PKD1L-1

Overview
NamePKD1L-1
Smed IDSMED30027038
Length (bp)2425
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PKD1L-1 (SMED30027038) t-SNE clustered cells

Violin plots show distribution of expression levels for PKD1L-1 (SMED30027038) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PKD1L-1 (SMED30027038) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PKD1L-1 (SMED30027038) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027038

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027038SMESG000066980.1 SmedASXL_002565SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30027038SMESG000066980.1 SmedASXL_000892SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30027038SMESG000066980.1 SmedASXL_018274SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30027038SMESG000066980.1 dd_Smed_v4_30941_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PKD1L-1 vs. TrEMBL
Match: A0A0H3YJQ5 (PKD1L-1 OS=Schmidtea mediterranea OX=79327 GN=PKD1L-1 PE=2 SV=1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 385/748 (51.47%), Postives = 515/748 (68.85%), Query Frame = 1
Query:   52 YYINTEWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISG-SMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLC-SEFCPLSICCSNVCNSRLLNGENITVLP-INYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTN-NDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENXXXXXXXXXXXXXXXXNFVSDAILVSNITYYQRITGLQFIPDK 2283
            ++   EWCI +T        G GTY    +S D T C DEC+  G  +++VWKN YCFCAND+S  IN TD   C + DG  VS++++ S+  +F +    +  +   N +  +P  Y   P      FKYSY D+ GIWE++ + + IQR++S  G+YQ+R+Q  K  N+AKI E  +EI+ Y++++N+N+TCQ +A+VYI  NCTV I  GS++ G I  +GL  E + + D   ER+G+VPNFFNNDFI+G S++GI +IN  +QY+G+++ +EFNA +   ID+LLL+P C   +C A   C  +  C R L C +E+CPLS  CS +CN+RLLN EN + LP ++YII++     I   GYQI  L VPWPV+AG+RL FH      D+IAVT LRSGE+ NF+ N+ TVT GT + + SFTP  + HQFSA+S  QRN  FK+MFNT+GIKNV++NLQSVDN++ S S+S++V LNINDTSFA  G+  TN S  F MNPHTG+ L YYW FGDNTTLNST+  VNHTF   G YN+SVYVYN +V+KVQ YL+ VKD V IN+FNS+G+  PNV A+F L M SGTGFNCTLSGD I N TQPS NL F +QW T+G +NVRIDCYNE +RD K+LVQ+IQ+N+TGL F +  G   E   L+F+W TGSNITF +L+NN+SY+   NE+   G ++NIT+   GV IG+IRA N +SD ILV+N+T+ Q+I+ +  I DK
Sbjct:   15 HFSRAEWCIKIT---LDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQSVDNVVASASSSVIVGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADK 759          
BLAST of PKD1L-1 vs. TrEMBL
Match: A0A267FN36 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002173g1 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 4.840e-38
Identity = 184/747 (24.63%), Postives = 336/747 (44.98%), Query Frame = 1
Query:  118 GTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSK--QINTTD--SIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEF-TPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISGSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPAS---FCTANNICDPSSKCPRKLLCSE----FCPLSICC----SNVCNSRLLNGENITVLPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAVTILR--SGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQS--VDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTS-GIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENXXXXXXXXXXXXXXXXNFVSDAILVSNITYYQRITGLQFIPDKMLVQ 2295
            G Y    L+++   C   C  M   Y+ +W++ +CFC++++++    N TD  +  C + + + V ++   + I   +V    ++ V    P+     + ++ P ++ F  +  Y D     E    N     + Y  PGV+ ++AQA +  N   I     +I V E LS INLTC S+ +      C + I +G+ L+  I+      E   + D   +R GS     N++  + S+ G  ++   F+++G +   EF A    ++++L+LRP C      +C + +ICD S+ C   + C+      CP +  C     + C ++         L   + + +  +++  QVGY +  +   + V  G ++ F        +A+   R  S    N YS +   +  T  T++  T   M+HQ SAIS+P  +      ++T+G   V + + +  +  +  + S S+ +  NINDT F P  + +  E C   + PHTG  ++Y W++ D++T  STS  +  +++ + G    +V  +     K       + ++V I+     G    N SA   + + +GT +NCT S    +     S  ++        GYYNV   C N  + D++S V  ++  VT     +     +    L+F  +  ++  F  L+ N++     NE +     E +T+  +G Y+ I RA N VSD + V N T  +RI GL    D  + +
Sbjct:   46 GDYDPDLLATEPVVCTSRCQQMSFAYAAIWQSRFCFCSDNINQTADFNITDLAAAACTAPEYVAVYNSEIATSIEDLEVTVGATTEVAVNTPLEVKALN-VSAPLSNTFSTRLGYADDRFRKELIMSNGYATNKSYIQPGVFNIKAQAYQYENTV-IGSGALQIKVTEPLSGINLTCPSVWITEKQMQCVLSIASGTGLRALINWGDGTTENFIVADPPWDRAGSPVATQNSEMENSSITGA-LVAADFKFEGTLQAFEFFAHTAGSLELLILRPACSGGTPYYCYSKDICDASNACNSDIDCAATSEILCPATENCWQASGSTCATKATKRNVTRSLHSTFNVAKKYSVSA-QVGYNLLPVTDQFLVLPGDKIGFWG-----SVAIVAARPVSVVEGNDYSFSSVSSPTTLTTSSDLTAQPMQHQISAISRPVTSHRLDRTYSTTGNFTVKVTISNAYLTGVESNASQSVWIQPNINDTRFVPVKYVLAREPCNIALEPHTGVDVKYNWSYSDSSTTESTSVPVSTYSYSSAGPGFINVTAFTVFENKTNSTSFQIIERVNISALVLDGQIFGNDSAA-TVVLATGTDYNCTFSISPGSTYYVSSNAMRIP-PLANIGYYNVNATCTNFLTSDSRSNVLYVEVPVTTFQLVTKAAEVNVAIQLKFRLNNCTHPKFEALLLNLTRAMTYNEPLLEVDMEPVTIAAVGKYVLISRAYNNVSDVLTVMNFTVQERIAGLNITIDNAVQE 781          
BLAST of PKD1L-1 vs. TrEMBL
Match: A0A1I8J0W5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.045e-37
Identity = 185/747 (24.77%), Postives = 337/747 (45.11%), Query Frame = 1
Query:  118 GTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSK--QINTTD--SIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEF-TPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISGSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPAS---FCTANNICDPSSKCPRKLLCSE----FCPLSICC----SNVCNSRLLNGENITVLPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAVTILR--SGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQS--VDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVN-HTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENXXXXXXXXXXXXXXXXNFVSDAILVSNITYYQRITGLQFIPDKMLVQ 2295
            G Y    L+++   C   C  M   Y+ +W++ +CFC++++++    N TD  +  C + + + V ++   + I   +V    ++ V    P+     + ++ P ++ F  +  Y D     E    N     + Y  PGV+ ++AQA +  N   I     +I V E LS INLTC S+ +      C + I +G+ L+  I+      E   + D   +R GS     N++  + S+ G  ++   F+++G +   EF A    ++++L+LRP C      +C + +ICD S+ C   + C+      CP +  C     + C ++         L   + + +  +++  QVGY +  +   + V  G ++ F        +A+   R  S    N YS +   +  T  T++  T   M+HQ SAIS+P  +      ++T+G   V + + +  +  +  + S S+ +  NINDT F P  + +  E C   + PHTG  ++Y W++ D++T  STS  V+ +++ + G    +V  +     K       + ++V I+     G    N SA   + + +GT +NCT S    +     S  ++        GYYNV   C N  + D++S V  ++  VT     +     +    L+F  +  ++  F  L+ N++     NE +     E +T+  +G Y+ I RA N VSD + V N T  +RI GL    D  + +
Sbjct:   46 GDYDPDLLATEPVVCTSRCQQMSFAYAAIWQSRFCFCSDNINQTADFNITDLAAAACTAPEYVAVYNSEIATSIEDLEVTVGATTEVAVNTPLEVKALN-VSAPLSNTFSTRLGYADDRFRKELIMSNGYATNKSYIQPGVFNIKAQAYQYENTV-IGSGALQIKVTEPLSGINLTCPSVWITEKQMQCVLSIASGTGLRALINWGDGTTENFIVADPPWDRAGSPVATQNSEMENSSITGA-LVAADFKFEGTLQAFEFFAHTAGSLELLILRPACSGGTPYYCYSKDICDASNACNSDIDCAATSEILCPATENCWQASGSTCATKATKRNVTRSLHSTFNVAKKYSVSA-QVGYNLLPVTDQFLVLPGDKIGFWG-----SVAIVAARPVSVVEGNDYSFSSGSSPTTLTTSSDLTAQPMQHQISAISRPVTSHRLDRTYSTTGNFTVKVTISNAYLTGVESNASQSVWIQPNINDTRFVPVKYVLAREPCNIALEPHTGVDVKYNWSYSDSSTTESTSVPVSTYSYSSAGPGFINVTAFTVFENKTNSTSFQIIERVNISALVLDGQIFGNDSAA-TVVLATGTDYNCTFSISPGSTYYVSSNAMRIP-PLANIGYYNVNATCTNFLTSDSRSNVLYVEVPVTTFQLVTKAAEVNVAIQLKFRLNNCTHPKFEALLLNLTRAMTYNEPLLEVDMEPVTIAAVGKYVLISRAYNNVSDVLTVMNFTVQERIAGLNITIDNAVQE 781          
BLAST of PKD1L-1 vs. TrEMBL
Match: A0A267FSJ8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023848g1 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.808e-35
Identity = 174/743 (23.42%), Postives = 311/743 (41.86%), Query Frame = 1
Query:  118 GTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTT------DSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFT--PNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISGSMAGINIINTVFQYDGVVSYVEF-NARQIATIDILLLRPDCP--ASFCTANNICDPSSKCPRKLLCSE----FCPLSICC---SNVCNSRLLNGENITVLPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAVTILRSGESSNFY-SNAHTVTVGTYLTAAS--FTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQS--VDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQ-PSTNLQFAFQWPTD-GYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENXXXXXXXXXXXXXXXXNFVSDAILVSNITYYQRITGLQF 2271
            G Y    L+++  TC   C A    Y+ +W+  +CFCA ++S   + T      D+  C  ++ + V    S  +     +L      V     +  T  + +   + +++  + SY D    WE    P Q  + + Y  PGV+  RA A    N + I  +  ++LV E     N+TC  + +V     CT+ + +G+ ++ +I       E   + D   ER G+     N D  S +   + +++  F+Y G++   EF      +T+++++ RP CP    FC     C   + C   + CS      CP +  C      C            +  +Y +        +  GY +  +   + V  G R+ F+  T    IA     S E  +++        +     AA+  +    + HQ SA+S+  +    +  + ++G   +S+ L S       V+ S ++L+   INDTSF P    ++NE C  R+ PHTG  ++Y WTF D  T  +T    ++     G  + +V  Y+ + T+  Y    +  +V I +    G    N SA  ++ + SG+ + CT++    +  TQ P   L F     +    Y ++  CYN  S  ++++   ++  VTG    +       P  L+ +   G++  F   I   +   V N +      E  +LP  G++  + R  N VSD ++  N+T   RI+   F
Sbjct:   46 GDYDPDLLATEVITCAASCKASSYRYTGIWQARFCFCAQNISSVASATFNRTEADAGSCTDAEHIAVYDIDSTDLADDLQILPPAQGTVVDAGSVNLTVDTSVF--AATEYLVRMSYGDDASRWERIDYPQQQ-VNKSYIVPGVWNARANA-YYQNSSLIGSSSLQLLVVEQTVIANITCPVVLLVTSPIQCTLSLISGTRVRASIDWGDGTQENFLLADSTWERAGTPVGQNNVDLASPTSDNVVLVDADFKYVGILQAFEFLGISGGSTVNLMIFRPMCPLGEQFCFGQYACSTDNLCASTVDCSSPVETLCPTTESCWASEGTCLKTRTKQNTTRGIASSYQVIAVYASVPVSAGYNLYRVPDEFTVFPGDRIGFYGTT----IAARSASSAEGPDYHLQRPSAPAINDIFNAANANWNSTGVHHQVSALSKSLQTYTLERKYISTGNTTISVRLSSNPFGGPSVNLSRAVLLQEGINDTSFEPVLDVLSNEPCNLRLKPHTGLNVKYNWTFSDGGTDFTTVPFSSYAISGLGPASVNVTAYSTLDTRQGYLSFRLISRVNILHLIVDGQHFGNDSA-VSISLNSGSDYLCTINAS--SGETQGPIAALSFRVSAQSSPALYFLKATCYNSLSSSSRTVPLYVEIPVTGFVVETNAAEVGVPFQLEMSIFNGTHPKFQASIAGENKTVVYNSAALRALAEASSLPTAGMFAVVCRTYNNVSDIVIALNVTAQHRISNASF 777          
BLAST of PKD1L-1 vs. TrEMBL
Match: G4VTA6 (Polycystin 1-related OS=Schistosoma mansoni OX=6183 GN=Smp_165230 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.410e-30
Identity = 172/704 (24.43%), Postives = 297/704 (42.19%), Query Frame = 1
Query:  118 GTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPI---FFTPKSYITDPSNSQFGFKY--SYQDRPGIWEFTPNQSPIQRIYSAPG----VYQVRAQAAKLINRAKIRETYSEILVYE--TLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISGSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPAS-FCTANNICDPSSKCPRKLLCSE---FCPLSICCSNVCNS------RLLNGENITVLPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAVTILRSGESSNFYSNAHTVTV-----GTYLTAASFTPINM-EHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSG----STSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTS-GIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESI 2133
            G Y S  + +D + CL  C     T+S +  + YCFC N+L       ++  CL SD + V    S + I  F +  T  +     + I   F  P  +   P    + F Y  + Q    I + T    P+   Y++PG      + R +   +   A +      +++YE  T ++I   C  + +      C +    GS+++GT+S      + I++ +   + IG  P    + FIS +   + I  +  +YDG +S ++ +A  +  +   LLR  C +  +    N C  ++   R + C+    F  L   C N+ +S      +L   + ITV   +Y +    T+ +  +G+Q   L   W +++G R+ F S     ++A +I  +  +S    +  T+T      G+ +  +    + +  HQ  A  +P    +     NT+G K+VS+ L S      +      T IL+   IN+T       C T+  C+  +  HTG  + Y W FGD T   +TS   V H + A G YN +V + N+I  K+    +TV  K   N          N      L  I+G  F C+   D I  +T+     QF ++    G     + C       ++ L Q +    TGL+  +     ++P  + FT+ TG+N+T  ++     +N V N SI
Sbjct:  125 GFYDSKTIGTDPSECLTGCSKNNYTWSAISNDSYCFCGNNLPPSTELYNA-SCLYSDIVTVYRTDSNTFIGPFQITTTELTVRQVGDKISINFVIPTEFKNLPGVKVYEFDYGDTIQTTENISDIT---IPLVISYNSPGPVWPTLRARNEDGTITGSASL-----ALMIYELITPADITFNCPIIVMSRSVFTCQLNCNKGSHIQGTVSFANDWQDAISLPEPNYDWIGLPPKRMTDKFISYNTNKLIITGSQARYDGTISTIQIHALLLTDVTFYLLRVQCTSGMYNFETNGCSLTNN--RSVTCTANQVFSGLLRDCVNISSSDCGSLRQLKLDKPITVENYDYQVIGIYTVKLTVLGWQSIKLPSVWTIQSGDRIGFTS-----ILAGSIGCAPSTSYEADDLETLTTFSGTNGSSVLGSGLKRLTLIRHQIGAWIRPTHGALLTGYINTTGYKDVSLQLYSYWGKNYTSPALIKTPILIDEIINETQLI-LNICDTDTQCSLELKNHTGINVTYVWDFGDGTVQETTSVKTVQHIYTAVGIYNLTVNISNSIQYKIITQNITVMKKTEFNGIQGNYFAVLNELTTLKL-NITGKRFICSWYIDGI--LTKNDNMTQFDYKHIQSGVVVWNVTCQTPTIAFSRKLEQFVLERFTGLSLVTKSLQVAKPAQIVFTFITGNNLTAQLIF----FNQVLNTSI 804          
BLAST of PKD1L-1 vs. Ensembl Nematostella
Match: EDO31944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF8])

HSP 1 Score: 92.4337 bits (228), Expect = 4.396e-19
Identity = 142/595 (23.87%), Postives = 241/595 (40.50%), Query Frame = 1
Query:  109 AGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDS---IPCLSSDGLMVSS---AVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSY----ITDPSNSQFGF------KYSYQDRPGIWEFTPNQSPIQR-IYSAPGVYQVRAQAAKLINRAKI-RETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFIS--GSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPA--SFCTANNICD-PSSKC-P-RKLLCSE---FCPL-SICCSNV-CNSRLLNGENITVL------PI-----------NYIIDRSVTINILQVGYQIANLGV---PWPVKAGHRLAFHSLTNNDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEH-QFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVI 1740
            +G G Y   D+S     CL++C  +   Y+ +     C C+N L       DS    PC  S     S       G +         NS    G   + FT +      I +P N   G        Y +    G     P+  P  R IY  PG Y V A A+ +I+   +  E Y+   V +  +NI LTC   A V     C   +  GS +  T   +    ++++I          VP   ++  I    +   I I    FQ+DG V++ +F   +  TI +++LRP+C A   +CT+   C   SS C P ++  CS    FC +   C SN    ++  N   + V       PI           +Y I     I++  +G+ I+ + +   P+ VK G  L +  +T    +A   +   E ++F  ++    V   L  +  T ++ +H  F+A        V +  F T G+K+++ N        ++    + +   I + +F    F  TN+S  F +  H G    Y+W FG+  +L +    +++ FP  G +  S+   N+I   V  + +++ D ++
Sbjct:   66 SGPGDYDPHDISP--IRCLEQC-GIKYKYAALQDGRLCLCSNTLPGTPKLDDSECNTPCPGSSKWPPSEHYLKCGGPL--------KNSVYNAGERILGFTLQKIESLNILEPVNIHGGITNGINVSYVFDLGDGTLVTKPSSEPKARHIYDKPGSYVVTATASNIISGEVVASEVYN---VDDPRNNIRLTCPRAAEVGQIVECNGTMDRGSRVNSTFVFSDGRTDRMSISSRYYSAGTIVPRGNDSSVIPVLNTPGTILIPAYEFQHDGQVTHWDFEIVEKGTIKLMILRPECSAGEEYCTSTRSCKISSSSCLPLKQKKCSSDEMFCMIQKRCVSNAYTTTQDANNNPVKVYTSSSTCPIQAPYQWSEPRADYRILFVQEISLETIGHHISAIPLAQQPF-VKEGDILGWLPVTG--YLAYKSVADHEGASFEYSSGVSAVNDKLLRSGSTTLHQKHFVFAAHYAHVAKFVVRNRFGTPGLKSLTSN--------ITEPLYLYIDYPIRNVTFEASKFANTNDSVEFLVPEHPGTNTTYFWDFGNGESLYTHLPSISYAFPTEGVFYVSLRAENSISHTVLTFPISIFDPIL 635          
BLAST of PKD1L-1 vs. Planmine SMEST
Match: SMESG000066980.1 (SMESG000066980.1)

HSP 1 Score: 1465.67 bits (3793), Expect = 0.000e+0
Identity = 738/742 (99.46%), Postives = 740/742 (99.73%), Query Frame = 1
Query:   67 EWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISGSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLCSEFCPLSICCSNVCNSRLLNGENITVLPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENXXXXXXXXXXXXXXXXNFVSDAILVSNITYYQRITGLQFIPDKMLV 2292
            EWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISGSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLCSEFCPLSICCSNVCNSRLLNGENITVLPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTS IGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENITLPIIGVYIGIIRAINFVSDAILVSNITYYQRITGLQFIPDK+ +
Sbjct:   20 EWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISGSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLCSEFCPLSICCSNVCNSRLLNGENITVLPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSTIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENITLPIIGVYIGIIRAINFVSDAILVSNITYYQRITGLQFIPDKIYI 761          
BLAST of PKD1L-1 vs. Planmine SMEST
Match: SMESG000066980.1 (SMESG000066980.1)

HSP 1 Score: 1464.51 bits (3790), Expect = 0.000e+0
Identity = 738/742 (99.46%), Postives = 740/742 (99.73%), Query Frame = 1
Query:   67 EWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISGSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLCSEFCPLSICCSNVCNSRLLNGENITVLPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENXXXXXXXXXXXXXXXXNFVSDAILVSNITYYQRITGLQFIPDKMLV 2292
            EWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISGSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLCSEFCPLSICCSNVCNSRLLNGENITVLPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTS IGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENITLPIIGVYIGIIRAINFVSDAILVSNITYYQRITGLQFIPDK+ +
Sbjct:   20 EWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISGSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLCSEFCPLSICCSNVCNSRLLNGENITVLPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSTIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENITLPIIGVYIGIIRAINFVSDAILVSNITYYQRITGLQFIPDKIYI 761          
BLAST of PKD1L-1 vs. Planmine SMEST
Match: SMESG000067002.1 (SMESG000067002.1)

HSP 1 Score: 744.962 bits (1922), Expect = 0.000e+0
Identity = 386/748 (51.60%), Postives = 515/748 (68.85%), Query Frame = 1
Query:   52 YYINTEWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISG-SMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLC-SEFCPLSICCSNVCNSRLLNGENITVLP-INYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTN-NDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENXXXXXXXXXXXXXXXXNFVSDAILVSNITYYQRITGLQFIPDK 2283
            ++   EWCI +T        G GTY    +S D T C DEC+  G  +++VWKN YCFCAND+S  IN TD   C + DG  VS++++ S+  +F +    +  +   N +  +P  Y   P      FKYSY D+ GIWE++ + + IQR++S  G+YQ+R+Q  K  N+AKI E  +EI+ Y++++N+N+TCQ +A+VYI  NCTV I  GS++ G I  +GL  E + + D   ER+G+VPNFFNNDFI+G S++GI +IN  +QY+G+++ +EFNA +   ID+LLL+P C   +C A   C  +  C R L C +E+CPLS  CS +CN+RLLN EN + LP ++YII++     I   GYQI  L VPWPV+AG+RL FH      D+IAVT LRSGE+ NF+ N+ TVT GT + + SFTP  + HQFSA+S  QRN  FK+MFNT+GIKNV++NLQSVDN++ S S+SI+V LNINDTSFA  G+  TN S  F MNPHTG+ L YYW FGDNTTLNST+  VNHTF   G YN+SVYVYN +V+KVQ YL+ VKD V IN+FNS+G+  PNV A+F L M SGTGFNCTLSGD I N TQPS NL F +QW T+G +NVRIDCYNE +RD K+LVQ+IQ+N+TGL F +  G   E   L+F+W TGSNITF +L+NN+SY+   NE+   G ++NIT+   GV IG+IRA N +SD ILV+N+T+ Q+I+ +  I DK
Sbjct:   15 HFSRAEWCIKIT---LDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQSVDNVVASASSSIIVGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMTSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADK 759          
BLAST of PKD1L-1 vs. Planmine SMEST
Match: SMESG000067002.1 (SMESG000067002.1)

HSP 1 Score: 744.962 bits (1922), Expect = 0.000e+0
Identity = 386/748 (51.60%), Postives = 515/748 (68.85%), Query Frame = 1
Query:   52 YYINTEWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISG-SMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLC-SEFCPLSICCSNVCNSRLLNGENITVLP-INYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTN-NDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENXXXXXXXXXXXXXXXXNFVSDAILVSNITYYQRITGLQFIPDK 2283
            ++   EWCI +T        G GTY    +S D T C DEC+  G  +++VWKN YCFCAND+S  IN TD   C + DG  VS++++ S+  +F +    +  +   N +  +P  Y   P      FKYSY D+ GIWE++ + + IQR++S  G+YQ+R+Q  K  N+AKI E  +EI+ Y++++N+N+TCQ +A+VYI  NCTV I  GS++ G I  +GL  E + + D   ER+G+VPNFFNNDFI+G S++GI +IN  +QY+G+++ +EFNA +   ID+LLL+P C   +C A   C  +  C R L C +E+CPLS  CS +CN+RLLN EN + LP ++YII++     I   GYQI  L VPWPV+AG+RL FH      D+IAVT LRSGE+ NF+ N+ TVT GT + + SFTP  + HQFSA+S  QRN  FK+MFNT+GIKNV++NLQSVDN++ S S+SI+V LNINDTSFA  G+  TN S  F MNPHTG+ L YYW FGDNTTLNST+  VNHTF   G YN+SVYVYN +V+KVQ YL+ VKD V IN+FNS+G+  PNV A+F L M SGTGFNCTLSGD I N TQPS NL F +QW T+G +NVRIDCYNE +RD K+LVQ+IQ+N+TGL F +  G   E   L+F+W TGSNITF +L+NN+SY+   NE+   G ++NIT+   GV IG+IRA N +SD ILV+N+T+ Q+I+ +  I DK
Sbjct:   15 HFSRAEWCIKIT---LDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQSVDNVVASASSSIIVGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMTSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADK 759          
BLAST of PKD1L-1 vs. Planmine SMEST
Match: SMESG000066980.1 (SMESG000066980.1)

HSP 1 Score: 148.288 bits (373), Expect = 4.145e-36
Identity = 95/99 (95.96%), Postives = 97/99 (97.98%), Query Frame = 1
Query: 1996 GLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENXXXXXXXXXXXXXXXXNFVSDAILVSNITYYQRITGLQFIPDKMLV 2292
            GLAFTS IGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENITLPIIGVYIGIIRAINFVSDAILVSNITYYQRITGLQFIPDK+ +
Sbjct:    6 GLAFTSTIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENITLPIIGVYIGIIRAINFVSDAILVSNITYYQRITGLQFIPDKIYI 104          
The following BLAST results are available for this feature:
BLAST of PKD1L-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJQ50.000e+051.47PKD1L-1 OS=Schmidtea mediterranea OX=79327 GN=PKD1... [more]
A0A267FN364.840e-3824.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J0W51.045e-3724.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FSJ82.808e-3523.42Uncharacterized protein OS=Macrostomum lignano OX=... [more]
G4VTA61.410e-3024.43Polycystin 1-related OS=Schistosoma mansoni OX=618... [more]
back to top
BLAST of PKD1L-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO319444.396e-1923.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PKD1L-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066980.10.000e+099.46SMESG000066980.1[more]
SMESG000066980.10.000e+099.46SMESG000066980.1[more]
SMESG000067002.10.000e+051.60SMESG000067002.1[more]
SMESG000067002.10.000e+051.60SMESG000067002.1[more]
SMESG000066980.14.145e-3695.96SMESG000066980.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027038 ID=SMED30027038|Name=PKD1L-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2425bp
ATCAAATAGTTTACAAATTCAAAATTTTAATTTGATGAAATTCGTTGTCA
CTATTATATTAATACGGAATGGTGCATATCTCTCACGGAACTACCGTTTT
CAAATTTCGCTGGAGCCGGAACTTACTTATCCTCAGATTTATCCTCTGAT
AATACAACCTGTTTAGATGAATGTTTTGCCATGGGCATGACATACAGTTT
AGTGTGGAAAAATCTCTACTGTTTCTGTGCAAACGATTTATCAAAGCAAA
TAAATACAACTGATTCAATTCCTTGTCTCAGTTCCGATGGGCTAATGGTG
AGTTCAGCAGTTTCCGGAAGTATTATCACGGTGTTTGATGTTTTGCAAAC
AAATAGCTCTGCAGTTACCGGTACGAATCCAATTTTCTTCACACCAAAAT
CATATATAACTGATCCAAGTAACTCGCAATTTGGTTTTAAATACAGCTAT
CAAGATCGTCCCGGGATTTGGGAATTTACTCCAAACCAAAGTCCAATACA
AAGAATTTATAGTGCTCCTGGAGTTTATCAAGTCAGAGCACAAGCGGCTA
AATTAATAAATAGAGCAAAAATAAGGGAAACTTATTCTGAAATTTTAGTT
TATGAAACTTTGTCAAATATAAATTTGACTTGCCAGTCTCTTGCTGTCGT
TTATATAACAGCAAATTGCACCGTTATGATCGGTACGGGCAGTTACCTTA
AAGGAACGATATCAGTAAATGGCTTAGAATTTGAAAAGATAAACATATTT
GACTTTAAGTGCGAAAGAATTGGTTCGGTGCCCAACTTTTTCAACAATGA
CTTTATTAGTGGTTCAATGGCCGGTATAAATATCATTAACACAGTATTCC
AGTACGACGGAGTGGTCTCGTACGTGGAATTTAACGCTCGTCAAATCGCT
ACGATAGACATATTGTTACTGCGACCAGACTGCCCAGCATCCTTTTGTAC
AGCCAATAATATCTGTGATCCGAGTTCTAAATGTCCAAGGAAGCTTTTAT
GTAGTGAATTCTGTCCACTCTCCATTTGTTGTTCTAATGTCTGTAATTCT
CGATTACTGAATGGAGAAAATATCACGGTGCTTCCAATTAATTACATTAT
TGATCGGTCGGTTACAATCAACATACTTCAAGTCGGATACCAAATTGCCA
ATTTAGGAGTACCTTGGCCTGTAAAAGCAGGACACCGATTAGCCTTTCAT
TCATTAACTAACAATGATGTAATTGCCGTGACTATTCTTCGGTCAGGTGA
AAGCTCTAACTTTTACAGCAATGCTCACACTGTTACCGTCGGAACGTATT
TAACTGCGGCCTCGTTTACTCCAATAAATATGGAGCATCAGTTTTCAGCT
ATTTCTCAACCTCAACGAAATCTAGTTTTCAAGATCATGTTCAACACAAG
TGGAATTAAAAATGTGTCAATAAACTTGCAAAGTGTAGACAATATTATGG
TCTCAGGATCTACGTCAATTTTGGTAAGTTTGAACATCAATGATACATCC
TTTGCACCTCCAGGCTTTTGTATCACAAATGAGTCATGCACATTTCGGAT
GAATCCCCATACCGGAGAATTATTGCAATATTATTGGACATTTGGAGACA
ATACTACGCTAAACTCAACGAGTGGAATTGTCAATCACACATTTCCAGCT
TTTGGTACATATAACGCATCAGTATACGTCTACAACGCTATTGTTACGAA
AGTACAATACTATTTGGTAACTGTAAAGGATAAAGTTATAATAAATTATT
TTAATTCAACCGGAATCTGTGGCCCTAACGTTTCTGCAAATTTCAACTTG
TGGATGATAAGTGGTACCGGGTTCAATTGTACACTCAGTGGAGATTTGAT
AACTAACATAACGCAACCATCCACAAATCTGCAATTTGCATTTCAATGGC
CAACAGATGGATATTACAATGTCCGAATTGACTGCTACAATGAAGGGAGT
CGTGATACAAAATCCTTAGTACAAATAATTCAATCAAATGTTACTGGGTT
AGCTTTTACGAGTTTGATAGGCATAACATCAGAACCGACATCATTACAAT
TCACATGGTCTACTGGGAGTAATATCACTTTCTCGGTGTTAATTAACAAT
GTCTCTTACAATTTTGTGGCTAATGAATCAATCAAACTGGGAAGTACAGA
AAATATCACTCTGCCTATTATTGGAGTTTATATTGGAATCATTCGAGCGA
TTAATTTTGTTTCTGATGCTATTCTAGTATCAAATATAACTTACTATCAA
CGAATTACCGGCCTCCAATTCATACCAGATAAAATGTTAGTTCAATAACA
CAATAAAATTTTATAATTTAATAGCTTACCACTAAATATTTGTCCCCGAT
GGATTGAGTAGGCACTGGCTCGGATAAATTACACACTTTTCTTATACTAT
CATTTAGTCAGCTTTTTTGTAATTA
back to top

protein sequence of SMED30027038-orf-1

>SMED30027038-orf-1 ID=SMED30027038-orf-1|Name=SMED30027038-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=706bp
MGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIIT
VFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFT
PNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLT
CQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSV
PNFFNNDFISGSMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPD
CPASFCTANNICDPSSKCPRKLLCSEFCPLSICCSNVCNSRLLNGENITV
LPINYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTNNDVIAV
TILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVF
KIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITN
ESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYV
YNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNC
TLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQII
QSNVTGLAFTSLIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANES
IKLGSTENITLPIIGVYIGIIRAINFVSDAILVSNITYYQRITGLQFIPD
KMLVQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR035986PKD_dom_sf
IPR000601PKD_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000601PKD domainPFAMPF00801PKDcoord: 443..504
e-value: 8.9E-9
score: 35.1
IPR000601PKD domainPROSITEPS50093PKDcoord: 461..504
score: 11.095
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 443..519
e-value: 1.0E-8
score: 36.9
NoneNo IPR availablePANTHERPTHR46730FAMILY NOT NAMEDcoord: 436..518
coord: 4..288
NoneNo IPR availableCDDcd00146PKDcoord: 467..506
e-value: 3.6175E-4
score: 37.8614
IPR035986PKD domain superfamilySUPERFAMILYSSF49299PKD domaincoord: 442..515