSVEEKMKYWYQPHISREEAIAMLK
NCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIE
LSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTD
NGKGIKTHVSSHSVIISSPKLNSLKKSDETGYSVYYLGCYDVEYITGPSV
INKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSI
TYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDP
SHKAHLIVKIINEQILKSTEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005515protein binding
GO:0003779actin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR000980SH2
IPR014020Tensin_C2-dom
IPR006020PTB/PI_dom
IPR011993PH-like_dom_sf
IPR013625PTB
IPR000008C2_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005925focal adhesion
GO:0009986cell surface
GO:0030054cell junction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 180..200
NoneNo IPR availableCOILSCoilCoilcoord: 38..58
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 203..263
NoneNo IPR availablePANTHERPTHR45734FAMILY NOT NAMEDcoord: 40..718
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 582..714
IPR000980SH2 domainPRINTSPR00401SH2DOMAINcoord: 435..449
score: 37.86
coord: 454..464
score: 52.58
coord: 493..503
score: 35.58
coord: 466..477
score: 25.36
coord: 517..531
score: 38.77
IPR000980SH2 domainSMARTSM00252SH2_5coord: 433..534
e-value: 2.1E-20
score: 83.8
IPR000980SH2 domainPFAMPF00017SH2coord: 435..528
e-value: 2.9E-10
score: 40.1
IPR000980SH2 domainPROSITEPS50001SH2coord: 435..543
score: 16.722
IPR006020PTB/PI domainSMARTSM00462PTB_9coord: 577..721
e-value: 1.1E-4
score: 31.5
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 431..540
e-value: 6.4E-31
score: 108.9
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 419..537
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 572..721
e-value: 2.4E-34
score: 120.1
IPR013625Tensin/EPS8 phosphotyrosine-binding domainPFAMPF08416PTBcoord: 582..716
e-value: 3.4E-11
score: 43.4