noggin-like protein 1

Overview
Namenoggin-like protein 1 (ABV04324.1)
Smed IDSMED30027052
Length (bp)1028
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of noggin-like protein 1 (SMED30027052) t-SNE clustered cells

Violin plots show distribution of expression levels for noggin-like protein 1 (SMED30027052) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of noggin-like protein 1 (SMED30027052) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for noggin-like protein 1 (SMED30027052) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027052

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027052SMESG000032255.1 SmedASXL_008908SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30027052SMESG000032255.1 dd_Smed_v4_14068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027052SMESG000032255.1 dd_Smed_v4_14068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30027052SMESG000032255.1 dd_Smed_v4_14068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027052SMESG000032255.1 dd_Smed_v6_14068_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30027052SMESG000032255.1 Contig49725uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30027052SMESG000032255.1 Contig49725uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30027052SMESG000032255.1 Contig49725newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30027052SMESG000032255.1 Contig49725newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
body wall musculatureSMED30027052SMESG000032255.1 dd_Smed_v4_14068_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30027052SMESG000032255.1 EF633691.1smed_ncbi_20200123PMID:19174194
Molina et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30027052SMESG000032255.1 EF633691.1smed_ncbi_20200123PMID:19174194
Molina et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30027052SMESG000032255.1 EF633691.1smed_ncbi_20200123PMID:19174194
Molina et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30027052SMESG000032255.1 dd_Smed_v4_14068_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of noggin-like protein 1 vs. Ensembl Human
Match: NOG (noggin [Source:HGNC Symbol;Acc:HGNC:7866])

HSP 1 Score: 66.2402 bits (160), Expect = 5.824e-12
Identity = 48/159 (30.19%), Postives = 71/159 (44.65%), Query Frame = 3
Query:  171 PDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPS---IIYEQTSLEASNNKQLDVLL----------SFKNLSFTD--EKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP   P E  L+  +L+ +LG  +Y+  +M+ + P          +  A +  +LD LL            K L F++   +G+    S+ L   ++ W+  Q  C   Y W  L    WP ++K G C S   CS P GM CK S    L VL+W C
Sbjct:   50 PDPIFDPKEKDLNETLLRSLLG-GHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 1 vs. Ensembl Zebrafish
Match: nog2 (noggin 2 [Source:NCBI gene;Acc:30185])

HSP 1 Score: 68.1662 bits (165), Expect = 5.675e-13
Identity = 44/145 (30.34%), Postives = 65/145 (44.83%), Query Frame = 3
Query:  171 PDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEK-GQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP H P E  L    L + LG  N++ ++MS++ P+ +      E     +L +    K L  T+   G+ +   +       +W+     C   Y WK L    WP +IK G C S   CS+P GM+CK     T   L+W C
Sbjct:   46 PDPEHDPREQDLSEKTLLKKLG-SNFDANFMSIHLPAQLNASAPPELP---RLPMPAELKKLDLTETPYGRRVKVGKKARRKFLQWLWMYTHCPVLYTWKDLGLRFWPRYIKEGNCFSERSCSFPEGMSCKPVKAVTKTFLRWYC 186          
BLAST of noggin-like protein 1 vs. Ensembl Zebrafish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 67.781 bits (164), Expect = 7.636e-13
Identity = 51/196 (26.02%), Postives = 86/196 (43.88%), Query Frame = 3
Query:   66 SVILIFTVWNILREPLIVNTYYSGSLIGTGLD----RSTPDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIY----EQTSLEASNNKQLDVLL-SFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEK 623
            + +LIF++   + E +  + Y    +    L     +  PDP   P E  L+   L+ ILG  ++E ++MS+N P   +    E    E    +   ++    K + F  + G+    S+ L   ++ W+     C   + W+ L    WP ++K G C +   CS P GM CK +    L VL+W C+    G K
Sbjct:    9 ATVLIFSIGFRIEEGMCQHYYLLRPIPSDSLPIVELKEDPDPVLDPKERDLNETELRAILG-SHFEQNFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNKRSCSVPEGMVCKPAKSSHLTVLRWRCVQRKGGLK 203          
BLAST of noggin-like protein 1 vs. Ensembl Zebrafish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 67.781 bits (164), Expect = 7.636e-13
Identity = 51/196 (26.02%), Postives = 86/196 (43.88%), Query Frame = 3
Query:   66 SVILIFTVWNILREPLIVNTYYSGSLIGTGLD----RSTPDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIY----EQTSLEASNNKQLDVLL-SFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEK 623
            + +LIF++   + E +  + Y    +    L     +  PDP   P E  L+   L+ ILG  ++E ++MS+N P   +    E    E    +   ++    K + F  + G+    S+ L   ++ W+     C   + W+ L    WP ++K G C +   CS P GM CK +    L VL+W C+    G K
Sbjct:    9 ATVLIFSIGFRIEEGMCQHYYLLRPIPSDSLPIVELKEDPDPVLDPKERDLNETELRAILG-SHFEQNFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNKRSCSVPEGMVCKPAKSSHLTVLRWRCVQRKGGLK 203          
BLAST of noggin-like protein 1 vs. Ensembl Zebrafish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 67.3958 bits (163), Expect = 1.388e-12
Identity = 51/196 (26.02%), Postives = 86/196 (43.88%), Query Frame = 3
Query:   66 SVILIFTVWNILREPLIVNTYYSGSLIGTGLD----RSTPDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIY----EQTSLEASNNKQLDVLL-SFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEK 623
            + +LIF++   + E +  + Y    +    L     +  PDP   P E  L+   L+ ILG  ++E ++MS+N P   +    E    E    +   ++    K + F  + G+    S+ L   ++ W+     C   + W+ L    WP ++K G C +   CS P GM CK +    L VL+W C+    G K
Sbjct:    9 ATVLIFSLGFRIEEGMCQHYYLLRPIPSDSLPIVELKEDPDPVLDPKERDLNETELRAILG-SHFEQNFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNKRSCSVPEGMVCKPAKSSHLTVLRWRCVQRKGGLK 203          
BLAST of noggin-like protein 1 vs. Ensembl Zebrafish
Match: nog1 (noggin 1 [Source:NCBI gene;Acc:30174])

HSP 1 Score: 60.4622 bits (145), Expect = 2.878e-10
Identity = 41/155 (26.45%), Postives = 72/155 (46.45%), Query Frame = 3
Query:  162 RSTPDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLS------FKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLS 605
            +  PDP + P E  L+   L+  LG  +++  ++S+  P   Y     E  + ++L + L+       KNL F    G+    S+ L   ++ W+   + C   Y W  L    WP +++ G C +   CS P GM CK +    + +L+W C++
Sbjct:   40 KEDPDPLYDPREKDLNETELRSALG--DFDSRFLSVGPPQDRYAGN--EDLDEQELQLNLAGMMPKDIKNLDFDAPWGKKRKASKKLKRRLQMWLWSYSFCPVLYAWNDLGSRFWPRFVRAGSCYTKRSCSVPEGMVCKPAKSTHITLLRWRCVA 190          
BLAST of noggin-like protein 1 vs. Ensembl Xenopus
Match: nog4 (noggin 4 [Source:NCBI gene;Acc:733455])

HSP 1 Score: 75.0998 bits (183), Expect = 4.460e-15
Identity = 43/142 (30.28%), Postives = 66/142 (46.48%), Query Frame = 3
Query:  240 NYEHSWMSMNTPSI------------IYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGIC-SSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKW 626
            +++  WMS+  P+             +Y+  S       Q    L F +L    E     N+S ++   IR+W+VQ+A+C+    W  L    WP W++H  C  +   CSWPPGMAC+Q+    +K+L W C     G  W
Sbjct:   84 SFDPFWMSVEQPADNDTSLLSTLSQDLYDGASRYRKKLAQEAQALDFGSLQLPRELS--ANSSLHVQNEIRQWLVQRASCQLTSTWVDLGTVFWPRWVRHTDCDGANTACSWPPGMACRQAQLTQIKLLAWHCWMKDTGLGW 223          
BLAST of noggin-like protein 1 vs. Ensembl Xenopus
Match: acad10 (acyl-CoA dehydrogenase family member 10 [Source:Xenbase;Acc:XB-GENE-967980])

HSP 1 Score: 69.707 bits (169), Expect = 2.477e-13
Identity = 47/146 (32.19%), Postives = 67/146 (45.89%), Query Frame = 3
Query:  171 PDPHK-PGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQL-DVLLSFKNLSFTDEK-GQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP + P E  LD   L++ LG  N++ ++MS+  P+ +   T    +  K L  V L  K L  ++   G  I   +       +W+     C   Y WK L    WP +IK G C S + CS+P GM CK     T   L+W C
Sbjct:   48 PDPEQDPKEQDLDERTLRKKLG-SNFDPNFMSVVLPNSVNMSTQDSLTKMKTLGSVPLELKKLDLSETPYGGRIRMGKKARRKFLQWLWAYTYCPVMYTWKDLGVRFWPRFIKEGHCFSEKSCSFPEGMYCKPIKSVTKTFLRWYC 192          
BLAST of noggin-like protein 1 vs. Ensembl Xenopus
Match: nog (noggin [Source:NCBI gene;Acc:493191])

HSP 1 Score: 63.1586 bits (152), Expect = 4.352e-11
Identity = 42/150 (28.00%), Postives = 68/150 (45.33%), Query Frame = 3
Query:  171 PDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTP----SIIYEQTSLEASNNKQLDVLLS-FKNLSFTDE-KGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP + P E  L+  +L R L + +++ ++M++N P     +            K    + +  K L F +  +G+    S+ L   ++ W+  Q  C   Y W  L    WP ++K G C S   CS P GM CK +    L +L+W C
Sbjct:   49 PDPIYDPKEKDLNETLL-RTLMVGHFDPNFMAINLPEERLGVEDLGELDLLLRQKPSGAMPAEIKGLEFYEGLQGKKHRLSKKLRRKLQMWLWSQTFCPVLYTWNDLGTRFWPRYVKVGSCYSKRSCSVPEGMVCKAAKSMHLTILRWRC 197          
BLAST of noggin-like protein 1 vs. Ensembl Mouse
Match: Nog (noggin [Source:MGI Symbol;Acc:MGI:104327])

HSP 1 Score: 66.2402 bits (160), Expect = 3.398e-12
Identity = 48/159 (30.19%), Postives = 71/159 (44.65%), Query Frame = 3
Query:  171 PDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPS---IIYEQTSLEASNNKQLDVLL----------SFKNLSFTD--EKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP   P E  L+  +L+ +LG  +Y+  +M+ + P          +  A +  +LD LL            K L F++   +G+    S+ L   ++ W+  Q  C   Y W  L    WP ++K G C S   CS P GM CK S    L VL+W C
Sbjct:   50 PDPIFDPKEKDLNETLLRSLLG-GHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9W740|NOGG2_DANRE (Noggin-2 OS=Danio rerio OX=7955 GN=nog2 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.284e-12
Identity = 44/145 (30.34%), Postives = 65/145 (44.83%), Query Frame = 3
Query:  171 PDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEK-GQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP H P E  L    L + LG  N++ ++MS++ P+ +      E     +L +    K L  T+   G+ +   +       +W+     C   Y WK L    WP +IK G C S   CS+P GM+CK     T   L+W C
Sbjct:   46 PDPEHDPREQDLSEKTLLKKLG-SNFDANFMSIHLPAQLNASAPPELP---RLPMPAELKKLDLTETPYGRRVKVGKKARRKFLQWLWMYTHCPVLYTWKDLGLRFWPRYIKEGNCFSERSCSFPEGMSCKPVKAVTKTFLRWYC 186          
BLAST of noggin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9YHV3|NOGG3_DANRE (Noggin-3 OS=Danio rerio OX=7955 GN=nog3 PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.884e-11
Identity = 51/196 (26.02%), Postives = 85/196 (43.37%), Query Frame = 3
Query:   66 SVILIFTVWNILREPLIVNTYYSGSLIGTGLD----RSTPDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIY----EQTSLEASNNKQLDVLL-SFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEK 623
            + +LIF++   + E +  + Y    +    L     +  PDP   P E  L+   L+ ILG  ++E ++MS+N P   +    E    E    +   ++    K + F  + G+    S+ L   ++ W+     C   + W+ L    WP ++K G C +   CS P GM CK      L VL+W C+    G K
Sbjct:    9 ATVLIFSLGFRIEEGMCQHYYLLRPIPSDSLPIVELKEDPDPVLDPKERDLNETELRAILG-SHFEQNFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNKRSCSVPEGMVCKPPKSSHLTVLRWRCVQRKGGLK 203          
BLAST of noggin-like protein 1 vs. UniProt/SwissProt
Match: sp|P97466|NOGG_MOUSE (Noggin OS=Mus musculus OX=10090 GN=Nog PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.377e-11
Identity = 48/159 (30.19%), Postives = 71/159 (44.65%), Query Frame = 3
Query:  171 PDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPS---IIYEQTSLEASNNKQLDVLL----------SFKNLSFTD--EKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP   P E  L+  +L+ +LG  +Y+  +M+ + P          +  A +  +LD LL            K L F++   +G+    S+ L   ++ W+  Q  C   Y W  L    WP ++K G C S   CS P GM CK S    L VL+W C
Sbjct:   50 PDPIFDPKEKDLNETLLRSLLG-GHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q13253|NOGG_HUMAN (Noggin OS=Homo sapiens OX=9606 GN=NOG PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.797e-11
Identity = 48/159 (30.19%), Postives = 71/159 (44.65%), Query Frame = 3
Query:  171 PDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPS---IIYEQTSLEASNNKQLDVLL----------SFKNLSFTD--EKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP   P E  L+  +L+ +LG  +Y+  +M+ + P          +  A +  +LD LL            K L F++   +G+    S+ L   ++ W+  Q  C   Y W  L    WP ++K G C S   CS P GM CK S    L VL+W C
Sbjct:   50 PDPIFDPKEKDLNETLLRSLLG-GHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 1 vs. UniProt/SwissProt
Match: sp|O93525|NOGG_CHICK (Noggin OS=Gallus gallus OX=9031 GN=NOG PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.565e-10
Identity = 41/151 (27.15%), Postives = 67/151 (44.37%), Query Frame = 3
Query:  171 PDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTP----SIIYEQTSLEASNNKQLDVLLS-FKNLSFTD--EKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP   P E  L+  +L+ ++G  +++ ++M+M+ P     +            +    +    K L F D  + G+    S+ L   ++ W+  Q  C   Y W  L    WP ++K G C S   CS P GM CK +    L +L+W C
Sbjct:   49 PDPIFDPKEKDLNETLLRSLMG-GHFDPNFMAMSLPEDRLGVDDLAELDLLLRQRPSGAMPGEIKGLEFYDGLQPGKKHRLSKKLRRKLQMWLWSQTFCPVLYTWNDLGSRFWPRYVKVGSCYSKRSCSVPEGMVCKPAKSVHLTILRWRC 198          
BLAST of noggin-like protein 1 vs. TrEMBL
Match: A8SLH5 (Noggin-like protein 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 473.011 bits (1216), Expect = 3.765e-166
Identity = 269/269 (100.00%), Postives = 269/269 (100.00%), Query Frame = 3
Query:   57 MVNSVILIFTVWNILREPLIVNTYYSGSLIGTGLDRSTPDPHKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHEDXXXXXXXXXXXXXXXSQXXXXXXXXXXXXXXXXXXXXXYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 863
            MVNSVILIFTVWNILREPLIVNTYYSGSLIGTGLDRSTPDPHKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHEDRKRRRLRRHQFKRHLSQKRKIGVKKVKKPKQLKRLVKRYLYKTSKYASGYLCQWKPIDYTVYESCTCSC
Sbjct:    1 MVNSVILIFTVWNILREPLIVNTYYSGSLIGTGLDRSTPDPHKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHEDRKRRRLRRHQFKRHLSQKRKIGVKKVKKPKQLKRLVKRYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 269          
BLAST of noggin-like protein 1 vs. TrEMBL
Match: Q8MY69 (Noggin like protein OS=Dugesia japonica OX=6161 GN=Djnlg PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 7.548e-114
Identity = 183/273 (67.03%), Postives = 225/273 (82.42%), Query Frame = 3
Query:   57 MVNSVILIFTVWNILREPLIVNTYYSG--SLIGTGLDRSTPDPHKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHEDXXXXXXXXXXXXXXXSQXXXXXXXXXXXXXXXXXXXXXYLYKTSKYASGYLCQWKPIDYTVYESCTCSC*G 869
            MVNS+I +  + NI +E   VN YYSG  ++  T  DRSTPDPH PGENAL+V +LQ+ILG +NY+ SWMS+NTPS IYE  +++  NNK LDVLLSFKNL+ TDE GQLINTS+NL++AIRRWMVQQA CK DY+WKRLD+THWPS+IKHG+C+S E CSWPPGM C+ +D+K LK+LKWTC+SDPLG++WN FRE +  D+++RRLRRH+ KRHLSQ  K    KV +PK++KRLVKRYLY+TSKY SGYLCQWKPIDYTV++SCTCSC G
Sbjct:    1 MVNSLIFVLAILNIFQESFTVNAYYSGRINMHSTNTDRSTPDPHVPGENALNVKLLQKILGKRNYDFSWMSINTPSKIYEPANIDIPNNKLLDVLLSFKNLTLTDENGQLINTSKNLESAIRRWMVQQAACKIDYLWKRLDDTHWPSFIKHGVCNSRESCSWPPGMNCRPNDQKLLKILKWTCISDPLGKRWNEFRESIFADKRKRRLRRHKIKRHLSQ--KRKTNKVIRPKRMKRLVKRYLYRTSKYVSGYLCQWKPIDYTVHQSCTCSCQG 271          
BLAST of noggin-like protein 1 vs. TrEMBL
Match: T1D134 (Nlg1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.138e-65
Identity = 108/250 (43.20%), Postives = 157/250 (62.80%), Query Frame = 3
Query:  123 TYYSGSLIGTGLDRSTPDPHKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRE---LMHEDXXXXXXXXXXXXXXXSQXXXXXXXXXXXXXXXXXXXXXYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 863
             Y+  + +     +++ DP  P +N+ +   L+ I+G KNY+ +WMS+N P  I+E  +     ++ L +L +FKN +  DE G  +   +N+  AIRRW+V+QA+C+ +Y+WK+LD  HWPSWIKHGICSS E CSWPPGM+C+    K  K+LKW C SDP   KWN FRE    + + R   R RRH  K+    K++ G+    + K+ ++   RY YKTSKY  G+ CQW+P+DY+V E+C CSC
Sbjct:   19 NYFQNNPMTPSQKKNSMDPFHPDDNSYNTKHLKAIMGGKNYDVTWMSINRPPKIFESANFSKPPSRNLLMLSNFKNYTLVDEVGNEMKIPKNISTAIRRWIVEQASCRVEYVWKKLDALHWPSWIKHGICSSKESCSWPPGMSCRNESHKKFKILKWICNSDPFAHKWNEFREKFLQLRKSRLLNRKRRHNLKKSNLVKQRRGLNFPNRSKRDEKKRLRYAYKTSKYVQGFFCQWEPVDYSVVETCMCSC 268          
BLAST of noggin-like protein 1 vs. TrEMBL
Match: C1JAC3 (Noggin-like protein 3 OS=Schmidtea mediterranea OX=79327 GN=nlg3 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.491e-31
Identity = 65/231 (28.14%), Postives = 132/231 (57.14%), Query Frame = 3
Query:  180 HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELM---HEDXXXXXXXXXXXXXXXSQXXXXXXXXXXXXXXXXXXXXXYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 863
            H P        ILQ+I+       +W+S+  P  +Y+ ++   + +K++  L+  KN++  D+ G  IN S+ +  +I++W+++++ C+ +Y W+ L+ET+WP W+K G+C + + CSWPPGM+C  +  + L +L+W C  D   EK+   + L+    + R++R+   +  K    ++     +K+++ +     ++  L+K S Y  G+ C+W+ + Y V ++C+C+C
Sbjct:   43 HFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMSCSPNSYRKLSLLQWICAEDKSKEKYKDDKLLIKIARKIRRKRQNISNNSKFKSKKRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNC 273          
BLAST of noggin-like protein 1 vs. TrEMBL
Match: C1JAC2 (Noggin-like protein 2 OS=Schmidtea mediterranea OX=79327 GN=nlg2 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 4.118e-30
Identity = 80/221 (36.20%), Postives = 116/221 (52.49%), Query Frame = 3
Query:  216 LQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSF----KNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHE-DXXXXXXXXXXXXXXXSQXXXXXXXXXXXXXXXXXXXXXYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 863
            L++IL  +     W+S   P  IY    +  +  KQ+DV + F    KN +F D KG  +  S N+  + RRW+ Q+++C  DYIW  LD + WP W+K GIC S   CSWPPGM CK   KK L +L+W C  DP   K+ A    M    R R + +    KR  +  ++ GV+KV   K  +   K+ + K  ++   + C+WK + Y V E C+C C
Sbjct:   70 LRQILDQEQLFDDWISSRIPKQIY----IPFNGTKQVDVRIQFLVKMKNYTFKDRKGNKLYLSPNVVDSFRRWLEQESSCPMDYIWTELDPSFWPRWVKKGICVSVVSCSWPPGMNCKSKHKKKLTLLQWNCEIDPDKSKYKADTMQMRSIKRIRVKRQNKLHKRRNTSSKRRGVRKVMTSKSKELKNKKRILKLREHIDDFYCKWKKVTYQVIEFCSCYC 286          
BLAST of noggin-like protein 1 vs. Ensembl Cavefish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 53.1434 bits (126), Expect = 5.667e-8
Identity = 38/151 (25.17%), Postives = 65/151 (43.05%), Query Frame = 3
Query:  171 PDPH-KPGENALDVHILQRILGLKNYEHSWMSMNTPSII-YEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLG 617
            PDP   P +  L+   L+  LG  +++  +M+++ P     + + L        D+    + L F  E       S+ +   ++ W+     C   Y W+ L    WP ++K G C+S   CS P GM C  +    L +L+W C+    G
Sbjct:   35 PDPALDPKDRDLNETELRARLG-AHFDAHFMAVSAPGAADTDASRLRPPGPMPRDI----RTLDF--ELPGWKKPSKKMRRRLQLWLWSYTFCPVVYAWQDLGSRFWPRYVKVGSCASKRSCSVPEGMVCSPAKSAHLTLLRWYCIPRKAG 178          
BLAST of noggin-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009391.1 (pep scaffold:Pmarinus_7.0:GL476782:173121:173762:-1 gene:ENSPMAG00000008500.1 transcript:ENSPMAT00000009391.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 1.919e-13
Identity = 39/151 (25.83%), Postives = 66/151 (43.71%), Query Frame = 3
Query:  186 PGENALDVHILQRILGLKNYEHSWMSMNTPS---------IIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGIC--SSTEPCSWPPGMACKQSDKKTLKVLKWTCLS 605
            P +  L    L  ILG  +++  WMS+  PS          +  ++S   +  ++L       N +   + G  +  ++   A + RW++Q+A C     W  L    WP W++   C  S    CSWP GM+C  +    +K+L W C +
Sbjct:   24 PKQRDLKSARLHNILG-SSFDPFWMSVKRPSSSSTTGDIGALATRSSAVTAAGRKLHAAARALNFTVLTDSGAAVAATEATAAFMTRWLLQKAECGVASSWHDLGSVFWPRWVRRSHCEESGGGGCSWPAGMSCAPAQSTHIKILAWHCYA 173          
BLAST of noggin-like protein 1 vs. Ensembl Sea Lamprey
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 65.0846 bits (157), Expect = 1.088e-12
Identity = 44/149 (29.53%), Postives = 68/149 (45.64%), Query Frame = 3
Query:  171 PDPH-KPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKN-LSFTD----EKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP   P E  LD  +L+R LG  +++  +M+++ P    + +  +    + L    S  N +   D      GQ I   +     I +W+     C   Y WK L E  WP ++K G C +   CS+P GMACK     +  +L+W C
Sbjct:   50 PDPELDPKEQDLDEKLLRRKLG-ASFDPEFMAVSLPK--GDASGQQTRGGRLLKPSGSMPNEIKRLDLGVLPHGQKIKIGKRARRKILQWLWSYTFCPVLYTWKDLGERFWPRFVKEGSCYNGRSCSFPEGMACKPFKSASKTLLRWHC 195          
BLAST of noggin-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011420.1 (pep scaffold:Pmarinus_7.0:GL487123:1955:2662:1 gene:ENSPMAG00000010393.1 transcript:ENSPMAT00000011420.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 2.279e-10
Identity = 42/166 (25.30%), Postives = 67/166 (40.36%), Query Frame = 3
Query:  171 PDPH-KPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVL----------------LSFKNLSFTDEKGQLINTSQNLDAAIRR------WMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP   P    LD  +L+R+LG  +++ ++MS+  P  +       +   +Q                    + F   ++ D +G   + +  L    RR      W   Q  C   Y WK L    WP +++ G C S   CS P GM+CK     +  +L+W C
Sbjct:   50 PDPELDPKTKDLDERVLRRLLG-SHFDPTFMSVAAPGEVRGLAKNASEPGEQHGRGAAAARRERAMPSEIRDMDFARAAWPDPRG---SRAGALGRKARRKMQLFLWAYTQ--CPVAYAWKDLGGRFWPRYVREGSCQSGRSCSIPAGMSCKAQRSTSKAILRWYC 209          
BLAST of noggin-like protein 1 vs. Ensembl Sea Lamprey
Match: nog2 (noggin 2 [Source:NCBI gene;Acc:30185])

HSP 1 Score: 58.151 bits (139), Expect = 2.978e-10
Identity = 44/161 (27.33%), Postives = 61/161 (37.89%), Query Frame = 3
Query:  171 PDPH-KPGENALDVHILQRILGLKNYEHSWMSMNTPS----------------IIYEQTSLEASNNKQLDVLLSFKNLSFTDE-KGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            PDP   P    LD   L + LG  N++H++MS+ TP                      T+ +        +    K L  T+   GQ +   +       +W+     C   Y WK L+   WP +IK G C S   CS P GM CK         L+W C
Sbjct:   47 PDPELDPKAKDLDERALLKKLG-SNFDHNFMSIATPESERQPGGESTTTTTTTTTAAVTAADRKPKPTGPIPSDIKRLDLTETLYGQKLKLGKRARRKFLQWLWAHTACPVVYSWKELNVRFWPRYIKEGSCYSARSCSVPEGMVCKPVKFSNKTFLRWHC 206          
BLAST of noggin-like protein 1 vs. Ensembl Nematostella
Match: EDO36981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH37])

HSP 1 Score: 48.1358 bits (113), Expect = 2.522e-7
Identity = 20/73 (27.40%), Postives = 38/73 (52.05%), Query Frame = 3
Query:  390 SQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSD 608
            S+ ++  +  W++Q+  C   Y W+ +    WP ++K   C S + CS  P   C+ S+ +   +L+W C+ D
Sbjct:    2 SREMERFMMGWLLQRENCPVVYSWRDMGPHFWPRFVKRATCKSKQ-CSIDPSTQCEPSNSRYFNILRWHCMDD 73          
BLAST of noggin-like protein 1 vs. Ensembl Nematostella
Match: EDO36952 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH36])

HSP 1 Score: 46.595 bits (109), Expect = 9.643e-7
Identity = 23/76 (30.26%), Postives = 37/76 (48.68%), Query Frame = 3
Query:  372 GQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            G+  N        ++ W+ + ++C     WK   +  WP +   G CS    CS+P GM CK+S  K + +L+W C
Sbjct:   15 GEGRNLGPKASRKLQLWLWELSSCPVYQKWKDQGQLIWPRYRNIGRCSRKSTCSYPGGMKCKRSKTKRVALLRWFC 90          
BLAST of noggin-like protein 1 vs. Ensembl Medaka
Match: nog2 (noggin 2 [Source:NCBI gene;Acc:30185])

HSP 1 Score: 67.781 bits (164), Expect = 7.241e-13
Identity = 46/151 (30.46%), Postives = 71/151 (47.02%), Query Frame = 3
Query:  162 RSTPDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNK---QLDVLLSFKNLSFTDEK-GQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTC 599
            R  PDP + P E  L    L++ LG  N++ ++MS+++P     Q +L AS+ +   Q  +    K L  T+   G+ +   +       +W+     C   Y WK L    WP +IK G C S   CS+P GM+CK +       L+W C
Sbjct:   44 REDPDPEYDPREQDLAERTLRKKLG-SNFDPNFMSISSPL----QVNLSASDYQVKLQGPMPNEIKKLDLTETPYGKRVKVGKKARRKFLQWLWTYTHCPVVYTWKDLGVRFWPRYIKEGKCFSERSCSFPEGMSCKPAKSINKIFLRWYC 189          
BLAST of noggin-like protein 1 vs. Ensembl Medaka
Match: nog1 (noggin 1 [Source:NCBI gene;Acc:30174])

HSP 1 Score: 58.5362 bits (140), Expect = 1.271e-9
Identity = 47/181 (25.97%), Postives = 80/181 (44.20%), Query Frame = 3
Query:  111 LIVNTYYSGSLIGTGLDRSTPDP-HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLL---------SFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEK 623
            LI+    S SL    L +  PDP + P E   +   L+ ILG  +++  ++S++ P  +       A+N++  D  L           + + F  + G+    S+ L   +++W+   + C   Y W  L    WP +++ G C S   CS P GM CK +    L  L+W C+     E+
Sbjct:   35 LILRPIPSDSLPLVEL-KEDPDPVYDPKERDFNETELKSILG--DFDSRFLSVSPPVEVKH-----AANDELDDFALQRAGGIMPKEIRAVDFDLQSGKKHKPSKKLKRRLQQWLWAYSFCPVLYSWTDLGNRFWPRFVRVGSCLSKRSCSVPEGMVCKPASSTHLTTLRWRCVQRKAAER 207          
BLAST of noggin-like protein 1 vs. Planmine SMEST
Match: SMESG000032255.1 (SMESG000032255.1)

HSP 1 Score: 468.389 bits (1204), Expect = 7.263e-168
Identity = 267/269 (99.26%), Postives = 267/269 (99.26%), Query Frame = 3
Query:   57 MVNSVILIFTVWNILREPLIVNTYYSGSLIGTGLDRSTPDPHKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHEDXXXXXXXXXXXXXXXSQXXXXXXXXXXXXXXXXXXXXXYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 863
            MVNSVILIFTVWNIL EPLIVN YYSGSLIGTGLDRSTPDPHKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHEDRKRRRLRRHQFKRHLSQKRKIGVKKVKKPKQLKRLVKRYLYKTSKYASGYLCQWKPIDYTVYESCTCSC
Sbjct:    1 MVNSVILIFTVWNILLEPLIVNAYYSGSLIGTGLDRSTPDPHKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHEDRKRRRLRRHQFKRHLSQKRKIGVKKVKKPKQLKRLVKRYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 269          
BLAST of noggin-like protein 1 vs. Planmine SMEST
Match: SMESG000007613.1 (SMESG000007613.1)

HSP 1 Score: 127.487 bits (319), Expect = 2.039e-34
Identity = 65/231 (28.14%), Postives = 131/231 (56.71%), Query Frame = 3
Query:  180 HKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELM---HEDXXXXXXXXXXXXXXXSQXXXXXXXXXXXXXXXXXXXXXYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 863
            H P        ILQ+I+       +W+S+  P  +Y+ ++   + +K++  L+  KN++  D+ G  IN S+ +  +I++W+++++ C+ +Y W+ L+ET+WP W+K G+C + + CSWPPGM C  +  + L +L+W C  D   EK+   + L+    + R++R+   +  K    ++     +K+++ +     ++  L+K S Y  G+ C+W+ + Y V ++C+C+C
Sbjct:   43 HFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEDKRKEKYKDDKLLIKIARKIRRKRQNIYNNSKFKSKKRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNC 273          
BLAST of noggin-like protein 1 vs. Planmine SMEST
Match: SMESG000034689.1 (SMESG000034689.1)

HSP 1 Score: 125.946 bits (315), Expect = 1.145e-33
Identity = 80/221 (36.20%), Postives = 116/221 (52.49%), Query Frame = 3
Query:  216 LQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSF----KNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHE-DXXXXXXXXXXXXXXXSQXXXXXXXXXXXXXXXXXXXXXYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 863
            L++IL  +     W+S   P  IY    +  +  KQ+DV + F    KN +F D KG  +  S N+  + RRW+ Q+++C  DYIW  LD + WP W+K GIC S   CSWPPGM CK   KK L +L+W C  DP   K+ A    M    R R + +    KR  +  ++ GV+KV   K  +   K+ + K  ++   + C+WK + Y V E C+C C
Sbjct:   70 LRQILDQEQLFDDWISSRIPKQIY----IPFNGTKQVDVRIQFLVKMKNYTFKDRKGNKLYLSPNVVDSFRRWLEQESSCPMDYIWTELDPSFWPRWVKKGICVSVVSCSWPPGMNCKSKHKKKLTLLQWNCEIDPDKSKYKADTMQMRSIKRIRVKRQNKLHKRRNTSSKRRGVRKVMTSKSKELKNKKRILKLREHIDDFYCKWKKVTYQVIEFCSCYC 286          
BLAST of noggin-like protein 1 vs. Planmine SMEST
Match: SMESG000034679.1 (SMESG000034679.1)

HSP 1 Score: 125.946 bits (315), Expect = 1.145e-33
Identity = 80/221 (36.20%), Postives = 116/221 (52.49%), Query Frame = 3
Query:  216 LQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSF----KNLSFTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHE-DXXXXXXXXXXXXXXXSQXXXXXXXXXXXXXXXXXXXXXYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 863
            L++IL  +     W+S   P  IY    +  +  KQ+DV + F    KN +F D KG  +  S N+  + RRW+ Q+++C  DYIW  LD + WP W+K GIC S   CSWPPGM CK   KK L +L+W C  DP   K+ A    M    R R + +    KR  +  ++ GV+KV   K  +   K+ + K  ++   + C+WK + Y V E C+C C
Sbjct:   70 LRQILDQEQLFDDWISSRIPKQIY----IPFNGTKQVDVRIQFLVKMKNYTFKDRKGNKLYLSPNVVDSFRRWLEQESSCPMDYIWTELDPSFWPRWVKKGICVSVVSCSWPPGMNCKSKHKKKLTLLQWNCEIDPDKSKYKADTMQMRSIKRIRVKRQNKLHKRRNTSSKRRGVRKVMTSKSKELKNKKRILKLREHIDDFYCKWKKVTYQVIEFCSCYC 286          
BLAST of noggin-like protein 1 vs. Planmine SMEST
Match: SMESG000016086.1 (SMESG000016086.1)

HSP 1 Score: 125.176 bits (313), Expect = 3.785e-33
Identity = 70/247 (28.34%), Postives = 129/247 (52.23%), Query Frame = 3
Query:  141 LIGTGLDRSTPDPHKPGENALDVHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLSFT--DEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHGICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLG---EKWNAFR-ELMHEDXXXXXXXXXXXXXXXSQXXXXXXXXXXXXXXXXXXXXXYLYKTSKYASGYLCQWKPIDYTVYESCTCSC 863
            LIG  +  +     KP     +   L+++    + +  W+S+N P ++     +E  N +Q +++ +  NL+FT  D  G ++   +N+    R+W+++ ++C+ +++W+ L E  WPSWI+ G+C+S++ CSWP GMACK S  +TL +L+W CL D  G   +K   F+ +L  +  K++ L   + +R      +      +   + K      L   S+ + GY CQW  + Y + + C+C C
Sbjct:   69 LIGDNISANFDSNTKPNLQQRNPKKLEKLFWKYHLDTQWLSINKPDVLRGLMPVEQINARQ-ELMKAVGNLNFTFVDSVGAMLEIPENMQNLFRKWLIEYSSCQMNFVWEDLGEMFWPSWIRRGLCTSSKSCSWPSGMACKHSGSRTLHLLRWVCLKDTNGTEAKKLQNFKIKLKTQKMKKQMLYYQKRRRRFPDSTRSNNLSKEVQSKKKATRITRLL--SRASDGYFCQWSMLKYYINDKCSCQC 312          
The following BLAST results are available for this feature:
BLAST of noggin-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NOG5.824e-1230.19noggin [Source:HGNC Symbol;Acc:HGNC:7866][more]
back to top
BLAST of noggin-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of noggin-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of noggin-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nog25.675e-1330.34noggin 2 [Source:NCBI gene;Acc:30185][more]
nog37.636e-1326.02noggin 3 [Source:NCBI gene;Acc:30173][more]
nog37.636e-1326.02noggin 3 [Source:NCBI gene;Acc:30173][more]
nog31.388e-1226.02noggin 3 [Source:NCBI gene;Acc:30173][more]
nog12.878e-1026.45noggin 1 [Source:NCBI gene;Acc:30174][more]
back to top
BLAST of noggin-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nog44.460e-1530.28noggin 4 [Source:NCBI gene;Acc:733455][more]
acad102.477e-1332.19acyl-CoA dehydrogenase family member 10 [Source:Xe... [more]
nog4.352e-1128.00noggin [Source:NCBI gene;Acc:493191][more]
back to top
BLAST of noggin-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nog3.398e-1230.19noggin [Source:MGI Symbol;Acc:MGI:104327][more]
back to top
BLAST of noggin-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W740|NOGG2_DANRE4.284e-1230.34Noggin-2 OS=Danio rerio OX=7955 GN=nog2 PE=2 SV=1[more]
sp|Q9YHV3|NOGG3_DANRE1.884e-1126.02Noggin-3 OS=Danio rerio OX=7955 GN=nog3 PE=1 SV=1[more]
sp|P97466|NOGG_MOUSE2.377e-1130.19Noggin OS=Mus musculus OX=10090 GN=Nog PE=2 SV=1[more]
sp|Q13253|NOGG_HUMAN2.797e-1130.19Noggin OS=Homo sapiens OX=9606 GN=NOG PE=1 SV=1[more]
sp|O93525|NOGG_CHICK1.565e-1027.15Noggin OS=Gallus gallus OX=9031 GN=NOG PE=2 SV=1[more]
back to top
BLAST of noggin-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A8SLH53.765e-166100.00Noggin-like protein 1 OS=Schmidtea mediterranea OX... [more]
Q8MY697.548e-11467.03Noggin like protein OS=Dugesia japonica OX=6161 GN... [more]
T1D1341.138e-6543.20Nlg1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
C1JAC33.491e-3128.14Noggin-like protein 3 OS=Schmidtea mediterranea OX... [more]
C1JAC24.118e-3036.20Noggin-like protein 2 OS=Schmidtea mediterranea OX... [more]
back to top
BLAST of noggin-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nog35.667e-825.17noggin 3 [Source:NCBI gene;Acc:30173][more]
back to top
BLAST of noggin-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000009391.11.919e-1325.83pep scaffold:Pmarinus_7.0:GL476782:173121:173762:-... [more]
nog31.088e-1229.53noggin 3 [Source:NCBI gene;Acc:30173][more]
ENSPMAT00000011420.12.279e-1025.30pep scaffold:Pmarinus_7.0:GL487123:1955:2662:1 gen... [more]
nog22.978e-1027.33noggin 2 [Source:NCBI gene;Acc:30185][more]
back to top
BLAST of noggin-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of noggin-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO369812.522e-727.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369529.643e-730.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of noggin-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nog27.241e-1330.46noggin 2 [Source:NCBI gene;Acc:30185][more]
nog11.271e-925.97noggin 1 [Source:NCBI gene;Acc:30174][more]
back to top
BLAST of noggin-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032255.17.263e-16899.26SMESG000032255.1[more]
SMESG000007613.12.039e-3428.14SMESG000007613.1[more]
SMESG000034689.11.145e-3336.20SMESG000034689.1[more]
SMESG000034679.11.145e-3336.20SMESG000034679.1[more]
SMESG000016086.13.785e-3328.34SMESG000016086.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027052
GenBankABV04324.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027052 ID=SMED30027052|Name=noggin-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1028bp
AAAAAGTTTCCTATTTAATAGGGAGGAAACTAAGAAATTTTGCACATAGT
TGAGTCATGGTAAATTCTGTGATCTTGATATTTACTGTTTGGAACATTTT
ACGAGAACCGTTGATAGTTAATACATACTATAGCGGAAGTTTAATCGGGA
CAGGATTGGACCGAAGTACCCCAGATCCACATAAGCCTGGGGAAAACGCT
CTAGACGTTCATATACTACAGAGAATTCTCGGTCTGAAAAACTATGAACA
TTCTTGGATGTCAATGAATACTCCATCGATCATTTACGAGCAAACGAGTC
TCGAAGCTTCAAATAATAAACAACTAGACGTTTTACTATCATTTAAAAAC
TTATCATTTACAGACGAAAAGGGTCAATTGATCAACACTTCTCAGAATCT
TGATGCAGCCATTCGTCGGTGGATGGTCCAGCAAGCGACATGCAAAACTG
ATTACATATGGAAACGACTCGATGAAACTCATTGGCCGTCATGGATTAAA
CACGGTATTTGTAGCAGTACAGAGCCATGCTCATGGCCTCCAGGAATGGC
CTGCAAACAGAGTGATAAAAAAACCTTAAAAGTCCTCAAATGGACTTGTT
TATCAGATCCTTTAGGTGAGAAATGGAACGCATTTCGAGAATTAATGCAC
GAAGATAGAAAAAGACGAAGACTAAGAAGACATCAATTTAAAAGACACTT
ATCACAGAAAAGAAAGATCGGAGTGAAGAAAGTGAAAAAACCGAAACAAT
TAAAAAGACTAGTAAAGAGATATCTATACAAAACGAGCAAATACGCCAGT
GGTTACCTATGCCAGTGGAAACCAATAGATTATACAGTTTATGAATCTTG
CACATGTAGCTGTTAAGGATGATCGTGATAATATTGTTGCTTTTTTGAGA
GATTTCACATACCTCATGAATATATTTCGATTTATTATTTATGTTTTTAG
CTTTAGACGATAATAAATTGTGAATAATCAGTTTGTATTTGTTACTTTAG
AGGTTGAGCTTTTTTTGCAATTTTTCAA
back to top

protein sequence of SMED30027052-orf-1

>SMED30027052-orf-1 ID=SMED30027052-orf-1|Name=SMED30027052-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=270bp
MVNSVILIFTVWNILREPLIVNTYYSGSLIGTGLDRSTPDPHKPGENALD
VHILQRILGLKNYEHSWMSMNTPSIIYEQTSLEASNNKQLDVLLSFKNLS
FTDEKGQLINTSQNLDAAIRRWMVQQATCKTDYIWKRLDETHWPSWIKHG
ICSSTEPCSWPPGMACKQSDKKTLKVLKWTCLSDPLGEKWNAFRELMHED
RKRRRLRRHQFKRHLSQKRKIGVKKVKKPKQLKRLVKRYLYKTSKYASGY
LCQWKPIDYTVYESCTCSC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000025nervous system
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0000461lateral branch
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR029034Cystine-knot_cytokine
IPR008717Noggin
Vocabulary: biological process
TermDefinition
GO:0045596negative regulation of cell differentiation
GO:0030514negative regulation of BMP signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF05806Noggincoord: 38..269
e-value: 5.1E-20
score: 72.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.520coord: 78..128
e-value: 1.4E-28
score: 102.3
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.665
IPR029034Cystine-knot cytokineGENE3DG3DSA:2.10.90.10coord: 40..183
e-value: 1.4E-28
score: 102.3
IPR029034Cystine-knot cytokineSUPERFAMILYSSF57501Cystine-knot cytokinescoord: 38..269
IPR008717NogginPIRSFPIRSF008129Noggincoord: 14..269
e-value: 3.1E-59
score: 198.1
IPR008717NogginPANTHERPTHR10494BONE MORPHOGENETIC PROTEIN INHIBITOR, NOGGINcoord: 40..269