Pseudouridine synthase

Overview
NamePseudouridine synthase
Smed IDSMED30027035
Length (bp)1479
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pseudouridine synthase (SMED30027035) t-SNE clustered cells

Violin plots show distribution of expression levels for Pseudouridine synthase (SMED30027035) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pseudouridine synthase (SMED30027035) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pseudouridine synthase (SMED30027035) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027035

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027035h1SMcG0009697 SmedASXL_015406SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027035h1SMcG0009697 SmedASXL_015406SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30027035h1SMcG0009697 dd_Smed_v4_12745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027035h1SMcG0009697 dd_Smed_v4_12745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027035h1SMcG0009697 dd_Smed_v4_12745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027035h1SMcG0009697 dd_Smed_v4_12745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pseudouridine synthase vs. Ensembl Human
Match: RPUSD2 (RNA pseudouridine synthase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24180])

HSP 1 Score: 261.922 bits (668), Expect = 1.244e-80
Identity = 148/427 (34.66%), Postives = 229/427 (53.63%), Query Frame = 2
Query:  218 SDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKET-NLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHD--------------------------------------VSVHRFYE--NGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDV-DNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
             D++  +  YYF+ G RKV PY+  F++  K RW+  S+  VF  +F +    + ++ +    L +N K   +L+ +LK ND + + VHRHE PV  EPI+++ E++ V+VV KPSS+PVH   ++  NTV+ IL K H +++L  +HR+DR+TSG+L+F K    S ++  Q+RDRQ+ K Y+  V G+F  E+   + CK+ + ++  KVG   V  V+  GK   T F  L YN +   S+V C+PLTGRTHQIRVHLQ+LG PI NDP+YN ++WG  +G+ G   K+ E+L+ DL+A H                                        +  +  E     P+ L T         + +  N+  +P C EC  R    + +  + V+FLHA RY+     ++Y + +P W 
Sbjct:  124 GDEHFAETSYYFEGGLRKVRPYYFDFRTYCKGRWVGHSLLHVFSTEFRAQPLAYYEAAVRAGRLQLNEKPVQDLNIVLKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFRHNTVIFILGKEHQLKELHPLHRLDRLTSGVLMFAKTAAVSERIHEQVRDRQLEKEYVCRVEGEFPTEE---VTCKEPILVVSYKVG---VCRVDPRGKPCETVFQRLSYNGQS--SVVRCRPLTGRTHQIRVHLQFLGHPILNDPIYNSVAWGPSRGRGGYIPKTNEELLRDLVAEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEEVAEAAPQELDTIALASEKAVETDVMNQETDPLCAEC--RLVRQDPLPQDLVMFLHALRYK--GPGFEYFSPMPAWA 538          
BLAST of Pseudouridine synthase vs. Ensembl Human
Match: RPUSD2 (RNA pseudouridine synthase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24180])

HSP 1 Score: 214.927 bits (546), Expect = 2.277e-63
Identity = 125/351 (35.61%), Postives = 188/351 (53.56%), Query Frame = 2
Query:  443 ILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHD--------------------------------------VSVHRFYE--NGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDV-DNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            + K ND + + VHRHE PV  EPI+++ E++ V+VV KPSS+PVH   ++  NTV+ IL K H +++L  +HR+DR+TSG+L+F K    S ++  Q+RDRQ+ K Y+  V G+F  E+   + CK+ + ++  KVG   V  V+  GK   T F  L YN +   S+V C+PLTGRTHQIRVHLQ+LG PI NDP+YN ++WG  +G+ G   K+ E+L+ DL+A H                                        +  +  E     P+ L T         + +  N+  +P C EC  R    + +  + V+FLHA RY+     ++Y + +P W 
Sbjct:  139 LRKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFRHNTVIFILGKEHQLKELHPLHRLDRLTSGVLMFAKTAAVSERIHEQVRDRQLEKEYVCRVEGEFPTEE---VTCKEPILVVSYKVG---VCRVDPRGKPCETVFQRLSYNGQS--SVVRCRPLTGRTHQIRVHLQFLGHPILNDPIYNSVAWGPSRGRGGYIPKTNEELLRDLVAEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEEVAEAAPQELDTIALASEKAVETDVMNQETDPLCAEC--RLVRQDPLPQDLVMFLHALRYK--GPGFEYFSPMPAWA 477          
BLAST of Pseudouridine synthase vs. Ensembl Human
Match: RPUSD4 (RNA pseudouridine synthase D4 [Source:HGNC Symbol;Acc:HGNC:25898])

HSP 1 Score: 72.4034 bits (176), Expect = 3.363e-13
Identity = 50/180 (27.78%), Postives = 89/180 (49.44%), Query Frame = 2
Query:  518 IIHESDTVLVVCKPSSMPVHSVSKYHF--NTVMGILHK---SHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQY-LGFPISNDPLYN 1039
            I+H+   ++V+ KP  +PVH           V+ IL K    H  + L + HR+D+ T+G+++   D + + ++    R RQV+K Y A+                 ++ +  P  G+  +  VE+  ++A T++  L  +   + +LV  +P+TG  HQ+RVHL + L  PI  D  Y+
Sbjct:   99 ILHQDKNLVVINKPYGLPVHGGPGVQLCITDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQVVKKYWAI-----------------TVHVPMPSAGVVDIPIVEKEAQVAVTQYQVL--SSTLSSALVELQPITGIKHQLRVHLSFGLDCPILGDHKYS 259          
BLAST of Pseudouridine synthase vs. Ensembl Human
Match: RPUSD1 (RNA pseudouridine synthase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:14173])

HSP 1 Score: 65.0846 bits (157), Expect = 7.187e-11
Identity = 66/247 (26.72%), Postives = 102/247 (41.30%), Query Frame = 2
Query:  647 RVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVE-----EGGKIASTKFMFLKYN--EKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPN 1366
            R  H++D  TSG L    +   +       ++R+V K YLA++ G   E +   +    ++G    + G A+   +E     E  K + T  + L++       +S VL KPLTGRTHQ+RVH   LG P+  D  Y  +S  +D+                      + +H FY       L+  T+ + +   E      F PS D C S  +  + +D  V  L A    T D D + R   P 
Sbjct:   61 RFCHQLDFSTSGALCVALNKAAAGSAYRCFKERRVTKAYLALLRGHIQESR---VTISHAIGRNSTE-GRAHTMCIEGSQGCENPKPSLTDLVVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHCSALGHPVVGDLTYGEVSGREDR-------------------PFRMMLHAFY-------LRIPTDTECV---EVCTPDPFLPSLDACWSPHTLLQSLDQLVQALRA----TPDPDPEDRGPRPG 270          
BLAST of Pseudouridine synthase vs. Ensembl Human
Match: RPUSD1 (RNA pseudouridine synthase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:14173])

HSP 1 Score: 65.0846 bits (157), Expect = 7.187e-11
Identity = 66/247 (26.72%), Postives = 102/247 (41.30%), Query Frame = 2
Query:  647 RVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVE-----EGGKIASTKFMFLKYN--EKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPN 1366
            R  H++D  TSG L    +   +       ++R+V K YLA++ G   E +   +    ++G    + G A+   +E     E  K + T  + L++       +S VL KPLTGRTHQ+RVH   LG P+  D  Y  +S  +D+                      + +H FY       L+  T+ + +   E      F PS D C S  +  + +D  V  L A    T D D + R   P 
Sbjct:   61 RFCHQLDFSTSGALCVALNKAAAGSAYRCFKERRVTKAYLALLRGHIQESR---VTISHAIGRNSTE-GRAHTMCIEGSQGCENPKPSLTDLVVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHCSALGHPVVGDLTYGEVSGREDR-------------------PFRMMLHAFY-------LRIPTDTECV---EVCTPDPFLPSLDACWSPHTLLQSLDQLVQALRA----TPDPDPEDRGPRPG 270          
BLAST of Pseudouridine synthase vs. Ensembl Celegans
Match: K07E8.7 (Pseudouridine synthase [Source:UniProtKB/TrEMBL;Acc:A0A0M9JJ73])

HSP 1 Score: 227.254 bits (578), Expect = 1.292e-69
Identity = 131/382 (34.29%), Postives = 209/382 (54.71%), Query Frame = 2
Query:  257 NGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKE-TNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTF----TENKSIISDEEARNKYFEPSCDECLSRFSCNEDV-----DNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            +G R + PY+  +++  K RW+ + + EVF  +F S +  + K   +   + +N ++ T++DY+++  D + H  HRHE P+ D PI++I E+D + VV KP S+PVH+  +Y  +TV+G L  + G   LRV+HR+DR TSG+LLF K+YET  +    ++  +  K Y+  V G F +E++    C++ +G L   +G   ++ V   GK A ++F  L  +  Q  S+V     TGRTHQIRVH Q+LG PI+ D +YN   WG  KGK   Y KS ++L ED+   H      ++E  NPE  Q       +   I  +  +      P  DE   +  CN +      ++F L+LH  +Y T    W ++T++P+W 
Sbjct:    9 DGVRHLAPYWACYRTRTKGRWIGRKMVEVFSGEFLSTNRNYAKIACKMGRIYVNGEQMTDVDYVMRNGDRVEHWAHRHEHPIRDLPIRVISETDDLFVVEKPPSLPVHTCGQYAIHTVLGQLRVNEGRTGLRVLHRLDRATSGVLLFAKNYETDLEFKTTLKQGEWSKEYICKVDGVFPDEEQV---CEQPIGPLVISMG---IQCVRPDGKDAKSRFRKLWSDGTQ--SVVQVHIETGRTHQIRVHSQFLGHPIAGDQIYNSAVWGPTKGKNADYQKSFDELCEDVRNTH--KCENWHEKPNPEFEQRMEHLAADTTPITPEAPSLTLEQRPEFDEICQK--CNVESKKVPENHFQLYLHCLKYET--KKWSFKTEMPDWA 376          
BLAST of Pseudouridine synthase vs. Ensembl Celegans
Match: K07E8.7 (Pseudouridine synthase [Source:UniProtKB/TrEMBL;Acc:A0A0M9JJ73])

HSP 1 Score: 226.868 bits (577), Expect = 5.176e-69
Identity = 131/382 (34.29%), Postives = 209/382 (54.71%), Query Frame = 2
Query:  257 NGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKE-TNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTF----TENKSIISDEEARNKYFEPSCDECLSRFSCNEDV-----DNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            +G R + PY+  +++  K RW+ + + EVF  +F S +  + K   +   + +N ++ T++DY+++  D + H  HRHE P+ D PI++I E+D + VV KP S+PVH+  +Y  +TV+G L  + G   LRV+HR+DR TSG+LLF K+YET  +    ++  +  K Y+  V G F +E++    C++ +G L   +G   ++ V   GK A ++F  L  +  Q  S+V     TGRTHQIRVH Q+LG PI+ D +YN   WG  KGK   Y KS ++L ED+   H      ++E  NPE  Q       +   I  +  +      P  DE   +  CN +      ++F L+LH  +Y T    W ++T++P+W 
Sbjct:   51 DGVRHLAPYWACYRTRTKGRWIGRKMVEVFSGEFLSTNRNYAKIACKMGRIYVNGEQMTDVDYVMRNGDRVEHWAHRHEHPIRDLPIRVISETDDLFVVEKPPSLPVHTCGQYAIHTVLGQLRVNEGRTGLRVLHRLDRATSGVLLFAKNYETDLEFKTTLKQGEWSKEYICKVDGVFPDEEQV---CEQPIGPLVISMG---IQCVRPDGKDAKSRFRKLWSDGTQ--SVVQVHIETGRTHQIRVHSQFLGHPIAGDQIYNSAVWGPTKGKNADYQKSFDELCEDVRNTH--KCENWHEKPNPEFEQRMEHLAADTTPITPEAPSLTLEQRPEFDEICQK--CNVESKKVPENHFQLYLHCLKYET--KKWSFKTEMPDWA 418          
BLAST of Pseudouridine synthase vs. Ensembl Celegans
Match: K07E8.7 (Pseudouridine synthase [Source:UniProtKB/TrEMBL;Acc:A0A0M9JJ73])

HSP 1 Score: 226.868 bits (577), Expect = 6.987e-69
Identity = 130/382 (34.03%), Postives = 210/382 (54.97%), Query Frame = 2
Query:  257 NGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKE-TNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTF----TENKSIISDEEARNKYFEPSCDECLSRFSCNEDV-----DNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            +G R + PY+  +++  K RW+ + + EVF  +F S +  + K   +   + +N ++ T++DY+++  D + H  HRHE P+ D PI++I E+D + VV KP S+PVH+  +Y  +TV+G L  + G   LRV+HR+DR TSG+LLF K+YET  +    ++  +  K Y+  V G F +E++    C++ +G L   +G   ++ V   GK A ++F  L  +  Q++  V  +  TGRTHQIRVH Q+LG PI+ D +YN   WG  KGK   Y KS ++L ED+   H      ++E  NPE  Q       +   I  +  +      P  DE   +  CN +      ++F L+LH  +Y T    W ++T++P+W 
Sbjct:   62 DGVRHLAPYWACYRTRTKGRWIGRKMVEVFSGEFLSTNRNYAKIACKMGRIYVNGEQMTDVDYVMRNGDRVEHWAHRHEHPIRDLPIRVISETDDLFVVEKPPSLPVHTCGQYAIHTVLGQLRVNEGRTGLRVLHRLDRATSGVLLFAKNYETDLEFKTTLKQGEWSKEYICKVDGVFPDEEQV---CEQPIGPLVISMG---IQCVRPDGKDAKSRFRKLWSDGTQSVVQVHIE--TGRTHQIRVHSQFLGHPIAGDQIYNSAVWGPTKGKNADYQKSFDELCEDVRNTH--KCENWHEKPNPEFEQRMEHLAADTTPITPEAPSLTLEQRPEFDEICQK--CNVESKKVPENHFQLYLHCLKYET--KKWSFKTEMPDWA 429          
BLAST of Pseudouridine synthase vs. Ensembl Fly
Match: RluA-2 (gene:FBgn0032256 transcript:FBtr0337002)

HSP 1 Score: 268.085 bits (684), Expect = 3.491e-83
Identity = 157/447 (35.12%), Postives = 240/447 (53.69%), Query Frame = 2
Query:  170 EALKFKTGENKKNKIISDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCG-VYHKSKEQLIEDLMANHDVS-------------------------------------------VHRFYENGNPETLQTFTENKSIISDE--EARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            EA   KT    K    SD+   +  YYF+NG RKV+PYF TF +  K RW+++ + +VF  +F +  P   +  +E   L +N+++   DY +K ND++ + VHRHE+PV  +PIKI++    ++VV KP+S+PVH   +Y  NTV+ IL K H ++ LR IHR+DR+TSG+LLFG+  E + +L  QIR RQV K Y+  V G+F    +  +EC + + ++  K+G+  V       K    K  F +  E  + S+VLCKPLTGR HQIRVHLQ+LG+PISNDPLYN   +G  KG+ G +   ++EQLI +L++ H+                                             + +  E  N  T Q  T+      D   +++    +P C EC   +  +    + +++LHA++Y+ V   W+Y T++P W 
Sbjct:  106 EANSLKT----KRPGFSDERYDETSYYFENGLRKVYPYFFTFTTFAKGRWVDEKILDVFVREFRAAPPEEYERSLEAGKLTVNSEKVPKDYKIKHNDLLANVVHRHEVPVTSQPIKIVYMDKDIVVVNKPASIPVHPCGRYRHNTVVFILAKEHNLKNLRTIHRLDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRVEGRF---PDGIVECNEKIDVVSYKIGVCKVSP-----KGKDCKTTFKRIGEVGSDSIVLCKPLTGRMHQIRVHLQFLGYPISNDPLYNHEVFGPLKGRGGDIGGITEEQLISNLISIHNAENWLGLEGDQIVSGEIKDVAASTSVVEAPSVVQAPINSETEKPVISKNLEPSNDATAQIATQTCYEEPDRSFDSKKTTSDPQCSECKINYR-DPGTKDLIMYLHAWKYKGV--GWEYETELPEWA 537          
BLAST of Pseudouridine synthase vs. Ensembl Fly
Match: RluA-2 (gene:FBgn0032256 transcript:FBtr0080032)

HSP 1 Score: 268.085 bits (684), Expect = 3.491e-83
Identity = 157/447 (35.12%), Postives = 240/447 (53.69%), Query Frame = 2
Query:  170 EALKFKTGENKKNKIISDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCG-VYHKSKEQLIEDLMANHDVS-------------------------------------------VHRFYENGNPETLQTFTENKSIISDE--EARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            EA   KT    K    SD+   +  YYF+NG RKV+PYF TF +  K RW+++ + +VF  +F +  P   +  +E   L +N+++   DY +K ND++ + VHRHE+PV  +PIKI++    ++VV KP+S+PVH   +Y  NTV+ IL K H ++ LR IHR+DR+TSG+LLFG+  E + +L  QIR RQV K Y+  V G+F    +  +EC + + ++  K+G+  V       K    K  F +  E  + S+VLCKPLTGR HQIRVHLQ+LG+PISNDPLYN   +G  KG+ G +   ++EQLI +L++ H+                                             + +  E  N  T Q  T+      D   +++    +P C EC   +  +    + +++LHA++Y+ V   W+Y T++P W 
Sbjct:  106 EANSLKT----KRPGFSDERYDETSYYFENGLRKVYPYFFTFTTFAKGRWVDEKILDVFVREFRAAPPEEYERSLEAGKLTVNSEKVPKDYKIKHNDLLANVVHRHEVPVTSQPIKIVYMDKDIVVVNKPASIPVHPCGRYRHNTVVFILAKEHNLKNLRTIHRLDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRVEGRF---PDGIVECNEKIDVVSYKIGVCKVSP-----KGKDCKTTFKRIGEVGSDSIVLCKPLTGRMHQIRVHLQFLGYPISNDPLYNHEVFGPLKGRGGDIGGITEEQLISNLISIHNAENWLGLEGDQIVSGEIKDVAASTSVVEAPSVVQAPINSETEKPVISKNLEPSNDATAQIATQTCYEEPDRSFDSKKTTSDPQCSECKINYR-DPGTKDLIMYLHAWKYKGV--GWEYETELPEWA 537          
BLAST of Pseudouridine synthase vs. Ensembl Fly
Match: RluA-2 (gene:FBgn0032256 transcript:FBtr0304133)

HSP 1 Score: 266.544 bits (680), Expect = 1.015e-82
Identity = 159/443 (35.89%), Postives = 239/443 (53.95%), Query Frame = 2
Query:  170 EALKFKTGENKKNKIISDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCG-VYHKSKEQLIEDLMANHDVSVHRFYENGN------------------PETLQ----TFTENKSIISDEEARNKYF-------------------EPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            EA   KT    K    SD+   +  YYF+NG RKV+PYF TF +  K RW+++ + +VF  +F +  P   +  +E   L +N+++   DY +K ND++ + VHRHE+PV  +PIKI++    ++VV KP+S+PVH   +Y  NTV+ IL K H ++ LR IHR+DR+TSG+LLFG+  E + +L  QIR RQV K Y+  V G+F    +  +EC + + ++  K+G+  V       K    K  F +  E  + S+VLCKPLTGR HQIRVHLQ+LG+PISNDPLYN   +G  KG+ G +   ++EQLI +L++ H+       E                     P  +Q    + TE   I  + E  N                      +P C EC   +  +    + +++LHA++Y+ V   W+Y T++P W 
Sbjct:  106 EANSLKT----KRPGFSDERYDETSYYFENGLRKVYPYFFTFTTFAKGRWVDEKILDVFVREFRAAPPEEYERSLEAGKLTVNSEKVPKDYKIKHNDLLANVVHRHEVPVTSQPIKIVYMDKDIVVVNKPASIPVHPCGRYRHNTVVFILAKEHNLKNLRTIHRLDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRVEGRF---PDGIVECNEKIDVVSYKIGVCKVSP-----KGKDCKTTFKRIGEVGSDSIVLCKPLTGRMHQIRVHLQFLGYPISNDPLYNHEVFGPLKGRGGDIGGITEEQLISNLISIHNAENWLGLEGDQIVSGEIKDVAASTSVVEAPSVVQAPINSETEKPVISKNLEPSNDIATQTCYEEPDRSFDSKKTTSDPQCSECKINYR-DPGTKDLIMYLHAWKYKGV--GWEYETELPEWA 533          
BLAST of Pseudouridine synthase vs. Ensembl Fly
Match: RluA-1 (gene:FBgn0051719 transcript:FBtr0080040)

HSP 1 Score: 251.906 bits (642), Expect = 2.559e-75
Identity = 136/325 (41.85%), Postives = 204/325 (62.77%), Query Frame = 2
Query:  161 FRKEALKFKTGENKKNKIISDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCG-VYHKSKEQLIEDLMANHDV 1132
             +K  L+ K  + K+     ++YQ +  YY +NG RKV+PY+ TF +  K RW+ + + ++F  +F ++     +  I+   L +N ++  +DY LK ND++ + VHRHE+PV  +PIKI+H  + ++VV KP+S+PVH   +Y  NTV+ IL K   ++ LR IHR+DR+TSG+LLFG+  + + ++  QIR+RQV K Y+  V G F +     +ECK+ + ++  K+G+  V +    GK  +T F  L  N     S+VLCKPLTGR HQIRVHLQYLG+PI NDPLYN   +G  KG+ G +  KS E+LI DL+  H+ 
Sbjct:  261 LKKAKLETKALKAKRPGFTDERYQ-ETSYYMENGLRKVYPYYFTFTTFTKGRWVGEKILDIFSREFRAHPAEEYERCIQTGTLTVNFEKVPIDYRLKHNDLLANIVHRHEVPVTCQPIKIVHMDEDIVVVNKPASIPVHPCGRYRHNTVVFILAKEFNLKNLRTIHRLDRLTSGLLLFGRSPKKARQMEQQIRNRQVEKEYICRVEGVFPDGI---VECKEPIEVVSYKIGVCKVSA---KGKDCTTTFQKLSQN--GTTSVVLCKPLTGRMHQIRVHLQYLGYPILNDPLYNHEVFGPLKGRSGDIGGKSDEELIRDLINIHNA 576          
BLAST of Pseudouridine synthase vs. Ensembl Fly
Match: RluA-1 (gene:FBgn0051719 transcript:FBtr0080039)

HSP 1 Score: 251.906 bits (642), Expect = 2.559e-75
Identity = 136/325 (41.85%), Postives = 204/325 (62.77%), Query Frame = 2
Query:  161 FRKEALKFKTGENKKNKIISDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCG-VYHKSKEQLIEDLMANHDV 1132
             +K  L+ K  + K+     ++YQ +  YY +NG RKV+PY+ TF +  K RW+ + + ++F  +F ++     +  I+   L +N ++  +DY LK ND++ + VHRHE+PV  +PIKI+H  + ++VV KP+S+PVH   +Y  NTV+ IL K   ++ LR IHR+DR+TSG+LLFG+  + + ++  QIR+RQV K Y+  V G F +     +ECK+ + ++  K+G+  V +    GK  +T F  L  N     S+VLCKPLTGR HQIRVHLQYLG+PI NDPLYN   +G  KG+ G +  KS E+LI DL+  H+ 
Sbjct:  261 LKKAKLETKALKAKRPGFTDERYQ-ETSYYMENGLRKVYPYYFTFTTFTKGRWVGEKILDIFSREFRAHPAEEYERCIQTGTLTVNFEKVPIDYRLKHNDLLANIVHRHEVPVTCQPIKIVHMDEDIVVVNKPASIPVHPCGRYRHNTVVFILAKEFNLKNLRTIHRLDRLTSGLLLFGRSPKKARQMEQQIRNRQVEKEYICRVEGVFPDGI---VECKEPIEVVSYKIGVCKVSA---KGKDCTTTFQKLSQN--GTTSVVLCKPLTGRMHQIRVHLQYLGYPILNDPLYNHEVFGPLKGRSGDIGGKSDEELIRDLINIHNA 576          
BLAST of Pseudouridine synthase vs. Ensembl Zebrafish
Match: rpusd2 (RNA pseudouridine synthase domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-120411-43])

HSP 1 Score: 233.417 bits (594), Expect = 2.094e-69
Identity = 152/453 (33.55%), Postives = 242/453 (53.42%), Query Frame = 2
Query:  200 KKNKIIS--DQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETN-LDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGV--------------YHKSKEQLIEDLMANHDVSVHRFYENG-------------------------NPETLQTFTE--------------NKSIISDEEA---RNKYF--EPSCDEC-LSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            K+N  +S   ++  +  YYF+ G RKVHPY+  F+S  K RW+ K++ +VF+ +F + S  +  + ++   + +N    + L+ +LK ND++ + VHRHE PV  +P+K++ +   V+VV KPSS+PVH   +Y  NTV+ IL K  G+  L  +HR+DR+TSG+LLF +  E S KL   +R+RQ+ K Y+  V G+F E +   + C++ + ++  +VGL     V+  GK + T F  L +N +   S+V C+PLTGRTHQIRVHLQ+LGFPI NDP+Y   +WG ++ K G+               H+SKE L    + + +VS     ++G                           E+ Q   +              +K + SD+ +   R+K F  +  C EC + R    E     +++LHA RY+    D++Y T +P+W 
Sbjct:  144 KRNTGVSFNQEHFAETSYYFEGGLRKVHPYYFDFKSYCKGRWIGKTLLDVFKKEFRAESLDYYNAAVKEGRIKLNETPVDDLNVVLKNNDLLRNTVHRHEPPVCGQPLKLLVDDGEVVVVDKPSSLPVHPCGRYRHNTVIFILGKEKGLVGLHTVHRLDRLTSGVLLFARTLEVSKKLDVMVRERQLEKEYVCRVEGEFPEAE---VVCEEPILVVSFRVGLC---RVDPKGKESRTIFQRLSFNGRS--SVVRCRPLTGRTHQIRVHLQFLGFPILNDPIYGSSAWGPNRAKGGLVGMSDEELLEALIEEHRSKESLHLLDLPDEEVSGKTKCKDGAQGRNEQITAIESSSGSSEVSLDEVKAESRQVVQQSTSESVGEINGARKDKDLASDDASRTGRSKDFVRDHLCGECKIVRPDPTE--KELIMYLHALRYK--GPDFEYSTQLPDWA 584          
BLAST of Pseudouridine synthase vs. Ensembl Zebrafish
Match: rpusd1 (RNA pseudouridine synthase domain containing 1 [Source:NCBI gene;Acc:767786])

HSP 1 Score: 62.7734 bits (151), Expect = 2.194e-10
Identity = 57/197 (28.93%), Postives = 88/197 (44.67%), Query Frame = 2
Query:  494 PVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQL---------RVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLG--ILCPKVGLAYVKSVE--EGGKIASTKFMFLKYN--EKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYN 1039
            P   E + ++++S   +VV K   + + S   Y   TV   L   H   +L         R  H++D  TSG L    +   + +     +DR+V K YLA+V G   EE    +    ++G      K  +   +  E  E  K   T+   L+Y   +   ++ VL +PLTGRTHQ+RVH   +G PI  D  Y+
Sbjct:    3 PASLENLCVLYQSTNYIVVNKHWDIRIDSKMWYEKQTVQSQL--KHRFPELADPGTYYGFRFCHQLDFSTSGALCVALNKAAAGQAYRCFKDRRVTKAYLALVRGTVTEEN---LSLDFAIGKNTTEGKTHMMCTEGTEGCENPKPCQTEVTVLEYGTYDGDPVTKVLLQPLTGRTHQLRVHCSAIGHPIVGDYTYS 194          
BLAST of Pseudouridine synthase vs. Ensembl Zebrafish
Match: rpusd1 (RNA pseudouridine synthase domain containing 1 [Source:NCBI gene;Acc:767786])

HSP 1 Score: 62.7734 bits (151), Expect = 2.194e-10
Identity = 57/197 (28.93%), Postives = 88/197 (44.67%), Query Frame = 2
Query:  494 PVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQL---------RVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLG--ILCPKVGLAYVKSVE--EGGKIASTKFMFLKYN--EKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYN 1039
            P   E + ++++S   +VV K   + + S   Y   TV   L   H   +L         R  H++D  TSG L    +   + +     +DR+V K YLA+V G   EE    +    ++G      K  +   +  E  E  K   T+   L+Y   +   ++ VL +PLTGRTHQ+RVH   +G PI  D  Y+
Sbjct:    3 PASLENLCVLYQSTNYIVVNKHWDIRIDSKMWYEKQTVQSQL--KHRFPELADPGTYYGFRFCHQLDFSTSGALCVALNKAAAGQAYRCFKDRRVTKAYLALVRGTVTEEN---LSLDFAIGKNTTEGKTHMMCTEGTEGCENPKPCQTEVTVLEYGTYDGDPVTKVLLQPLTGRTHQLRVHCSAIGHPIVGDYTYS 194          
BLAST of Pseudouridine synthase vs. Ensembl Xenopus
Match: RPUSD2 (RNA pseudouridylate synthase domain containing 2 [Source:NCBI gene;Acc:100497757])

HSP 1 Score: 251.136 bits (640), Expect = 4.863e-77
Identity = 153/432 (35.42%), Postives = 228/432 (52.78%), Query Frame = 2
Query:  218 SDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKET--NLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNK-YFEPS--------------------------------------------CDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
             D++  +   Y +NG RKV PY+  F++  K RW+ KS+ EVF  +F +  PL    Q      L  N+ET  +L+ +LK ND + + VHRHE PV  EP++I+ E+D ++V+ KPSS+PVH   ++  NTV+ IL K + ++ L  IHR+DRMTSG+L+F K  E S K+  Q+R RQ+ K Y+  V G+F +E+   + C++ + ++  K+G+     V+  GK   T F  L YN K   S+V C P TGRTHQIRVHLQYLG PI NDP+YN  +WG ++GK G  +++ E L+  L+  H         + + E LQ   EN  + S  E   K   EP+                                            C EC      +    + V++LHA RY+    ++D+ +D+P+W 
Sbjct:   71 GDEHFRETETYLENGLRKVRPYYFDFETYCKGRWVGKSLLEVFGKEFRA-EPLEYYEQAAQAGRLRLNEETVRDLNVVLKNNDFLRNTVHRHEPPVTAEPLRILAENDEMVVIDKPSSLPVHPCGRFRHNTVIFILGKEYNLKGLHTIHRLDRMTSGVLMFAKTLEVSKKIDEQVRQRQLEKEYVCRVCGEFPKEE---VTCEEPIFVVSYKIGVC---RVDPKGKPCKTVFQRLSYNGKS--SVVKCFPYTGRTHQIRVHLQYLGHPIVNDPIYNTEAWGPNRGKGGEINRTDEDLLRALVDVHKSKQSLDILDISEEDLQPIMENAGLKSSTEPVQKEASEPADPQPKDEAQECKLTENVTNSSQDTDSSAACRITEESSQGSRDSLCGECRI-VRADPSPKDLVMYLHALRYKGA--EFDFSSDMPDWA 490          
BLAST of Pseudouridine synthase vs. Ensembl Xenopus
Match: RPUSD1 (RNA pseudouridine synthase domain containing 1 [Source:NCBI gene;Acc:100380010])

HSP 1 Score: 70.4774 bits (171), Expect = 7.701e-13
Identity = 63/199 (31.66%), Postives = 93/199 (46.73%), Query Frame = 2
Query:  494 PVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQL---------RVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGI-LCPKVGLAYVKSVE-----EGGKIASTKFMFLKYNEKQN--LSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYN 1039
            P   E + I+++S   LVV K   + + S   Y   TV   L   H   +L         R  H++D  TSG L    + E + +     +DR V K YLA+V G  +E+       + SL I    + GL ++  VE     +  K   T  + L++   +   ++ VL +PLTGRTHQ+RVH   LGFPI  D  Y+
Sbjct:    3 PCSIEKLSILYQSADFLVVNKHWDIRIDSKMWYEKLTVQSQL--KHRFPELADPGTYYGFRFCHQLDFSTSGALCVALNKEAAGRAYQCFKDRTVTKAYLALVRGTVSEKY-----MRISLAIGKNTQEGLTHMMCVEGAPGCKNAKPCQTDLVVLQHGSYKGDPVTKVLLQPLTGRTHQLRVHCSALGFPIVGDFTYS 194          
BLAST of Pseudouridine synthase vs. Ensembl Mouse
Match: Rpusd2 (RNA pseudouridylate synthase domain containing 2 [Source:MGI Symbol;Acc:MGI:1918066])

HSP 1 Score: 261.536 bits (667), Expect = 1.574e-80
Identity = 153/423 (36.17%), Postives = 235/423 (55.56%), Query Frame = 2
Query:  218 SDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKET-NLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANH----DVSVHRFYENG-NPETLQTFTENKSIISDE---------------EARNKYF---------------EPSCDEC--LSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            SD++  +  YYF+ G RKV PY+  FQ+  K RW+ +S+  VF  +F S    + ++ +    L +N +   +L  +LK ND + + VHRHE PV  EPI ++ E++ V+V+ KPSS+PVH   ++  NTV+ IL K H +++L  +HR+DR+TSG+L+F K    S K+  Q+RDRQ+ K Y+  V+G+F +++   + CK+ + ++  KVG   V  V+  GK   T F  L YN +   S+V C+PLTGRTHQIRVHLQ+LG PI NDP+YN  +WG  +G+ G   K+ E+L+ DL+A H     +S+    E+   P  + +   +  +  D                EA  ++                +P C EC  L +    +D    V+FLHA RY+    D++Y + IP W 
Sbjct:  137 SDEHFAETTYYFEGGLRKVRPYYFDFQTYCKGRWVGRSLLHVFSTEFRSQPLSYYEAAVRAGRLHLNEEPVQDLSIVLKDNDFLRNTVHRHEPPVTAEPIHLLAENNDVVVIDKPSSIPVHPCGRFRHNTVIFILGKEHQLKELHPLHRLDRLTSGVLMFAKTAAVSEKIHEQVRDRQLEKEYVCRVAGEFPDKE---VICKEPILVVSYKVG---VCRVDPRGKPCETVFQRLSYNGRS--SVVQCRPLTGRTHQIRVHLQFLGHPILNDPIYNSTAWGPSRGQGGHIPKTDEELLRDLVAEHQAKESLSMLDLCESDLTPGLIDSTAPSSELAKDSLEGLATAAQKIDGIAEAAPQHLDTPEKAAKADVTQETDPLCAECRVLRQDPLPQD---LVMFLHALRYK--GPDFEYVSPIPAWA 546          
BLAST of Pseudouridine synthase vs. Ensembl Mouse
Match: Rpusd1 (RNA pseudouridylate synthase domain containing 1 [Source:MGI Symbol;Acc:MGI:1919186])

HSP 1 Score: 61.6178 bits (148), Expect = 5.556e-10
Identity = 59/227 (25.99%), Postives = 95/227 (41.85%), Query Frame = 2
Query:  647 RVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVE-----EGGKIASTKFMFLKYN--EKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFL 1306
            R  H++D  TSG L    +   +       ++R+V K YLA+V G   E +   +    ++G    + G  +   +E     E  K + T+ + L++       +S VL KPLTGRTHQ+RVH   LG PI  D  Y            G     ++Q    ++       H FY       L+  T+ + +   E      F P+ D C S  +C + ++  +  L
Sbjct:   61 RFCHQLDFSTSGALCVALNKAAAGSAYKCFKERRVTKAYLALVRGHVQESQ---VTINYAIGRNSTE-GRTHTMCIEGTHGCENPKPSLTELLVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHCSALGHPIVGDLTY------------GQAEDQEDQPFRMML-------HAFY-------LRIPTQAERV---EACTPDPFLPALDACWSPSTCVQPLEQLIQAL 254          
BLAST of Pseudouridine synthase vs. Ensembl Mouse
Match: Rpusd1 (RNA pseudouridylate synthase domain containing 1 [Source:MGI Symbol;Acc:MGI:1919186])

HSP 1 Score: 61.6178 bits (148), Expect = 5.556e-10
Identity = 59/227 (25.99%), Postives = 95/227 (41.85%), Query Frame = 2
Query:  647 RVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVE-----EGGKIASTKFMFLKYN--EKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFL 1306
            R  H++D  TSG L    +   +       ++R+V K YLA+V G   E +   +    ++G    + G  +   +E     E  K + T+ + L++       +S VL KPLTGRTHQ+RVH   LG PI  D  Y            G     ++Q    ++       H FY       L+  T+ + +   E      F P+ D C S  +C + ++  +  L
Sbjct:   61 RFCHQLDFSTSGALCVALNKAAAGSAYKCFKERRVTKAYLALVRGHVQESQ---VTINYAIGRNSTE-GRTHTMCIEGTHGCENPKPSLTELLVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHCSALGHPIVGDLTY------------GQAEDQEDQPFRMML-------HAFY-------LRIPTQAERV---EACTPDPFLPALDACWSPSTCVQPLEQLIQAL 254          
BLAST of Pseudouridine synthase vs. Ensembl Mouse
Match: Rpusd4 (RNA pseudouridylate synthase domain containing 4 [Source:MGI Symbol;Acc:MGI:1919239])

HSP 1 Score: 52.373 bits (124), Expect = 8.021e-7
Identity = 54/195 (27.69%), Postives = 91/195 (46.67%), Query Frame = 2
Query:  515 KIIHESDTVLVVCKPSSMPVHSVSKYHF--NTVMGILHK---SHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAV---VSGKFNEEKEQPIECKKSLG-------ILCPKVGLAYVKSVE----EGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQY-LGFPISNDPLYN 1039
            +I+H+ + ++V+ KP  +PVH         + V+ IL K    H  + L + HR+D+ T+G+++   + + + ++    R RQV K Y A+   V        + PI+ K+  G        L P   L   K V+        +A T++  L       L  +  +P+TG  HQ+RVHL + L  PI  D  Y+
Sbjct:   98 RILHQDNDLVVINKPYGLPVHGGPGVQLCISDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWEKDMAHQVQELFRTRQVEKKYWAITVRVPLPSAGVVDIPIKEKEVQGPQQHHKMTLSPSYRLDNGKMVKVRASRDAHVAVTQYQVLSSASSSALVEL--QPVTGIKHQLRVHLSFGLDCPILGDHKYS 290          
BLAST of Pseudouridine synthase vs. UniProt/SwissProt
Match: sp|Q8IZ73|RUSD2_HUMAN (RNA pseudouridylate synthase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPUSD2 PE=1 SV=2)

HSP 1 Score: 261.922 bits (668), Expect = 5.975e-80
Identity = 148/427 (34.66%), Postives = 229/427 (53.63%), Query Frame = 2
Query:  218 SDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKET-NLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHD--------------------------------------VSVHRFYE--NGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDV-DNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
             D++  +  YYF+ G RKV PY+  F++  K RW+  S+  VF  +F +    + ++ +    L +N K   +L+ +LK ND + + VHRHE PV  EPI+++ E++ V+VV KPSS+PVH   ++  NTV+ IL K H +++L  +HR+DR+TSG+L+F K    S ++  Q+RDRQ+ K Y+  V G+F  E+   + CK+ + ++  KVG   V  V+  GK   T F  L YN +   S+V C+PLTGRTHQIRVHLQ+LG PI NDP+YN ++WG  +G+ G   K+ E+L+ DL+A H                                        +  +  E     P+ L T         + +  N+  +P C EC  R    + +  + V+FLHA RY+     ++Y + +P W 
Sbjct:  124 GDEHFAETSYYFEGGLRKVRPYYFDFRTYCKGRWVGHSLLHVFSTEFRAQPLAYYEAAVRAGRLQLNEKPVQDLNIVLKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFRHNTVIFILGKEHQLKELHPLHRLDRLTSGVLMFAKTAAVSERIHEQVRDRQLEKEYVCRVEGEFPTEE---VTCKEPILVVSYKVG---VCRVDPRGKPCETVFQRLSYNGQS--SVVRCRPLTGRTHQIRVHLQFLGHPILNDPIYNSVAWGPSRGRGGYIPKTNEELLRDLVAEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEEVAEAAPQELDTIALASEKAVETDVMNQETDPLCAEC--RLVRQDPLPQDLVMFLHALRYK--GPGFEYFSPMPAWA 538          
BLAST of Pseudouridine synthase vs. UniProt/SwissProt
Match: sp|Q149F1|RUSD2_MOUSE (RNA pseudouridylate synthase domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rpusd2 PE=1 SV=2)

HSP 1 Score: 261.536 bits (667), Expect = 1.101e-79
Identity = 153/423 (36.17%), Postives = 235/423 (55.56%), Query Frame = 2
Query:  218 SDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKET-NLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANH----DVSVHRFYENG-NPETLQTFTENKSIISDE---------------EARNKYF---------------EPSCDEC--LSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            SD++  +  YYF+ G RKV PY+  FQ+  K RW+ +S+  VF  +F S    + ++ +    L +N +   +L  +LK ND + + VHRHE PV  EPI ++ E++ V+V+ KPSS+PVH   ++  NTV+ IL K H +++L  +HR+DR+TSG+L+F K    S K+  Q+RDRQ+ K Y+  V+G+F +++   + CK+ + ++  KVG   V  V+  GK   T F  L YN +   S+V C+PLTGRTHQIRVHLQ+LG PI NDP+YN  +WG  +G+ G   K+ E+L+ DL+A H     +S+    E+   P  + +   +  +  D                EA  ++                +P C EC  L +    +D    V+FLHA RY+    D++Y + IP W 
Sbjct:  137 SDEHFAETTYYFEGGLRKVRPYYFDFQTYCKGRWVGRSLLHVFSTEFRSQPLSYYEAAVRAGRLHLNEEPVQDLSIVLKDNDFLRNTVHRHEPPVTAEPIHLLAENNDVVVIDKPSSIPVHPCGRFRHNTVIFILGKEHQLKELHPLHRLDRLTSGVLMFAKTAAVSEKIHEQVRDRQLEKEYVCRVAGEFPDKE---VICKEPILVVSYKVG---VCRVDPRGKPCETVFQRLSYNGRS--SVVQCRPLTGRTHQIRVHLQFLGHPILNDPIYNSTAWGPSRGQGGHIPKTDEELLRDLVAEHQAKESLSMLDLCESDLTPGLIDSTAPSSELAKDSLEGLATAAQKIDGIAEAAPQHLDTPEKAAKADVTQETDPLCAECRVLRQDPLPQD---LVMFLHALRYK--GPDFEYVSPIPAWA 546          
BLAST of Pseudouridine synthase vs. UniProt/SwissProt
Match: sp|Q09709|YA32_SCHPO (Uncharacterized protein C18B11.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC18B11.02c PE=3 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 4.503e-69
Identity = 133/391 (34.02%), Postives = 208/391 (53.20%), Query Frame = 2
Query:  236 DCVYYFQ-NGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLY-NCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPS----------CDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            DC Y F+ +G R+V PY++ + +  K RW  K++ EVF  +F      + +  I N  + +NN+  N+D +++   +++H  HRHE PV D+P+ I+HE ++ +V+ KP+ +PVH   +Y+ NTV+ IL K +    L   +R+DR+TSG++ F K  + + ++   +  + + K Y+A V G+F    E  + C   L  + P +GL     +   GK AST F  + ++   + SLVLCKPLTGRTHQ+RVHLQYLG+PI+NDP+Y N   WG   GK G    S E +I            R  E G  ET     + +   ++ EA  K               C EC +    +   +   ++LHA +Y +   DW Y+T +P W 
Sbjct:   12 DCEYVFKGDGLRRVPPYYYEYITFAKLRWYGKTLLEVFNTEFRDRESGYYEKAIRNGQVKVNNQIGNVDTLIENGYIVSHHAHRHEPPVSDQPVGIVHEDESYVVIDKPAGVPVHPTGRYNHNTVLHILMKENKCSLLYPCNRLDRLTSGLMFFSKSPKAAEEMRVHMISKSLKKEYVARVIGEFPNSGE--VICDAPLLTVAPTLGL---NRIHPDGKEASTVFKRIAFD--GHTSLVLCKPLTGRTHQLRVHLQYLGYPIANDPIYANKRVWGPSLGKNG--EGSNESVI-----------MRLSEIGKTETASPLLQYEWYTNETEAEAKARRDKRLGELLTGKHCSECGTPLYSDPSPEELGIWLHALKYES--KDWSYKTQLPKWA 380          
BLAST of Pseudouridine synthase vs. UniProt/SwissProt
Match: sp|Q12362|RIB2_YEAST (Bifunctional protein RIB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIB2 PE=1 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 2.141e-68
Identity = 137/389 (35.22%), Postives = 208/389 (53.47%), Query Frame = 2
Query:  263 FRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPI---ECKKSLGILCPKVGL-AYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLY-NCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTD-------WDYRTDIPNWVGLFALSP 1393
             RK+ PYF T+++  KERW ++ + +VF ++F    P +    I    + +N++  NLD I++  D+ITH+VHRHE PV  +PI I+ E + +LV+ KPSS+PVH   +Y FNT+  +L +  G   +   +R+D+ TSG++   K    + ++  Q++ R+V K Y+A V G+F      PI   E  K +  + PKV L A  +  +E  K A T F  + Y+ +   S+V CKPLTGRTHQIRVHLQYLGFPI+NDP+Y N   WG D G+ G             + N+D  V +       + +      +S I             C+EC +    +   ++  L+LHA+RY +++ +       W YRT  P W    AL P
Sbjct:   78 LRKIEPYFFTYKTFCKERWRDRKLVDVFVSEFRDREPSYYSKTIAEGKVYLNDEPANLDTIIRDGDLITHKVHRHEPPVTSKPIDIVFEDEDILVIDKPSSIPVHPTGRYRFNTITKMLERQLGY-SVHPCNRLDKPTSGLMFLAKTPLGADRMGDQMKAREVTKEYVARVKGEF------PIGIVEVDKPVRSVNPKVALNAVCEMSDENAKHAKTVFQRVSYDGQT--SIVKCKPLTGRTHQIRVHLQYLGFPIANDPIYSNPDIWGPDLGRGG-------------LQNYDDIVLKL------DAIGKTNPAESWIHPHSEGEYLLGRQCEECEAEMYTDPGTNDLDLWLHAFRYESLERNSDTQKPLWSYRTKYPEW----ALEP 434          
BLAST of Pseudouridine synthase vs. UniProt/SwissProt
Match: sp|O16686|YK27_CAEEL (Uncharacterized protein K07E8.7 OS=Caenorhabditis elegans OX=6239 GN=K07E8.7 PE=3 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 8.887e-68
Identity = 130/382 (34.03%), Postives = 210/382 (54.97%), Query Frame = 2
Query:  257 NGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKE-TNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTF----TENKSIISDEEARNKYFEPSCDECLSRFSCNEDV-----DNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            +G R + PY+  +++  K RW+ + + EVF  +F S +  + K   +   + +N ++ T++DY+++  D + H  HRHE P+ D PI++I E+D + VV KP S+PVH+  +Y  +TV+G L  + G   LRV+HR+DR TSG+LLF K+YET  +    ++  +  K Y+  V G F +E++    C++ +G L   +G   ++ V   GK A ++F  L  +  Q++  V  +  TGRTHQIRVH Q+LG PI+ D +YN   WG  KGK   Y KS ++L ED+   H      ++E  NPE  Q       +   I  +  +      P  DE   +  CN +      ++F L+LH  +Y T    W ++T++P+W 
Sbjct:   62 DGVRHLAPYWACYRTRTKGRWIGRKMVEVFSGEFLSTNRNYAKIACKMGRIYVNGEQMTDVDYVMRNGDRVEHWAHRHEHPIRDLPIRVISETDDLFVVEKPPSLPVHTCGQYAIHTVLGQLRVNEGRTGLRVLHRLDRATSGVLLFAKNYETDLEFKTTLKQGEWSKEYICKVDGVFPDEEQV---CEQPIGPLVISMG---IQCVRPDGKDAKSRFRKLWSDGTQSVVQVHIE--TGRTHQIRVHSQFLGHPIAGDQIYNSAVWGPTKGKNADYQKSFDELCEDVRNTH--KCENWHEKPNPEFEQRMEHLAADTTPITPEAPSLTLEQRPEFDEICQK--CNVESKKVPENHFQLYLHCLKYET--KKWSFKTEMPDWA 429          
BLAST of Pseudouridine synthase vs. TrEMBL
Match: A0A3R7D786 (RNA pseudouridylate synthase domain-containing protein 2 OS=Clonorchis sinensis OX=79923 GN=Rpusd2 PE=4 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 7.999e-97
Identity = 182/482 (37.76%), Postives = 275/482 (57.05%), Query Frame = 2
Query:   32 FAPVKKISYLNIIDIITMKRLSKNMED-FXXXXXXXXXXXXXXLFRKEALKFKTGENKKNKIISDQYQGDCV--YYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQP--------IECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIIS------DEEARNKY---FEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWVGLFALSPTDKDTLIN 1417
            FA  +K   L ++       L   ME  F  +K  K SKEEKKL +K A + +  E K++      Y+   +  YYF+NG RKV PY   F++ +K RW+++ + EV  ++F    P  + ++ ++ +L +N++  + DY+L+ +D+I+H+VHRHE+PVLD PI  IHE D +LV+ KP+S+PVH   +Y  N++  IL + +  + LR  HR+DRMTSG+++  K+Y+ S +L+ +I  R+V KYY+  V G F +E E          I C + LG LC K+GL  V S   GGK A T F  L Y+   N SLV+C+  TGRTHQIR+HLQYLG+PI++DPLYN   WG  KGK   Y    +++I  + A+     +  + +G   ++  F   +  ++      D+E R++    F+ +C EC+ RF  + D+   VL LHAYRY     DW Y   +P+W    A   +D   LI 
Sbjct:   43 FAGFRKTEKLRMVHRTLAHCLQDPMETVFPKTKIPKCSKEEKKLLQKAAARSRRQERKRSLEDFLHYESINISDYYFENGLRKVFPYHFMFKAYVKRRWIDRPIHEVLLDEFNFPFPDIIHARCDSGDLRVNDECISPDYLLRDSDMISHKVHRHEMPVLDSPIDFIHEDDDLLVINKPASIPVHPCGQYTLNSLTHILARQYDRRPLRFTHRLDRMTSGLMIIAKNYDASLRLATEISAREVKKYYICRVDGHFPDEVEDSPSTLPQGVIACTQPLGPLCSKMGLHAVVSESSGGKPACTHFKRLLYDPDTNTSLVVCRLFTGRTHQIRIHLQYLGYPITDDPLYNSSDWGDRKGKGAQYGVPVDEVIRRISAHRSKDSYLDFVHGTESSISGFDRLRDHLNSTRSALDKEVRDRLLQSFDSTCPECI-RFYKDPDMKCLVLQLHAYRYEGA--DWSYTASLPSWATSLASHTSDFPALIQ 521          
BLAST of Pseudouridine synthase vs. TrEMBL
Match: A0A1S8X9Q7 (Pseudouridine synthase OS=Opisthorchis viverrini OX=6198 GN=X801_00666 PE=3 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 7.446e-95
Identity = 164/440 (37.27%), Postives = 255/440 (57.95%), Query Frame = 2
Query:  158 LFRKEALKFKTGENKKNKIISDQYQGDCV--YYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVK-SQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQP--------IECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIIS------DEEARNKY---FEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWVGLFALSPTDKDTLIN 1417
            L +K A + +  E K++      Y+   +  YYF+NG RKV PY   F++ +K RW+++S+ EV  ++F    P  +K ++ ++ +L +N++  + DY+L+ +D+I+H+VHRHE+PVLD PI  IHE D +LV+ KP+S+PVH   +Y  N++  IL K +  + LR  HR+DRMTSG+++  K+Y+ S +L+ +I  R+V KYY+    G F +E E          I C + LG +C K+GL  V     GGK A T F  L Y+   N SLV+C+  TGRTHQIR+HLQYLG+PI++DPLYN   WG  KGK   Y    +++I  +  +     +  + +G    +  F + +  ++      D+E R++    F+ +C EC +RF  + D+ + VL LHAYRY     +W Y   +P+W    A   +D   LI 
Sbjct:   33 LLQKAAARSRKQERKRSLEDFLHYESIDISDYYFENGLRKVFPYHFMFKAYVKRRWIDRSIHEVLLDEFNFPFPDIIKHARCDSGDLRVNDERISPDYLLRDSDMISHKVHRHEMPVLDSPIDFIHEDDDLLVINKPASIPVHPCGQYTLNSLTHILAKQYDRRPLRFTHRLDRMTSGLMIVAKNYDASLRLATEIGAREVKKYYICRADGHFPDEVEDTPNTLPQGVIACTQPLGPICSKMGLHAVVPESSGGKPACTHFKRLLYDSNTNTSLVVCRLFTGRTHQIRIHLQYLGYPITDDPLYNSSDWGDKKGKGAQYGIPVDEVIRKISTHRSKDSYLDFVHGTESNISGFDKFRDHLNSTHSALDKEVRDRLLQSFDSTCPEC-NRFYKDPDMKSLVLQLHAYRYEGA--EWSYTASLPSWATRLASHTSDFPALIQ 469          
BLAST of Pseudouridine synthase vs. TrEMBL
Match: A0A5J4NEE2 (Pseudouridine synthase OS=Paragonimus westermani OX=34504 GN=DEA37_0013999 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 1.573e-94
Identity = 164/401 (40.90%), Postives = 239/401 (59.60%), Query Frame = 2
Query:  245 YYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPL--FVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQP--------IECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIIS-----DEEARNKY---FEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWVGLFALSP 1393
            YYF+NGFRKV+PY   F+S  K RWL +S+ +V   +F  N PL   +  +  + +L +N+     +YIL+ +D+I+H+VHRHELPVL+ PIK +HE D VLV+ KP+S+PVH   +Y  N+++ IL K +G + LR IHR+DRMTSG+++  K+Y+ S +L+ QI  R+V KYY+  V G+F +             I C + LG +C K+GL  V   ++GGK + T F+ L YN     SLVLC+  TGRTHQIRVHLQYLG+PI  DPLYN   WG+ KGK   Y    +++I  + +N   + +        E+ ++F + K  IS     D + R++    F+  C +C   +  + D+ N VL LHAY+Y     DW Y   +P+W     +SP
Sbjct:   62 YYFENGFRKVYPYHFVFKSYAKRRWLGRSICDVLLEEF--NFPLQSVIPDRCLSGDLRVNDLPITPNYILQDSDLISHKVHRHELPVLNTPIKFVHEDDDVLVLSKPASIPVHPCGQYTLNSMVHILAKEYGRRPLRFIHRLDRMTSGLMITAKNYDASLRLTSQISAREVKKYYVCQVEGRFPDRLPNASQMCAPGVIACDQPLGPICAKLGLHAVVPEKDGGKASLTHFLRLAYNPLIKSSLVLCRLFTGRTHQIRVHLQYLGYPIVGDPLYNSTDWGEMKGKGAQYDIPLDEIIRRISSNRTAASYLNENQSFTESSRSFDQFKERISASNSLDSDTRDRLVRSFDHHCPDCRLCYR-DPDIRNLVLRLHAYQY--CGLDWSYVAPLPDWATGDMMSP 457          
BLAST of Pseudouridine synthase vs. TrEMBL
Match: A0A4S2LZ79 (Pseudouridine synthase OS=Opisthorchis felineus OX=147828 GN=CRM22_004943 PE=3 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 1.875e-93
Identity = 163/439 (37.13%), Postives = 249/439 (56.72%), Query Frame = 2
Query:  158 LFRKEALKFKTGENKKNKIISDQYQGDCV--YYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQP--------IECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIIS------DEEARN---KYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWVGLFALSPTDKDTLIN 1417
            L +K A + +  E K++      Y+   +  YYF++G RKV PY   F++ +K RW+++S+ EV  ++F    P  + ++ ++ +L +N++  + DY+L+ +D+I+H+VHRHE+PVLD PI  IHE   +LV+ KP+S+PVH   +Y  N++  IL K +  + LR  HR+DRMTSG+++  K+Y+ S +L+ +I  R+V KYY+    G F +E E          I C + LG +C K+GL  V     GGK A T F  L Y+   N SLV+C+  TGRTHQIR+HLQYLG PI++DPLYN   WG  KGK   Y    +++I  +  +     +  + +G    +  F   +  ++      D+E R+   K F+ +C EC +RF  + D    VL LHAYRY     DW Y   +P+W    A   +D   LI 
Sbjct:   33 LLQKAAARSRKQERKRSLEDFLHYESIEISDYYFEDGLRKVFPYHFIFKAYVKRRWIDRSIHEVLLDEFNFPFPDIIHARCDSGDLRVNDECISPDYLLRDSDMISHKVHRHEMPVLDSPIDFIHEDSDLLVINKPASIPVHPCGQYTLNSLTHILAKQYDRRPLRFTHRLDRMTSGLMIIAKNYDASLRLATEISAREVKKYYICRADGHFPDEVEDSPGTLPQGVIACTQPLGPICSKMGLHAVVPESSGGKPACTHFKRLLYDPNTNTSLVVCRLFTGRTHQIRIHLQYLGHPITDDPLYNSSDWGVKKGKGAQYGMPLDEVIRKISTHRTKDSYLDFVHGTESNISGFDRFRDHLNSTRSALDKEVRDCLLKSFDSTCPEC-NRFYKDPDTKCLVLQLHAYRYEGA--DWSYTASLPSWATSLASHTSDLPALIQ 468          
BLAST of Pseudouridine synthase vs. TrEMBL
Match: A0A553NBS4 (PseudoU_synth_2 domain-containing protein OS=Tigriopus californicus OX=6832 GN=TCAL_12503 PE=4 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 1.927e-93
Identity = 158/400 (39.50%), Postives = 243/400 (60.75%), Query Frame = 2
Query:  191 GENKKNKIISDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVS---VHRFYENGNPETLQTF-TENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWVGL 1378
            G N +    SD+   +  YYF  G R+V+PY  TF +  K RW+ + + +VF  +F + +P      IE+ ++LIN + T  DY+L+ ND++ + VHRHE+PV D+ ++IIH+   ++VV KP+S+PVH   +Y  N+++ IL K   ++ L  IHR+DR+TSG+LL G++   +  +  QIR R VLK Y+  V G+F  E+   + C++ + IL  K+G+     V+  GK   T+F  ++ N ++  S+V CKP TGR HQIRVHLQ+LGFPI+NDPLYN  ++G D+GK GV+ KS++QLI+DL+  H+          E+  P++++   T   S  S+ + R K   P+C ECL ++  +   D  V+FLHA +Y     DW Y T +P W  L
Sbjct:  178 GRNTRRSGFSDEKYDETSYYFAGGLRRVYPYAFTFATFAKRRWVGRPLMDVFATEFRAKTPPEYVRSIESGDILINGQPTTADYVLRDNDLLANTVHRHEVPVTDQRVQIIHQDQDLVVVNKPASIPVHPCGRYRHNSLVFILAKEFELKHLNTIHRLDRLTSGLLLLGRNPAIARTMEQQIRGRLVLKEYVCRVQGQFPAER---VVCREPIEILSHKIGIC---RVDPQGKACETEFELVQTNGQE--SVVRCKPHTGRMHQIRVHLQFLGFPITNDPLYNHEAFGPDRGKGGVFGKSQDQLIQDLIDAHNSERWLASASPEDAAPKSMKVMETPPNSSSSETDPRLKPV-PNCAECLVKYK-DPTADELVMFLHALKYS--GHDWSYETPLPAWSKL 565          
BLAST of Pseudouridine synthase vs. Ensembl Cavefish
Match: rpusd2 (RNA pseudouridine synthase domain containing 2 [Source:NCBI gene;Acc:103042945])

HSP 1 Score: 234.958 bits (598), Expect = 6.108e-70
Identity = 129/314 (41.08%), Postives = 194/314 (61.78%), Query Frame = 2
Query:  197 NKKNKIIS--DQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPL--FVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANH 1126
             K+N  +S   ++  +  YYF+ G RKV PY+  F++  K RW+ K++ +VF  +F +  PL  + K+  E +  L      +L+  LK ND + + VHRHE PV+  P++I+ +   V+VV KP+S+PVH   +Y  NTV+ IL K  G+  L  +HR+DR+TSG+LLF +  E S KL   +RDRQ+ K Y+  V G+F + +   + C++ + ++  KVG   V  V+  GK   T F  L YN +   S+V C+PLTGRTHQIRVHLQ+LGFPI NDP+Y   +WG ++GK GV   + ++L+E L++ H
Sbjct:  129 QKRNPAVSFTPEHFAETSYYFEAGLRKVRPYYFDFKTYCKGRWIGKTLLQVFSTEFRAE-PLDYYRKAAKEGRIRLNEEPVEDLNIRLKNNDFLRNTVHRHEPPVVGRPLEILVDDGEVVVVDKPASLPVHPCGRYRHNTVIFILGKERGLHALHTVHRLDRLTSGVLLFARTLEVSKKLDQMVRDRQLEKEYVCRVDGEFPDGE---VVCEEPILVVSFKVG---VCRVDPKGKDCRTVFQKLSYNGRS--SVVRCRPLTGRTHQIRVHLQFLGFPILNDPIYGASAWGPNRGKGGVVGVNDDELLEALISEH 433          
BLAST of Pseudouridine synthase vs. Ensembl Cavefish
Match: rpusd1 (RNA pseudouridine synthase domain containing 1 [Source:NCBI gene;Acc:103042140])

HSP 1 Score: 59.3066 bits (142), Expect = 2.501e-9
Identity = 44/136 (32.35%), Postives = 65/136 (47.79%), Query Frame = 2
Query:  644 LRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVE--EGGKIASTKFMFLKYN--EKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYN 1039
             R  H++D  TSG L    +   + +     ++R V K YLA+V G   EEK   I+          K  +  V+  E  E  K + T+   L+Y   +   ++ VL +P TGRTHQ+RVH   +G PI  D  Y+
Sbjct:   60 FRFCHQLDFSTSGALCVALNKAAAGRAYHFFKNRLVTKAYLALVRGSVPEEKLM-IDFAIGKNSTEGKTHMMCVEETEGCENPKPSQTELNVLEYGVYDGDPVTKVLLQPRTGRTHQLRVHCSAIGHPIVGDYTYS 194          
BLAST of Pseudouridine synthase vs. Ensembl Sea Lamprey
Match: rpusd2 (RNA pseudouridine synthase domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-120411-43])

HSP 1 Score: 201.06 bits (510), Expect = 1.014e-60
Identity = 121/336 (36.01%), Postives = 174/336 (51.79%), Query Frame = 2
Query:  482 RHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAY---VKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANH-------------DVSVHRFYE----------NGNPETLQ----------TFTENKSIISDEEARNKYF---EPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            RHE PV   P+ ++ ++D ++VV KPSSMPVH   +Y  NTV+ +L K HG+  L  +HR+DR+TSG+LLF    E   +L  QIR+R+V K YL  V G+F   + +     + +    P + ++Y   V  V+  GK   T F  L YN +   S++LC+P TGR HQIRVHLQ+LG PI NDP+YN  +WG  + + G   KS EQL++DL+A+              D  V    E          +GN +T Q              N+ + +  EA + +    +P C EC  +   +   D  ++FLHA RYR     W+Y    P W 
Sbjct:    1 RHEPPVAAGPVTLLAQTDELVVVDKPSSMPVHPCGRYRHNTVIFVLGKEHGLAPLHTVHRLDRLTSGVLLFAHTLEAVQRLDRQIREREVQKEYLCRVEGRFPGGEGE---EAEEVVCAEPVLVVSYSVGVCRVDTRGKPCRTTFTRLSYNGRS--SVLLCRPETGRMHQIRVHLQFLGHPILNDPVYNAAAWGPARARGGTIGKSDEQLLQDLLADRRRLGEEVTESCDGDCGVIGNGEGSIVGGGIACSGNDDTAQKSSAGSGGGDGGGTNEPVTTSSEAEDSWAGGQDPLCSEC-RQTRPDPRPDQLIMFLHALRYR--GPGWEYTAPTPEWA 328          
BLAST of Pseudouridine synthase vs. Ensembl Sea Lamprey
Match: rpusd2 (RNA pseudouridine synthase domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-120411-43])

HSP 1 Score: 189.889 bits (481), Expect = 1.338e-55
Identity = 118/393 (30.03%), Postives = 193/393 (49.11%), Query Frame = 2
Query:  245 YYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNE---KQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHK--------SKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYF----EPSCDEC-LSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWVG 1375
            +      RKV PY+    +  K RWL  S+++++E +F+S +    ++      L +N + T+LD +L+  D I  R HRHE PV   P+ ++ E   ++ V KP+S+PVH   +Y   +++ +L K  G+  L  +HR+DR+ SG+++F K  E S ++  QIR R V K YL  V G+F   +   + C++ L ++  ++G++ V  +   GK + + F  L+Y+        SL+ C P+TGR+HQ+RVHLQ LGFPI  DP+Y   +W        V  +        S   L+E L A  + +  R                 S ++ E    +      +P C EC L R   +    +  + LHA RY      W +   +P+W  
Sbjct:   21 FVLHGSLRKVRPYYADATARCKARWLGLSLRQLYEREFHSETVASYEAACAVGRLTLNGRRTHLDAVLRDGDTIRLRAHRHEPPVSSRPVVVVAEEHDLVAVDKPASLPVHPCGRYRHGSLLFVLGKERGVSGLHTLHRLDRLASGLVVFAKSREASRRVDEQIRQRLVHKEYLCRVVGEFPAGE---VVCEEPLSVVEGRLGVSRVDRL--AGKPSRSLFRRLRYDADTCAGGSSLLSCVPVTGRSHQLRVHLQSLGFPILLDPVYGSPAWANGAPLVDVLRRIADETCEPSARSLVERLGAADEWAWGRIPPG---PGGVRGGGGVSDVASEAVMAEVVWPEKDPICSECRLQRP--DPRPRDLGMCLHALRY--SGPGWGFEVPMPDWAA 401          
BLAST of Pseudouridine synthase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009045.1 (pep scaffold:Pmarinus_7.0:GL484265:15078:19154:1 gene:ENSPMAG00000008183.1 transcript:ENSPMAT00000009045.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 9.578e-13
Identity = 58/220 (26.36%), Postives = 94/220 (42.73%), Query Frame = 2
Query:  518 IIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGIL---------HKSH-------------GIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEK---EQPIECKKSLG--------ILCPK-----VGLAYVK-SVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQY-LGFPISNDPLYNCISWGK 1057
            +IH+   ++VV KP  +PVH       N V  +L         H S                 +L + HR+DR T+G L+  ++ E +  ++  +R+R+  + Y AV  G     +   + P+  +K  G         + P+        A VK  +  G + A T++  L    +   +LV  +PLTG  HQ+RVHL   LG P   D  Y+    G+
Sbjct:   41 VIHQQRELIVVNKPYGIPVHGGPGVGRNNVAAVLPVLEQLLDGHPSRRRHRKNTTAGDDATASKLHLCHRLDRDTTGALVLARNAEAADAVASLLRERRAERTYWAVTVGVPQPARGVVDLPVGERKHEGPDGVTYRMAVMPRFHYVDASNALVKRRLPRGARTAVTQYRVLAEGAEGRSALVELRPLTGHKHQLRVHLALGLGTPALGDHKYSPRRQGQ 260          
BLAST of Pseudouridine synthase vs. Ensembl Yeast
Match: RIB2 (Bifunctional DRAP deaminase tRNA:pseudouridine synthase; the deaminase catalyzes the third step in riboflavin biosynthesis and the synthase catalyzes formation of pseudouridine at position 32 in cytoplasmic tRNAs; RIB2 has a paralog, PUS9, that arose from the whole genome duplication [Source:SGD;Acc:S000005427])

HSP 1 Score: 233.032 bits (593), Expect = 3.083e-70
Identity = 137/389 (35.22%), Postives = 208/389 (53.47%), Query Frame = 2
Query:  263 FRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPI---ECKKSLGILCPKVGL-AYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLY-NCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTD-------WDYRTDIPNWVGLFALSP 1393
             RK+ PYF T+++  KERW ++ + +VF ++F    P +    I    + +N++  NLD I++  D+ITH+VHRHE PV  +PI I+ E + +LV+ KPSS+PVH   +Y FNT+  +L +  G   +   +R+D+ TSG++   K    + ++  Q++ R+V K Y+A V G+F      PI   E  K +  + PKV L A  +  +E  K A T F  + Y+ +   S+V CKPLTGRTHQIRVHLQYLGFPI+NDP+Y N   WG D G+ G             + N+D  V +       + +      +S I             C+EC +    +   ++  L+LHA+RY +++ +       W YRT  P W    AL P
Sbjct:   78 LRKIEPYFFTYKTFCKERWRDRKLVDVFVSEFRDREPSYYSKTIAEGKVYLNDEPANLDTIIRDGDLITHKVHRHEPPVTSKPIDIVFEDEDILVIDKPSSIPVHPTGRYRFNTITKMLERQLGY-SVHPCNRLDKPTSGLMFLAKTPLGADRMGDQMKAREVTKEYVARVKGEF------PIGIVEVDKPVRSVNPKVALNAVCEMSDENAKHAKTVFQRVSYDGQT--SIVKCKPLTGRTHQIRVHLQYLGFPIANDPIYSNPDIWGPDLGRGG-------------LQNYDDIVLKL------DAIGKTNPAESWIHPHSEGEYLLGRQCEECEAEMYTDPGTNDLDLWLHAFRYESLERNSDTQKPLWSYRTKYPEW----ALEP 434          
BLAST of Pseudouridine synthase vs. Ensembl Yeast
Match: PUS9 (Mitochondrial tRNA:pseudouridine synthase; catalyzes the formation of pseudouridine at position 32 in mitochondrial tRNAs; contains an N-terminal mitochondrial targeting sequence; PUS9 has a paralog, RIB2, that arose from the whole genome duplication [Source:SGD;Acc:S000002194])

HSP 1 Score: 223.787 bits (569), Expect = 5.353e-68
Identity = 132/379 (34.83%), Postives = 208/379 (54.88%), Query Frame = 2
Query:  263 FRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEE-GGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLY-NCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRY-------RTVDTDWDYRTDIPNWV 1372
             RK+ PY  T+++  KERW +K + +VF ++F      + K  IEN ++ IN++  +L  +++  D+ITH+VHRHE PV   PIK+I E D ++V+ KPS +PVH   +Y FNT+  +L  + G   +   +R+DR+TSG++   K  + +  +  Q++ R+V K Y+A V G+F E +   +  +K L ++ P++ L  V  ++E G K A T F  + Y+ K   S+V CKPLTGR+HQIRVHLQYLG PI+NDP+Y N   WG + GK G              A+ D+ + +  E G  +  +++  +     +   + K     C  C S    +   ++  L+LHAY Y        T    W Y+T+ P W 
Sbjct:  105 LRKIKPYHFTYRTFCKERWRDKKLVDVFISEFRDRESEYYKRTIENGDVHINDETADLSTVIRNGDLITHQVHRHEPPVTSRPIKVIFEDDNIMVIDKPSGIPVHPTGRYRFNTITKMLQNNLGF-VVNPCNRLDRLTSGLMFLAKTPKGADNIGDQLKAREVTKEYVAKVVGEFPETE---VIVEKPLKLIEPRLALNAVCQMDEKGAKHAKTVFNRISYDGK--TSIVKCKPLTGRSHQIRVHLQYLGHPIANDPIYSNDEVWGNNLGKGG-------------QADFDIVITKLDEIGKRKPAKSWFHSNGGYGEVLRQEK-----CSICESDLYTDPGPNDLDLWLHAYLYESTETEEGTEKKKWCYKTEYPEWA 459          
BLAST of Pseudouridine synthase vs. Ensembl Yeast
Match: PUS6 (tRNA:pseudouridine synthase; catalyzes the conversion of uridine to pseudouridine at position 31 in cytoplasmic and mitochondrial tRNAs; mutation of Asp168 to Ala abolishes enzyme activity; not essential for viability [Source:SGD;Acc:S000003401])

HSP 1 Score: 157.918 bits (398), Expect = 6.607e-44
Identity = 119/412 (28.88%), Postives = 192/412 (46.60%), Query Frame = 2
Query:  248 YFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNL------DYILKPNDVITHRVHRHELPVL----------DEP-----IKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKF--------NEEKEQPI--ECKKSLGILCPKVGLAYVKSVEEG---GKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARN-KYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWVGL 1378
            Y QNG RKV PY++   + +K RWL K + +V  ++F      +   QI      +      L        I+K +DV+    H+HE PV           D P       I+ E +++LV+ KPS +PVH   +++ NT+  +L K HG+  L   +R+D++TSG+L+  K+ +++ ++   IR R ++K YLA V G+F        NE   +    +  K    + P   +   +    G    K A TKF  ++Y    + ++V CKP+TGRTHQIR+HL  LG PI ND +Y           C    K  E+L         ++    +EN      +          DE   N +  E  C EC +    +  + +  L+LHA++Y  ++  + ++TD+P W  L
Sbjct:   10 YTQNGLRKVRPYYNRRSAFVKGRWLGKLLIDVLVSEFKLRPRAYYLDQIRKGTYRLIRDGVPLVPDHLMTTIIKNHDVLETTTHKHEPPVKQWCSQEVEAEDLPGRIAGFNIVFEDESILVIDKPSGIPVHPTGQFYQNTITELL-KLHGVDALPC-YRLDKITSGLLILAKNSQSAGEIQKSIRSRDMIKIYLARVKGRFPHSELILDNENAAETTFEDTSKVTVEMTPIYSIDPKRQFPVGLSTSKDAITKFYPIRYFSHADETVVACKPITGRTHQIRIHLARLGHPIVNDSVY-----------CSHITKYPERL-------KFITQFPRWENQQDLDAEELKVRFQKFVDETKNNCRTMETFCPECHTVDLKDPVLSDLELWLHAWKYEEINGKFKFKTDLPKWAQL 401          
BLAST of Pseudouridine synthase vs. Ensembl Yeast
Match: PUS5 (Pseudouridine synthase; catalyzes only the formation of pseudouridine (Psi)-2819 in mitochondrial 21S rRNA; not essential for viability [Source:SGD;Acc:S000004155])

HSP 1 Score: 46.595 bits (109), Expect = 2.863e-6
Identity = 53/197 (26.90%), Postives = 83/197 (42.13%), Query Frame = 2
Query:  500 LDEPIKIIHESDTVLVVCKPSSMP-----VHSVSKYHFN--------TVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLS-----GQIRDRQVLKYYLAVV--SGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHL-QYLGFPISND 1027
            L + I II E+    +V KP  +P       +  + H N            I +    ++  R +HR+D   +G +L  K  + S K S     G     ++ + Y+A+V  SG+FN+     I           K G  Y   +  GG+   TKF  +  N       ++ + +TG+ HQIR H+ Q L  PI ND
Sbjct:    3 LKKQIPIIFENTHYFIVNKPPGIPSQPPDCRTWGRTHPNLDPTPLLERFKAIYYSHREVELCRTVHRLDHCVTGGMLIAKTKDGSVKFSRFLQKGGNNGYKLQRKYVAIVESSGRFNKPNNYEI-----------KYGPKYNFLISHGGR-EITKFKEVDEN------CIVLQLVTGKKHQIRNHVSQILNQPILND 181          
BLAST of Pseudouridine synthase vs. Ensembl Nematostella
Match: EDO47303 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMP5])

HSP 1 Score: 242.662 bits (618), Expect = 2.693e-75
Identity = 147/422 (34.83%), Postives = 215/422 (50.95%), Query Frame = 2
Query:  251 FQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDV----SVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPS-----------------C-------------DECLSRFSCNEDVD--------------NFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            F  G R V PY+ TF S+ K RWLN+ + ++F  +F S S  + +  IE+  + +N ++     +L+ NDV+ +RVHRHE PV D+P++II  +D ++V+ KPSS+PVH   +Y  NTV+ +L K H ++ L  IHRIDR+TSGIL+F K    +  L  Q+RDRQV K YL  V G+F  E   P++C++ + ++  KVG+  V      GK   T F  L  N K   S+V C P TGR HQIRVHLQ+LG+PI +DP+YN  +WG  +G+ GV      ++I+ L  +  +     V     +   ET    T N   I+   +  +   PS                 C             DE   +     D D                 ++LHA  Y+    DW+Y T +P+W 
Sbjct:    1 FSTGLRHVKPYYFTFTSHCKGRWLNRELLDIFREEFRSESISYYEKAIESGKITVNGEKVLPTTVLRGNDVLRNRVHRHEPPVTDQPLEIICNTDDIVVLNKPSSIPVHPCGRYRHNTVVFLLGKEHNLRNLYTIHRIDRLTSGILMFAKTLTRARMLEAQVRDRQVEKEYLCRVQGEFPSE---PVDCEQPIIVVSHKVGICRVSP---DGKSCRTVFTKLHSNGKS--SVVKCIPYTGRMHQIRVHLQWLGYPIIDDPIYNHPAWGTKRGRGGVTDDQALEVIKALAQSTTIIEGDDVGYTPRDREAETRPIPTHNSKNINTGMSLAQAHAPSGLTAEQSAHGLTPVPNKCRDDNANMETGAQHDEMSPQGEGERDADCSECRIWRRDPTPQELTMYLHALSYK--GPDWEYCTSVPSWA 412          
BLAST of Pseudouridine synthase vs. Ensembl Nematostella
Match: EDO47554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM79])

HSP 1 Score: 53.5286 bits (127), Expect = 8.476e-8
Identity = 56/194 (28.87%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  518 IIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLR----VIHRIDRMT----------SGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCP---------KVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQ-YLGFPISND 1027
            +I  ++ ++ + KP  +PVH        +V  +L +   I+  +    + HR+D+            SG+LL  ++   + K++   + R V K YLAV  G    E E  I      G + P          VG  + +  E G K A TKF  L  N+    SL+  +P+TG   QIRVHL   L  PI  D
Sbjct:   25 VIFSNNDLIAINKPYGLPVHGGPGVVL-SVAELLEEFAAIKNYQNKPELAHRLDKYGTDYTIMLIDCSGVLLLTRNKTAAQKIAEMFQSRMVKKRYLAVSVGVPRYE-EGTISIPVGYGRVGPWERIIIRQDLVGKTHKEITEAGFKQAITKFKILDENQ-STCSLLEIEPITGHKQQIRVHLADALRCPILGD 215          
BLAST of Pseudouridine synthase vs. Ensembl Medaka
Match: rpusd2 (RNA pseudouridine synthase domain containing 2 [Source:NCBI gene;Acc:101173104])

HSP 1 Score: 254.988 bits (650), Expect = 3.070e-78
Identity = 155/430 (36.05%), Postives = 231/430 (53.72%), Query Frame = 2
Query:  218 SDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKET-NLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKS----------------------IISDEEARNKY--FEPS-------------------CDEC-LSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWV 1372
            S ++  +  YYF  G RKVHPY+  F++  K RW+ KS+ EVFE++F + +  + +   +   + +N     +L  +LK ND + + VHRHE PV+  P++I+ +   VLVV KP+S+PVH   ++  NTV+ IL K +G+ +L  +HR+DR+TSG+LLF +  ETS KL   +RDR++ K Y+  V G+F E +   + C++ + ++  KVGL     V+  GK   T F  L +N K   S+V C PLTGRTHQIRVHLQ+LGFPI NDP+Y   +WG ++GK GV  KS E++++ L     V  HR  E  NP+ L   T  K                       +I+D  +        P+                   C EC + R    E     +++LHA RY+    D++Y T +P W 
Sbjct:  123 SQEHFSETSYYFDGGLRKVHPYYFDFKTYCKGRWIGKSLLEVFESEFRAETVEYYQQAAKEGRIRLNEAPVEDLSVVLKNNDHMRNTVHRHEPPVVGTPLEILVDDGQVLVVDKPASIPVHPCGRFRHNTVIFILGKEYGVSELHTVHRLDRLTSGVLLFARTVETSKKLDKMVRDREIEKEYVCRVEGEFPEGE---LVCEEPILVVSFKVGLC---RVDPKGKECRTVFQRLSFNGK--TSVVRCSPLTGRTHQIRVHLQFLGFPILNDPIYGSSAWGPNRGKGGVVGKSDEEILQAL-----VEEHRSQE--NPDLLNDLTGGKEVAEKNFTDKCRQQVDPCGDETDVITDSTSVKDSINLPPTTANGSEKTADVPKISQDHLCSECKIVRPDPTE--KELIMYLHALRYK--GPDFEYFTRLPEWA 533          
BLAST of Pseudouridine synthase vs. Ensembl Medaka
Match: rpusd1 (RNA pseudouridine synthase domain containing 1 [Source:NCBI gene;Acc:101166304])

HSP 1 Score: 61.6178 bits (148), Expect = 3.794e-10
Identity = 59/195 (30.26%), Postives = 84/195 (43.08%), Query Frame = 2
Query:  494 PVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQL---------RVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVE--EGGKIASTKFMFLKYN--EKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYN 1039
            P   E + ++H S   LV+ K   + + S   Y   TV   L   H    L         R  H++D  TSG L    +   + +     +DR V K YLA+V G   EE  Q I           K  +  ++  E  E  K + TK   L+Y   +   ++ VL +PLTGRTHQ+RVH   +G  I  D  Y+
Sbjct:    6 PASIENLHVLHHSKDFLVLDKHWDIRIDSKMWYEKLTVQAQLQ--HHFPDLADPSTYYGFRFCHQLDFSTSGALCVALNKAAAGRAYRCFKDRTVTKAYLALVRGTV-EETTQTIRFSIGKNSTEGKKHMMLIEGSEGCENPKPSETKLTVLEYGLYDGDPVTKVLLQPLTGRTHQLRVHCSAIGHSIVGDFTYS 197          
BLAST of Pseudouridine synthase vs. Ensembl Medaka
Match: rpusd1 (RNA pseudouridine synthase domain containing 1 [Source:NCBI gene;Acc:101166304])

HSP 1 Score: 61.6178 bits (148), Expect = 3.794e-10
Identity = 59/195 (30.26%), Postives = 84/195 (43.08%), Query Frame = 2
Query:  494 PVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQL---------RVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVE--EGGKIASTKFMFLKYN--EKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYN 1039
            P   E + ++H S   LV+ K   + + S   Y   TV   L   H    L         R  H++D  TSG L    +   + +     +DR V K YLA+V G   EE  Q I           K  +  ++  E  E  K + TK   L+Y   +   ++ VL +PLTGRTHQ+RVH   +G  I  D  Y+
Sbjct:    6 PASIENLHVLHHSKDFLVLDKHWDIRIDSKMWYEKLTVQAQLQ--HHFPDLADPSTYYGFRFCHQLDFSTSGALCVALNKAAAGRAYRCFKDRTVTKAYLALVRGTV-EETTQTIRFSIGKNSTEGKKHMMLIEGSEGCENPKPSETKLTVLEYGLYDGDPVTKVLLQPLTGRTHQLRVHCSAIGHSIVGDFTYS 197          
BLAST of Pseudouridine synthase vs. Planmine SMEST
Match: SMESG000051935.1 (SMESG000051935.1)

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 446/452 (98.67%), Postives = 447/452 (98.89%), Query Frame = 2
Query:  104 MEDFXXXXXXXXXXXXXXLFRKEALKFKTGENKKNKIISDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWVGLFALSPTDKDTLINKLEFLTGSDCDIFD 1459
            MEDFSSSKKHKMSKEEKKL RKEALKFKTGENKKNKIISDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPI IIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVV GKFNEEKEQPIEC K LGILCPKVGLAY+KSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWVGLFALSPTDKDTLINKLEFLTGSDCDIFD
Sbjct:    1 MEDFSSSKKHKMSKEEKKLLRKEALKFKTGENKKNKIISDQYQGDCVYYFQNGFRKVHPYFHTFQSNIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILKPNDVITHRVHRHELPVLDEPINIIHESDTVLVVCKPSSMPVHSVSKYHFNTVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVGGKFNEEKEQPIECNKPLGILCPKVGLAYLKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISWGKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSIISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYRTDIPNWVGLFALSPTDKDTLINKLEFLTGSDCDIFD 452          
BLAST of Pseudouridine synthase vs. Planmine SMEST
Match: SMESG000021497.1 (SMESG000021497.1)

HSP 1 Score: 60.4622 bits (145), Expect = 7.403e-10
Identity = 44/149 (29.53%), Postives = 69/149 (46.31%), Query Frame = 2
Query:  644 LRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFN-----EEKEQPIECKK---SLGILCPKVGLAYVKSVEEG--------GKIASTKFMFLKYN--EKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLY 1036
             R  H++D  TSG++  G +     ++S     R   K YLA+V G  N      +    +EC +    +G         Y + ++           + AST+ M L++   + +  S VL  PLTGRTHQ+RVH ++LG  I  D +Y
Sbjct:  101 FRFCHQLDYSTSGVICIGYNKAGCGQVSKSFEKRTAKKQYLALVWGHLNLNNCNSKMTNGLECYRINTEIGTKQVTYSTGYSQYIQCTIDDPLCIKPQSASTEIMVLEHGLYDNKAASKVLLIPLTGRTHQLRVHCKHLGHNIIGDCMY 249          
BLAST of Pseudouridine synthase vs. Planmine SMEST
Match: SMESG000060928.1 (SMESG000060928.1)

HSP 1 Score: 58.9214 bits (141), Expect = 3.772e-9
Identity = 53/154 (34.42%), Postives = 78/154 (50.65%), Query Frame = 2
Query:  638 QQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQVLKYYLAVVSGKFNEE--------KEQPIECK-------KSLGILCPKVGLAYVKSVEEGGKIASTKFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQY-LGFPISNDPLYNCISW 1051
            ++L ++HR+D+ T+G+LL  ++ +++  L    ++R + K YL +  G  +EE        KE  +  +       KS+     K G  + KS  E GKI ST F  L  N   N+SLV C  ++G  HQIR HL Y L  PI  D  Y   SW
Sbjct:  135 ERLHIVHRLDKDTTGVLLLAQNPDSAFLLKDAFKERHIRKNYLCLTHGIPHEEHGIINFNLKEATLGDQIVIRPDMKSVKKNIKKAG--FTKS--EPGKI-STAFNVLCSN--YNISLVQCAMISGVKHQIRAHLAYGLETPILGDHKY---SW 278          
The following BLAST results are available for this feature:
BLAST of Pseudouridine synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPUSD21.244e-8034.66RNA pseudouridine synthase domain containing 2 [So... [more]
RPUSD22.277e-6335.61RNA pseudouridine synthase domain containing 2 [So... [more]
RPUSD43.363e-1327.78RNA pseudouridine synthase D4 [Source:HGNC Symbol;... [more]
RPUSD17.187e-1126.72RNA pseudouridine synthase domain containing 1 [So... [more]
RPUSD17.187e-1126.72RNA pseudouridine synthase domain containing 1 [So... [more]
back to top
BLAST of Pseudouridine synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
K07E8.71.292e-6934.29Pseudouridine synthase [Source:UniProtKB/TrEMBL;A... [more]
K07E8.75.176e-6934.29Pseudouridine synthase [Source:UniProtKB/TrEMBL;A... [more]
K07E8.76.987e-6934.03Pseudouridine synthase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Pseudouridine synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RluA-23.491e-8335.12gene:FBgn0032256 transcript:FBtr0337002[more]
RluA-23.491e-8335.12gene:FBgn0032256 transcript:FBtr0080032[more]
RluA-21.015e-8235.89gene:FBgn0032256 transcript:FBtr0304133[more]
RluA-12.559e-7541.85gene:FBgn0051719 transcript:FBtr0080040[more]
RluA-12.559e-7541.85gene:FBgn0051719 transcript:FBtr0080039[more]
back to top
BLAST of Pseudouridine synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpusd22.094e-6933.55RNA pseudouridine synthase domain containing 2 [So... [more]
rpusd12.194e-1028.93RNA pseudouridine synthase domain containing 1 [So... [more]
rpusd12.194e-1028.93RNA pseudouridine synthase domain containing 1 [So... [more]
back to top
BLAST of Pseudouridine synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RPUSD24.863e-7735.42RNA pseudouridylate synthase domain containing 2 [... [more]
RPUSD17.701e-1331.66RNA pseudouridine synthase domain containing 1 [So... [more]
back to top
BLAST of Pseudouridine synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rpusd21.574e-8036.17RNA pseudouridylate synthase domain containing 2 [... [more]
Rpusd15.556e-1025.99RNA pseudouridylate synthase domain containing 1 [... [more]
Rpusd15.556e-1025.99RNA pseudouridylate synthase domain containing 1 [... [more]
Rpusd48.021e-727.69RNA pseudouridylate synthase domain containing 4 [... [more]
back to top
BLAST of Pseudouridine synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IZ73|RUSD2_HUMAN5.975e-8034.66RNA pseudouridylate synthase domain-containing pro... [more]
sp|Q149F1|RUSD2_MOUSE1.101e-7936.17RNA pseudouridylate synthase domain-containing pro... [more]
sp|Q09709|YA32_SCHPO4.503e-6934.02Uncharacterized protein C18B11.02c OS=Schizosaccha... [more]
sp|Q12362|RIB2_YEAST2.141e-6835.22Bifunctional protein RIB2 OS=Saccharomyces cerevis... [more]
sp|O16686|YK27_CAEEL8.887e-6834.03Uncharacterized protein K07E8.7 OS=Caenorhabditis ... [more]
back to top
BLAST of Pseudouridine synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7D7867.999e-9737.76RNA pseudouridylate synthase domain-containing pro... [more]
A0A1S8X9Q77.446e-9537.27Pseudouridine synthase OS=Opisthorchis viverrini O... [more]
A0A5J4NEE21.573e-9440.90Pseudouridine synthase OS=Paragonimus westermani O... [more]
A0A4S2LZ791.875e-9337.13Pseudouridine synthase OS=Opisthorchis felineus OX... [more]
A0A553NBS41.927e-9339.50PseudoU_synth_2 domain-containing protein OS=Tigri... [more]
back to top
BLAST of Pseudouridine synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpusd26.108e-7041.08RNA pseudouridine synthase domain containing 2 [So... [more]
rpusd12.501e-932.35RNA pseudouridine synthase domain containing 1 [So... [more]
back to top
BLAST of Pseudouridine synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpusd21.014e-6036.01RNA pseudouridine synthase domain containing 2 [So... [more]
rpusd21.338e-5530.03RNA pseudouridine synthase domain containing 2 [So... [more]
ENSPMAT00000009045.19.578e-1326.36pep scaffold:Pmarinus_7.0:GL484265:15078:19154:1 g... [more]
back to top
BLAST of Pseudouridine synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
RIB23.083e-7035.22Bifunctional DRAP deaminase tRNA:pseudouridine syn... [more]
PUS95.353e-6834.83Mitochondrial tRNA:pseudouridine synthase; catalyz... [more]
PUS66.607e-4428.88tRNA:pseudouridine synthase; catalyzes the convers... [more]
PUS52.863e-626.90Pseudouridine synthase; catalyzes only the formati... [more]
back to top
BLAST of Pseudouridine synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO473032.693e-7534.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475548.476e-828.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pseudouridine synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpusd23.070e-7836.05RNA pseudouridine synthase domain containing 2 [So... [more]
rpusd13.794e-1030.26RNA pseudouridine synthase domain containing 1 [So... [more]
rpusd13.794e-1030.26RNA pseudouridine synthase domain containing 1 [So... [more]
back to top
BLAST of Pseudouridine synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000051935.10.000e+098.67SMESG000051935.1[more]
SMESG000021497.17.403e-1029.53SMESG000021497.1[more]
SMESG000060928.13.772e-934.42SMESG000060928.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027035 ID=SMED30027035|Name=Pseudouridine synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=1479bp
AATGAAATTAAAAGTAATTTTTGATCTAATTTTCGCTCCAGTAAAAAAGA
TATCATATTTAAATATTATTGATATTATAACAATGAAACGATTATCTAAA
AATATGGAAGATTTTTCTTCTTCAAAGAAACACAAAATGAGCAAAGAAGA
AAAGAAATTATTCCGTAAAGAAGCCCTAAAATTCAAAACAGGTGAAAATA
AGAAAAACAAAATTATAAGTGATCAATACCAAGGGGATTGTGTGTATTAT
TTTCAAAACGGATTTAGAAAAGTTCATCCATATTTTCACACATTTCAAAG
TAATATTAAGGAGCGTTGGTTGAATAAATCGGTAAAAGAAGTATTTGAAA
ATGATTTTTATTCGAATTCTCCATTATTTGTTAAAAGTCAAATCGAGAAT
AAGAATTTGCTAATTAATAACAAAGAAACAAATTTGGACTATATTTTAAA
ACCGAACGATGTTATAACCCACCGAGTTCATCGGCATGAGCTACCAGTTC
TCGATGAACCAATAAAAATTATCCACGAAAGTGACACTGTTCTTGTCGTT
TGTAAACCGAGCTCAATGCCAGTTCATTCAGTGAGCAAATACCATTTCAA
TACCGTTATGGGGATCCTGCACAAATCTCATGGTATCCAACAGTTGCGAG
TGATTCATCGGATCGACCGGATGACATCGGGAATTCTTCTGTTTGGCAAA
GATTATGAAACAAGCAGCAAATTATCGGGTCAAATCCGGGATCGACAAGT
GCTAAAGTATTATCTCGCAGTCGTCAGTGGGAAATTCAATGAGGAAAAGG
AGCAACCGATCGAATGCAAAAAGTCATTGGGGATTTTGTGCCCGAAAGTT
GGACTGGCCTATGTCAAAAGCGTCGAGGAAGGCGGGAAAATCGCTTCGAC
GAAATTTATGTTTTTAAAATATAACGAAAAACAGAATTTGTCCTTGGTTC
TTTGTAAGCCGCTGACGGGTCGGACTCATCAAATCCGGGTTCATTTGCAA
TATCTCGGATTTCCGATTTCCAATGACCCGTTGTACAATTGCATATCCTG
GGGCAAAGATAAAGGCAAATGCGGCGTATATCATAAATCTAAAGAACAAC
TAATTGAAGATTTGATGGCCAATCACGACGTCTCGGTACACAGATTCTAT
GAGAACGGAAATCCGGAAACTTTACAGACATTCACGGAAAACAAATCAAT
TATTTCTGATGAAGAGGCCCGTAACAAGTATTTTGAGCCCAGTTGTGATG
AGTGTTTGTCTCGGTTTTCCTGTAATGAAGATGTTGATAATTTTGTTCTT
TTCCTTCATGCCTATCGATATAGGACAGTGGATACTGATTGGGACTACAG
GACAGATATTCCGAATTGGGTAGGGCTTTTTGCACTCTCCCCTACTGACA
AGGACACCTTGATCAATAAATTAGAGTTTTTAACAGGCTCCGATTGTGAT
ATTTTTGATTAAATAAATTTGTTTTGTGC
back to top

protein sequence of SMED30027035-orf-1

>SMED30027035-orf-1 ID=SMED30027035-orf-1|Name=SMED30027035-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MKLKVIFDLIFAPVKKISYLNIIDIITMKRLSKNMEDFSSSKKHKMSKEE
KKLFRKEALKFKTGENKKNKIISDQYQGDCVYYFQNGFRKVHPYFHTFQS
NIKERWLNKSVKEVFENDFYSNSPLFVKSQIENKNLLINNKETNLDYILK
PNDVITHRVHRHELPVLDEPIKIIHESDTVLVVCKPSSMPVHSVSKYHFN
TVMGILHKSHGIQQLRVIHRIDRMTSGILLFGKDYETSSKLSGQIRDRQV
LKYYLAVVSGKFNEEKEQPIECKKSLGILCPKVGLAYVKSVEEGGKIAST
KFMFLKYNEKQNLSLVLCKPLTGRTHQIRVHLQYLGFPISNDPLYNCISW
GKDKGKCGVYHKSKEQLIEDLMANHDVSVHRFYENGNPETLQTFTENKSI
ISDEEARNKYFEPSCDECLSRFSCNEDVDNFVLFLHAYRYRTVDTDWDYR
TDIPNWVGLFALSPTDKDTLINKLEFLTGSDCDIFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006225PsdUridine_synth_RluC/D
IPR006145PsdUridine_synth_RsuA/RluA
IPR006224PsdUridine_synth_RluC/D_CS
IPR020103PsdUridine_synth_cat_dom_sf
Vocabulary: biological process
TermDefinition
GO:0009451RNA modification
GO:0001522pseudouridine synthesis
Vocabulary: molecular function
TermDefinition
GO:0009982pseudouridine synthase activity
GO:0003723RNA binding
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.2350.10coord: 164..447
e-value: 7.5E-50
score: 171.4
NoneNo IPR availablePANTHERPTHR21600RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE Bcoord: 52..458
NoneNo IPR availablePANTHERPTHR21600:SF40RNA PSEUDOURIDYLATE SYNTHASE DOMAIN-CONTAINING PROTEIN 2coord: 52..458
NoneNo IPR availableCDDcd02557PseudoU_synth_ScRIB2coord: 156..346
e-value: 6.2402E-89
score: 268.73
IPR006225Pseudouridine synthase, RluC/RluDTIGRFAMTIGR00005TIGR00005coord: 104..349
e-value: 6.5E-62
score: 207.4
IPR006145Pseudouridine synthase, RsuA/RluAPFAMPF00849PseudoU_synth_2coord: 180..333
e-value: 2.4E-30
score: 105.7
IPR006224Pseudouridine synthase, RluC/RluD, conserved sitePROSITEPS01129PSI_RLUcoord: 218..232
IPR020103Pseudouridine synthase, catalytic domain superfamilySUPERFAMILYSSF55120Pseudouridine synthasecoord: 162..444