C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30027056
Length (bp)1611
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30027056) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30027056) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30027056) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30027056) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y2E3I7 (Uncharacterized protein (Fragment) OS=Araneus ventricosus OX=182803 GN=AVEN_94904_1 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.156e-25
Identity = 92/298 (30.87%), Postives = 147/298 (49.33%), Query Frame = 3
Query:  630 VQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEK---DGEIK---DNFFSNSACVFSDSFLADGVS----RLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKN 1493
            V+  + D +V++LQ    +  ++K    + I+F +   DG+++     F S        S + D +     ++ E +++F   GSGW    +  ++    TY+P   LA  S+IP P  L  KKA++N+KNTD  CF++SVL+ L    V KN +RVS YT+   EL    +T CP++ C +P  E+ N   NL INVF Y         D +  P       ++ +K      INLL +  GD+ HY  I N++RLL        N + +  +C  CL+ F  +   K H+  C ++
Sbjct:  243 VRPQIHDMIVDELQ----EKRAIKWYCVSKIRFSRETPDGDVEYCTPYFRSKVVIELDTSMIGDHIEQAFDKIKESVDEFLKNGSGWVFDSVIHMELKTATYHP---LAPSSYIPLPSKLAAKKAVINIKNTDQKCFVWSVLAALHP--VGKNADRVSHYTSMEQELQLGKVT-CPVQPCKVPIIEKLN---NLRINVFGY--------EDDEVFP-------LYISKREDTRVINLLYITQGDDKHYCLIKNMSRLLG----DLTNHKAKAFYCYSCLHRFTTESLLKDHLPYCKEH 508          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y2ETR7 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_91292_1 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.495e-25
Identity = 92/298 (30.87%), Postives = 147/298 (49.33%), Query Frame = 3
Query:  630 VQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEK---DGEIK---DNFFSNSACVFSDSFLADGVS----RLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKN 1493
            V+  + D +V++LQ    +  ++K    + I+F +   DG+++     F S        S + D +     ++ E +++F   GSGW    +  ++    TY+P   LA  S+IP P  L  KKA++N+KNTD  CF++SVL+ L    V KN +RVS YT+   EL    +T CP++ C +P  E+ N   NL INVF Y         D +  P       ++ +K      INLL +  GD+ HY  I N++RLL        N + +  +C  CL+ F  +   K H+  C ++
Sbjct:  347 VRPQIHDMIVDELQ----QKKAIKWYCVSKIRFSRETPDGDVEYCMPYFRSKVVIELDTSMIGDHIEQAFDKIKESVDEFLKNGSGWVFDSVIHMELKTATYHP---LAPSSYIPLPSKLAAKKAVINIKNTDQKCFVWSVLAALHP--VGKNADRVSHYTSMEQELRLGKVT-CPVQPCKVPIIEKFN---NLRINVFGY--------EDDEVFP-------LYISKREDTRVINLLYITQGDDKHYCLIKNMSRLLG----DLTNHKAKAFYCYSCLHRFTTESLLKDHLPYCKEH 612          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y2GN36 (Uncharacterized protein (Fragment) OS=Araneus ventricosus OX=182803 GN=AVEN_232847_1 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 6.821e-25
Identity = 87/283 (30.74%), Postives = 140/283 (49.47%), Query Frame = 3
Query:  675 EIKKMGSVKVQFTALIQFEK---DGEIK---DNFFSNSACVFSDSFLADGVS----RLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKN 1493
            E+++  ++K    + I+F +   DG+++     F S        S + D +     ++ E +++F   GSGW    +  ++     Y+P   LA  S+IP P  L  KKA++N+KNTD  CF++SVL+ L    V KN ERVS Y +   EL   ++T CP++ C +P  E+ N   NL INVF Y         D +  P       ++ +K      INLL +  GD+ HY  I N++RLL        N + +  +C  CL+ F  +   K H++ C ++
Sbjct:  226 ELQEKRAIKWYCVSKIRFSRETPDGDVEYCTPYFRSKVVIELDTSMIGDHIEQAFDKIKESVDEFLKNGSGWVFDSVIHMELKTAAYHP---LAPSSYIPLPSKLAAKKALINIKNTDQKCFVWSVLAALHP--VGKNAERVSHYVSMEQELRLGNVT-CPVQPCKVPIIEKLN---NLRINVFGY--------EDDEVFP-------LYISKREDIQAINLLYITQGDDKHYCLIKNMSRLL----GDLTNHKAKAFYCYSCLHRFSAESLLKDHLSYCKEH 480          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y2WJZ7 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_144343_1 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.362e-24
Identity = 92/298 (30.87%), Postives = 145/298 (48.66%), Query Frame = 3
Query:  630 VQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEK---DGEIK---DNFFSNSACVFSDSFLADGVS----RLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKN 1493
            V+  + D +V++LQ    +  ++K    + I+F +   DG+++     F S        S + D +     ++ E +++F   GSGW    +  ++    TY+P   LA  S+IP P  L  KKA++N+KNTD  CFI+SVL+ L    V KN ERVS Y +   EL   ++T CP++ C +P  E+ +   NL INVF Y         D +  P    L +  R  +     INLL +  GD+ HY  I N++RLL            +  +C  CL+ F  +   K H+  C ++
Sbjct:  232 VRPQIHDMIVDELQ----QKKAIKWYCVSKIRFSRETPDGDVEYCTPYFRSKVVIELDTSMIGDHIEQAFDKIKESVDEFLKNGSGWVFDSVIHMELKTATYHP---LAPSSYIPLPSKLAAKKALINIKNTDQKCFIWSVLAALHP--VGKNAERVSHYVSMEQELRLGNVT-CPVQPCKVPIIEKLS---NLRINVFGY--------EDDEVFP----LYISKREDI---QVINLLYITQGDDKHYCLIKNMSRLLG----DLTKHNPKAFYCYSCLHRFSAESLLKDHLPYCKEH 497          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4Y2S2Z6 (Uncharacterized protein (Fragment) OS=Araneus ventricosus OX=182803 GN=AVEN_82606_1 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.462e-23
Identity = 89/298 (29.87%), Postives = 145/298 (48.66%), Query Frame = 3
Query:  630 VQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEK---DGEIK---DNFFSNSACVFSDSFLADGVS----RLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKN 1493
            V+  + D +V++LQ    +  ++K    + I+F +   DG+++     F S        S + D +     ++ E +++F   GSGW    +  ++    TY+P   LA  S+IP P  L  KKA++N+KNTD  CF++SVL+ L    V  + ERV  YT+   EL   ++T CP++ C +P  E+ N   NL INVF Y +                 + L++ +K      INLL +  GD+ HY  I N++RLL   +     T     +C  CL+ F  +   K H+  C ++
Sbjct:  215 VRPQIHDMIVDELQ----QKKAIKWYCVSKIRFSRETPDGDVEYCTPYFRSKVVIELDTSMIGDHIEQAFEKIKESVDEFLKNGSGWVFDSVIHMELKTATYHP---LAPSSYIPLPSKLAAKKALINIKNTDQKCFVWSVLAAL-HPAVGPHPERVYHYTSLEQELRLGNVT-CPVQPCKVPIIEKLN---NLRINVFGYEDD---------------EVFLLYISKREEIQVINLLYITQGDDKHYCLIKNMSRLLGDLTKFNGETF----YCYSCLHRFTTESFLKNHLPYCNEH 481          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO44110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWZ0])

HSP 1 Score: 98.9821 bits (245), Expect = 1.106e-22
Identity = 74/226 (32.74%), Postives = 114/226 (50.44%), Query Frame = 3
Query:  828 IEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKN-TDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDE-LNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHP-HLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKNK 1496
            +EKF   GSGWR  ++   D  +    P   L+G S+IP P  L  KKAI+NVKN +DH CF ++V S +       + ER++   T   +  N+  I + P+ L  I +FE+ N     A+NV+ Y  +             +P  ++  H T+      INLLL+ D +  HY  I N++RLL   SS   + +   ++CP CLN F+  +  + H   C+KN+
Sbjct:    9 VEKFQKQGSGWRFDQVEYFDINID---PXKPLSGSSYIPLPSELASKKAIINVKNESDHECFKWAVTSAIYPKET--HPERLNKQMTESSKNFNWSGI-EFPISLKQIDEFEKQNPH---AVNVYGYEGSV------------YPLRISKRHDTRT-----INLLLISDDETNHYCWIKNMSRLL---SSQIGDHQHASEFCPRCLNSFWCKEALERHSEYCSKNE 205          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO34080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQD5])

HSP 1 Score: 96.6709 bits (239), Expect = 4.058e-21
Identity = 74/226 (32.74%), Postives = 113/226 (50.00%), Query Frame = 3
Query:  828 IEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNT-DHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDE-LNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHP-HLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKNK 1496
            +EKF   GSGWR  ++   D  +  + P   L+G S+IP    L  KKAI+NVKN  DH CF ++V S +       + ER++   T   +  N+  I + P+ L  I +FE+ N     A+NV+ Y  +             +P  ++  H T+      INLLL+ D +  HY  I N++RLL   SS   + +   ++CP CLN F+  K  + H   C+KN+
Sbjct:  362 VEKFQKQGSGWRFDQVEYFDINIDPFKP---LSGSSYIPLLSELASKKAIINVKNENDHECFKWAVTSAIYPKET--HPERLNKQMTESSKNFNWSGI-EFPISLKQIDEFEKQNPH---AVNVYGYEGSV------------YPLRISKRHDTRT-----INLLLISDDETNHYCWIKNMSRLL---SSQIGDHQHASEFCPRCLNSFWCKKALERHSEYCSKNE 558          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO48021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKP4])

HSP 1 Score: 90.5077 bits (223), Expect = 2.544e-19
Identity = 75/231 (32.47%), Postives = 109/231 (47.19%), Query Frame = 3
Query:  807 VSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKN-TDHSCFIYSVLSIL----KRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLC 1484
            V+ L E IE+F   GSGWR  ++   D  +  + P   L+G S+I  P  L  K+AI+NVKN  DH CF ++V S +    K    L  + R SS      + ++  I + P+ L  I KFE+ N      +NVF YN          +  P          +K      INLLL+ + +  HY  I +++RLL   SS   N +   ++CP CLN F+  K  + H   C
Sbjct:  198 VNYLLELIERFQNKGSGWRFDQVEYFDINIDPFEP---LSGSSYIQLPSKLASKQAIINVKNKNDHECFKWAVTSAMYPRGKDPQRLNEQIRESS-----KKFDWAGI-EFPVSLKQIDKFEKQNP---YTVNVFGYNG---------EVFPRRI-------SKKRNARVINLLLISNDETNHYCWIKDMSRLL---SSQINNHQHATEFCPRCLNPFWCKKALEKHSEYC 397          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 88.5817 bits (218), Expect = 2.732e-18
Identity = 78/242 (32.23%), Postives = 113/242 (46.69%), Query Frame = 3
Query:  780 FSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKN-TDHSCFIYSVLSIL--KRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKNK 1496
            FSD F A   + L   +EKF   GSGW+  ++   D  +  + P   L+G S++  P+ L  KKAI+NV+N  DH CF ++V S +  KRD    N +R+S       E    S  + P+ L  I KFER N      +NVF Y     K++  +      P             N INLLL+ +G+  HY  I ++  L++       +TR     C  CLN F   K  + H   C+KN+
Sbjct:  570 FSDLFNA-MTNPLIGLVEKFQKQGSGWQFDRVEYFDINIDPFDP---LSGSSYVELPKELAVKKAIINVRNENDHKCFKWAVTSAVYPKRD----NPQRLSRKMMENSERFDWSGIEFPVSLRQIDKFERQNPH---TVNVFTYE---EKKICPLRISGKDPF------------NAINLLLISNGETSHYCWIKDVMSLVSSQIDKYHHTRF---LCFRCLNSFRCKKALEKHYEYCSKNE 782          
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Match: EDO34977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMS5])

HSP 1 Score: 87.8113 bits (216), Expect = 3.390e-18
Identity = 71/226 (31.42%), Postives = 106/226 (46.90%), Query Frame = 3
Query:  828 IEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKN-TDHSCFIYSVLSIL--KRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKNK 1496
            +EKF   GSGW+  ++   D  +  + P   L+G S++  P+ L  KKAI+NV+N  DH CF ++V S +  KRD    N +R+S       E    S  + P+ L  I KFER N      +NVF Y     K++  +      P             N INLLL+ +G+  HY  I ++  L++       +TR     C  CLN F  +   + H   C+KN+
Sbjct:  158 VEKFQKQGSGWQFDRVEYFDINIDPFDP---LSGSSYVELPKELAVKKAIINVRNENDHKCFKWAVTSAVYPKRD----NPQRLSRKMMENSERFDWSGIEFPVSLRQIDKFERQNPH---TVNVFTYEE---KKICPLRISGKDPF------------NAINLLLISNGETSHYCWIKDVMSLVSSQIDKYHHTRF---LCFRCLNSFRCEMALEKHYEYCSKNE 355          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000066165.1 (SMESG000066165.1)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 412/418 (98.56%), Postives = 412/418 (98.56%), Query Frame = 3
Query:  192 MESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKKALFQMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPADKIVPCIPAXXXXXXXXXSDDETEYNQIGGSVXXXXXXXXXXXXXLRGSRKNIRFDLENQNLVQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSACVFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGF 1445
            MESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKK LFQMINAKNASNNNTNNTKITKNNNTTVTKK KRPADKIVPCIPAKIKKIEIIISDDETEYNQIGGSVNIEINDEPEIEIDLRGSRKNIRFDLENQNLVQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNS CVFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNC SSSECNTRI VKWCPHCLNG 
Sbjct:    1 MESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKKTLFQMINAKNASNNNTNNTKITKNNNTTVTKKLKRPADKIVPCIPAKIKKIEIIISDDETEYNQIGGSVNIEINDEPEIEIDLRGSRKNIRFDLENQNLVQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSVCVFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCRSSSECNTRIHVKWCPHCLNGL 418          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000037212.1 (SMESG000037212.1)

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 399/441 (90.48%), Postives = 405/441 (91.84%), Query Frame = 3
Query:  114 ITYLSGRLYKNYCQSGIGHNSKCHTTMESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKKALFQMXXXXXXXXXXXXXXXXXXXXXXXXXXX--------XXRPADKIVPCIPAXXXXXXXXXSDDETEYNQIGGSVXXXXXXXXXXXXXLRGSRKNIRFDLENQNLVQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSACVFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIR 1412
            I+Y   RLYKNYCQSGIGHNSKCHTTME+YYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFK NK ALFQMINAKN  NNN NNT  TK                 SKRPADKIV CIPAKIKKIEIIISDDETEYNQ+ GSVN EINDEPEIE+DLR SRKNIRFDLENQNLVQIALTDKLVNKLQ EIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSA VFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILT+YYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYD ITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHL LIHRTKVIGGNPINLLLLQDGDN+HYTAIFNLNR LNCHSSSECNTRIR
Sbjct:  665 ISYKKCRLYKNYCQSGIGHNSKCHTTMENYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKSNKNALFQMINAKNVINNNNNNTNNTKITKKINNNTTVTKNNKKSKRPADKIVSCIPAKIKKIEIIISDDETEYNQLEGSVNNEINDEPEIEVDLRSSRKNIRFDLENQNLVQIALTDKLVNKLQNEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSASVFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTSYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDPITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLVLIHRTKVIGGNPINLLLLQDGDNYHYTAIFNLNRQLNCHSSSECNTRIR 1105          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000066165.1 (SMESG000066165.1)

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 376/379 (99.21%), Postives = 376/379 (99.21%), Query Frame = 3
Query:  192 MESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKKALFQMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPADKIVPCIPAXXXXXXXXXSDDETEYNQIGGSVXXXXXXXXXXXXXLRGSRKNIRFDLENQNLVQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSACVFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDG 1328
            MESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKK LFQMINAKNASNNNTNNTKITKNNNTTVTKK KRPADKIVPCIPAKIKKIEIIISDDETEYNQIGGSVNIEINDEPEIEIDLRGSRKNIRFDLENQNLVQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNS CVFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDG
Sbjct:    1 MESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKKTLFQMINAKNASNNNTNNTKITKNNNTTVTKKLKRPADKIVPCIPAKIKKIEIIISDDETEYNQIGGSVNIEINDEPEIEIDLRGSRKNIRFDLENQNLVQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSVCVFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDG 379          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000057427.1 (SMESG000057427.1)

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 365/466 (78.33%), Postives = 375/466 (80.47%), Query Frame = 3
Query:  111 IITYLSGRLYKNYCQSGIGHNSKCHTTMESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKKALFQMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPADKIVPCIPAXXXXXXXXXSDDETEYNQIGGSVXXXXXX--XXXXXXXLRGSRKNIRFDLENQNLVQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSACVFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKNKIG 1502
            +I+Y   RLYKNYCQSGIGHNSK H TMESYYG RFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKIN              NNNT  TK  K +         RPADKIV CIPAKIKKIEIIISDDETEYNQIGGSVN EIN   EPEIE+DLRGSRKNIRFDLENQNLVQIAL DKLVNKLQ EIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSACVFSDSFLADGVSRLNEKIEKFTYLG+G                        HSFIPTPESLVGKKAIVNVKNTD SCF+YSVLSILKRDIVLKNRERVSSYTTFMDELNYD ITDCPMRLC+IPKFERNNSDLNLAINV EYNNTPSKQLNDIDYV HHPHL LIHRTKVIGGNPIN L                  LLNCHSSSECNTRIRVKWC HCLNGFYY+KTFKAHV+LC KN+IG
Sbjct:  886 VISYKKSRLYKNYCQSGIGHNSKFHMTMESYYGQRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINNNNNTNNTKITKNINNNTTVTKNNKKSK--------RPADKIVLCIPAKIKKIEIIISDDETEYNQIGGSVNNEINVNDEPEIEVDLRGSRKNIRFDLENQNLVQIALIDKLVNKLQNEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSACVFSDSFLADGVSRLNEKIEKFTYLGTG------------------------HSFIPTPESLVGKKAIVNVKNTDPSCFMYSVLSILKRDIVLKNRERVSSYTTFMDELNYDPITDCPMRLCSIPKFERNNSDLNLAINVIEYNNTPSKQLNDIDYVSHHPHLVLIHRTKVIGGNPINHL------------------LLNCHSSSECNTRIRVKWCLHCLNGFYYEKTFKAHVDLCAKNQIG 1301          

HSP 2 Score: 53.5286 bits (127), Expect = 3.847e-7
Identity = 25/41 (60.98%), Postives = 31/41 (75.61%), Query Frame = 1
Query: 1504 QNLPLNDYSTL-----VIFADLEAILPKDIKHHQIHMPISA 1611
            +NL   +YS +     VI+AD EA+LPKD+KHHQIHMPISA
Sbjct: 1311 KNLIFKNYSKMITPPFVIYADFEAVLPKDVKHHQIHMPISA 1351          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000057427.1 (SMESG000057427.1)

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 365/466 (78.33%), Postives = 375/466 (80.47%), Query Frame = 3
Query:  111 IITYLSGRLYKNYCQSGIGHNSKCHTTMESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKKALFQMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPADKIVPCIPAXXXXXXXXXSDDETEYNQIGGSVXXXXXX--XXXXXXXLRGSRKNIRFDLENQNLVQIALTDKLVNKLQIEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSACVFSDSFLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFIPTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFMDELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDYVPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSSECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKNKIG 1502
            +I+Y   RLYKNYCQSGIGHNSK H TMESYYG RFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKIN              NNNT  TK  K +         RPADKIV CIPAKIKKIEIIISDDETEYNQIGGSVN EIN   EPEIE+DLRGSRKNIRFDLENQNLVQIAL DKLVNKLQ EIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSACVFSDSFLADGVSRLNEKIEKFTYLG+G                        HSFIPTPESLVGKKAIVNVKNTD SCF+YSVLSILKRDIVLKNRERVSSYTTFMDELNYD ITDCPMRLC+IPKFERNNSDLNLAINV EYNNTPSKQLNDIDYV HHPHL LIHRTKVIGGNPIN L                  LLNCHSSSECNTRIRVKWC HCLNGFYY+KTFKAHV+LC KN+IG
Sbjct:  864 VISYKKSRLYKNYCQSGIGHNSKFHMTMESYYGQRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINNNNNTNNTKITKNINNNTTVTKNNKKSK--------RPADKIVLCIPAKIKKIEIIISDDETEYNQIGGSVNNEINVNDEPEIEVDLRGSRKNIRFDLENQNLVQIALIDKLVNKLQNEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSACVFSDSFLADGVSRLNEKIEKFTYLGTG------------------------HSFIPTPESLVGKKAIVNVKNTDPSCFMYSVLSILKRDIVLKNRERVSSYTTFMDELNYDPITDCPMRLCSIPKFERNNSDLNLAINVIEYNNTPSKQLNDIDYVSHHPHLVLIHRTKVIGGNPINHL------------------LLNCHSSSECNTRIRVKWCLHCLNGFYYEKTFKAHVDLCAKNQIG 1279          

HSP 2 Score: 53.5286 bits (127), Expect = 4.011e-7
Identity = 25/41 (60.98%), Postives = 31/41 (75.61%), Query Frame = 1
Query: 1504 QNLPLNDYSTL-----VIFADLEAILPKDIKHHQIHMPISA 1611
            +NL   +YS +     VI+AD EA+LPKD+KHHQIHMPISA
Sbjct: 1289 KNLIFKNYSKMITPPFVIYADFEAVLPKDVKHHQIHMPISA 1329          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2E3I71.156e-2530.87Uncharacterized protein (Fragment) OS=Araneus vent... [more]
A0A4Y2ETR71.495e-2530.87Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2GN366.821e-2530.74Uncharacterized protein (Fragment) OS=Araneus vent... [more]
A0A4Y2WJZ78.362e-2430.87Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2S2Z62.462e-2329.87Uncharacterized protein (Fragment) OS=Araneus vent... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441101.106e-2232.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340804.058e-2132.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480212.544e-1932.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461092.732e-1832.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349773.390e-1831.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066165.10.000e+098.56SMESG000066165.1[more]
SMESG000037212.10.000e+090.48SMESG000037212.1[more]
SMESG000066165.10.000e+099.21SMESG000066165.1[more]
SMESG000057427.13.847e-778.33SMESG000057427.1[more]
SMESG000057427.14.011e-778.33SMESG000057427.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027056 ID=SMED30027056|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1611bp
ATATGATTTGAAATACGAATATTAATTTTTATAAATATTTACATAATTAT
CATCATTTATATATTATTATTTGATTCATATATGATTTAAATAATAATAA
ACATTTGATAATAATTACATATTTATCAGGTCGTTTGTATAAAAACTATT
GCCAATCTGGAATTGGTCATAACTCGAAATGCCATACGACTATGGAAAGT
TACTATGGTCATAGATTCTATGGCATCGACTTTTTTATTTGCCCTAAATG
CGATACAGCCCAAGACATTGAATATCTAGAGTTTTATAAGAAACACTCTA
GCCATTTAAATCAATTTAAAATTAATAAAAAGGCATTATTTCAAATGATT
AATGCGAAAAATGCTAGTAATAATAACACAAACAATACAAAGATCACTAA
AAACAATAATACAACTGTTACTAAAAAATCAAAAAGACCTGCTGATAAAA
TCGTGCCGTGTATCCCTGCTAAAATTAAAAAAATAGAAATCATCATTAGT
GATGACGAAACTGAATATAATCAAATAGGGGGTTCTGTAAATATTGAAAT
AAACGATGAACCTGAAATAGAGATTGACTTAAGAGGTTCCCGTAAAAATA
TTCGATTTGATTTAGAAAATCAAAATCTTGTTCAAATCGCCCTAACTGAT
AAACTTGTAAATAAATTACAAATCGAAATAAAGAAAATGGGATCTGTAAA
AGTTCAGTTTACAGCTCTCATTCAATTTGAAAAAGATGGGGAAATAAAAG
ATAATTTCTTTTCGAATAGCGCGTGTGTCTTTTCCGATAGTTTTCTTGCA
GATGGTGTGAGTCGGTTAAATGAGAAAATCGAAAAATTCACATATTTAGG
AAGTGGGTGGCGCGTAGTTAAGATTCGCGAAATCGATTTTATTTTAACCA
CGTATTATCCTGTAAGTCGATTAGCCGGGCATAGTTTTATCCCTACGCCT
GAATCTCTAGTAGGTAAAAAGGCTATTGTAAACGTTAAAAACACAGATCA
TTCGTGTTTTATATATAGTGTCTTATCGATTTTAAAGCGTGATATAGTTT
TAAAGAATAGGGAGCGTGTTTCTTCTTACACTACTTTTATGGATGAATTG
AATTATGATTCAATTACAGATTGTCCAATGAGACTCTGTAACATACCCAA
ATTTGAGAGAAATAATAGCGATTTAAATTTGGCCATCAATGTCTTTGAAT
ATAACAACACCCCTTCTAAACAATTGAATGACATTGATTATGTACCTCAT
CATCCTCACCTTGCCTTAATTCATCGAACAAAGGTTATCGGTGGTAACCC
GATTAATCTTTTATTATTACAAGACGGTGATAATTTTCATTATACCGCAA
TTTTTAATTTAAATAGACTGTTGAATTGTCATTCGAGTAGTGAATGTAAC
ACCAGAATTCGCGTAAAATGGTGTCCCCATTGTTTAAACGGTTTTTATTA
TGATAAAACCTTTAAGGCACATGTTAATTTGTGCACTAAAAATAAAATTG
GAACAAAACCTACCATTAAATGATTACTCCACCCTCGTAATTTTTGCGGA
CCTTGAGGCGATTTTACCTAAAGATATTAAACATCACCAAATACACATGC
CGATATCAGCA
back to top

protein sequence of SMED30027056-orf-1

>SMED30027056-orf-1 ID=SMED30027056-orf-1|Name=SMED30027056-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=444bp
MESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKKALF
QMINAKNASNNNTNNTKITKNNNTTVTKKSKRPADKIVPCIPAKIKKIEI
IISDDETEYNQIGGSVNIEINDEPEIEIDLRGSRKNIRFDLENQNLVQIA
LTDKLVNKLQIEIKKMGSVKVQFTALIQFEKDGEIKDNFFSNSACVFSDS
FLADGVSRLNEKIEKFTYLGSGWRVVKIREIDFILTTYYPVSRLAGHSFI
PTPESLVGKKAIVNVKNTDHSCFIYSVLSILKRDIVLKNRERVSSYTTFM
DELNYDSITDCPMRLCNIPKFERNNSDLNLAINVFEYNNTPSKQLNDIDY
VPHHPHLALIHRTKVIGGNPINLLLLQDGDNFHYTAIFNLNRLLNCHSSS
ECNTRIRVKWCPHCLNGFYYDKTFKAHVNLCTKNKIGTKPTIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding