Cleavage stimulation factor subunit 1

Overview
NameCleavage stimulation factor subunit 1
Smed IDSMED30027032
Length (bp)1324
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cleavage stimulation factor subunit 1 (SMED30027032) t-SNE clustered cells

Violin plots show distribution of expression levels for Cleavage stimulation factor subunit 1 (SMED30027032) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cleavage stimulation factor subunit 1 (SMED30027032) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cleavage stimulation factor subunit 1 (SMED30027032) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027032

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027032h1SMcG0014647 SmedASXL_004466SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027032h1SMcG0014647 SmedASXL_004466SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Human
Match: CSTF1 (cleavage stimulation factor subunit 1 [Source:HGNC Symbol;Acc:HGNC:2483])

HSP 1 Score: 524.628 bits (1350), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 316/425 (74.35%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQLL+DGY + A  ++  + P +   PS +LL L++LG+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD +LVGT H TLR+YD+NT QCFVS  P+DQH  AI  V ++ +++M+ + S DG  K+WDGVS RCI TFEKAH+G  + S  FS+NSKY+L+SGKDS+ KLWE+STGR L+ YTGAG +GRQ+HR+ AVFNHTEDYV+ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTGSKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Human
Match: CSTF1 (cleavage stimulation factor subunit 1 [Source:HGNC Symbol;Acc:HGNC:2483])

HSP 1 Score: 392.119 bits (1006), Expect = 1.278e-134
Identity = 193/339 (56.93%), Postives = 247/339 (72.86%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYT 1056
            KDR  LY+LIISQLL+DGY + A  ++  + P +   PS +LL L++LG+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD +LVGT H TLR+YD+NT QCFVS  P+DQH  AI  V ++ +++M+ + S DG  K+WDGVS RCI TFEKAH+G  + S  FS+NSKY+L+SGKDS+ KLWE+STGR L+ YT
Sbjct:    9 KDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTGSKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYT 345          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Human
Match: CSTF1 (cleavage stimulation factor subunit 1 [Source:HGNC Symbol;Acc:HGNC:2483])

HSP 1 Score: 392.119 bits (1006), Expect = 1.278e-134
Identity = 193/339 (56.93%), Postives = 247/339 (72.86%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYT 1056
            KDR  LY+LIISQLL+DGY + A  ++  + P +   PS +LL L++LG+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD +LVGT H TLR+YD+NT QCFVS  P+DQH  AI  V ++ +++M+ + S DG  K+WDGVS RCI TFEKAH+G  + S  FS+NSKY+L+SGKDS+ KLWE+STGR L+ YT
Sbjct:    9 KDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTGSKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYT 345          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Human
Match: CSTF1 (cleavage stimulation factor subunit 1 [Source:HGNC Symbol;Acc:HGNC:2483])

HSP 1 Score: 144.821 bits (364), Expect = 3.182e-41
Identity = 68/134 (50.75%), Postives = 93/134 (69.40%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLA 441
            KDR  LY+LIISQLL+DGY + A  ++  + P +   PS +LL L++LG+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLA
Sbjct:    9 KDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLA 142          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Human
Match: WDR5B (WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:17826])

HSP 1 Score: 102.449 bits (254), Expect = 1.152e-23
Identity = 78/269 (29.00%), Postives = 126/269 (46.84%), Query Frame = 1
Query:  256 MDLDVETESSTMAPEAALYE-TCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            + L      S   PE   Y   C +  H  A  +  F+  G+ +A+ S D  I I           G  D   +             +TLY H  E+S V +  D +   L S S D T+KL+D  +    K  K    ++ V    F+   + ++ G++ +T++I++V T +C  +      H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+LT+  D+ +KLW+ S GRCL  YTG
Sbjct:   13 LALSSSANQSKEVPENPNYALKCTLVGHTEAVSSVKFSPNGEWLASSSADRLIIIW----------GAYDGKYE-------------KTLYGHNLEISDVAWSSDSSR--LVSASDDKTLKLWDVRSGKCLKTLKG--HSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTL---SAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVD-DDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTG 250          

HSP 2 Score: 63.929 bits (154), Expect = 1.357e-10
Identity = 65/251 (25.90%), Postives = 107/251 (42.63%), Query Frame = 1
Query:  565 DPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRI---YDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLC-CWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFW-YKR 1302
            D   Q+  S S + + ++ +  N ++K       EA  V ++KF  +G+ L   +  + + I   YD    +          HN  I+ V WS +SS   S S D + K+WD  S +C+ T  K H  + +    F+  S  +++   D  VK+WE+ TG+CL   +        +H     FN +   ++    D   LC  WD+      + L  + N  V     SP     L+ + DN  + W Y R
Sbjct:    8 DAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEA--VSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYG------HNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTL-KGHSNY-VFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVH-----FNCSGSLIVSGSYD--GLCRIWDAASGQCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSR 241          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Celegans
Match: cpf-1 (Cleavage and Polyadenylation Factor [Source:UniProtKB/TrEMBL;Acc:Q19864])

HSP 1 Score: 423.32 bits (1087), Expect = 4.613e-146
Identity = 211/429 (49.18%), Postives = 289/429 (67.37%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGP-SNRLLKLMQLGLSISDDEADRCNLKEDSIT---PGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR+ +YRLII QL +DG+Q  A+++  T+  S  + P S++L +L+ +     +D   +   K   +      +G+DL+ + +   ++ E + YET Y+T HKA CRAAAFN+ G LVATGS D SIKI+DVER+LA+         + N+      HPVIRTLYDH  +V+ V FHP  +  IL SGS D T+KLFDFS  +VKKA K++ E  PVR +  H  G+ LLV T H T+R+Y++ T Q + SA P+DQH  ++  V +S N+ ++ + S DG  KIWDGVS RC+ TF++AH+G  I S +F++N KY+LTSG DSIVKLWELST RCLI YTGAG TG Q   + A FNH EDYV+FPDE + S+C WD+R +DR+RLL+L H  A R FVHSP+  AF++ SDD+RARFWY++P ++
Sbjct:    6 KDREYMYRLIIGQLFYDGHQQIAVNLANTLGCSAPAPPPSDKLFRLVTIAKQFVEDPDYKAEEKSSPMQFEPVSSGLDLEYDADVQPVSSEPSEYETIYLTVHKAPCRAAAFNSDGSLVATGSADCSIKIMDVERILARE----KEHREMNENGPDAHHPVIRTLYDHVDDVNTVIFHPRDS--ILISGSNDKTVKLFDFSKTAVKKAMKTLSEVYPVRALSCHPGGEFLLVATDHPTVRLYNIETAQAYASANPDDQHTESVTDVHYSENARLYVTASKDGHVKIWDGVSNRCVETFKRAHDGSSICSAKFTKNGKYILTSGMDSIVKLWELSTNRCLIVYTGAGATGAQDFATNASFNHNEDYVLFPDEKSGSMCSWDARNSDRKRLLALGHTSACRTFVHSPSMPAFMTGSDDHRARFWYRKPATN 428          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Celegans
Match: cpf-1 (Cleavage and Polyadenylation Factor [Source:UniProtKB/TrEMBL;Acc:Q19864])

HSP 1 Score: 423.32 bits (1087), Expect = 4.613e-146
Identity = 211/429 (49.18%), Postives = 289/429 (67.37%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGP-SNRLLKLMQLGLSISDDEADRCNLKEDSIT---PGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR+ +YRLII QL +DG+Q  A+++  T+  S  + P S++L +L+ +     +D   +   K   +      +G+DL+ + +   ++ E + YET Y+T HKA CRAAAFN+ G LVATGS D SIKI+DVER+LA+         + N+      HPVIRTLYDH  +V+ V FHP  +  IL SGS D T+KLFDFS  +VKKA K++ E  PVR +  H  G+ LLV T H T+R+Y++ T Q + SA P+DQH  ++  V +S N+ ++ + S DG  KIWDGVS RC+ TF++AH+G  I S +F++N KY+LTSG DSIVKLWELST RCLI YTGAG TG Q   + A FNH EDYV+FPDE + S+C WD+R +DR+RLL+L H  A R FVHSP+  AF++ SDD+RARFWY++P ++
Sbjct:    6 KDREYMYRLIIGQLFYDGHQQIAVNLANTLGCSAPAPPPSDKLFRLVTIAKQFVEDPDYKAEEKSSPMQFEPVSSGLDLEYDADVQPVSSEPSEYETIYLTVHKAPCRAAAFNSDGSLVATGSADCSIKIMDVERILARE----KEHREMNENGPDAHHPVIRTLYDHVDDVNTVIFHPRDS--ILISGSNDKTVKLFDFSKTAVKKAMKTLSEVYPVRALSCHPGGEFLLVATDHPTVRLYNIETAQAYASANPDDQHTESVTDVHYSENARLYVTASKDGHVKIWDGVSNRCVETFKRAHDGSSICSAKFTKNGKYILTSGMDSIVKLWELSTNRCLIVYTGAGATGAQDFATNASFNHNEDYVLFPDEKSGSMCSWDARNSDRKRLLALGHTSACRTFVHSPSMPAFMTGSDDHRARFWYRKPATN 428          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 107.457 bits (267), Expect = 1.473e-25
Identity = 70/247 (28.34%), Postives = 124/247 (50.20%), Query Frame = 1
Query:  319 CYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            C +  H  +  +A F+  G+ + T S D ++KI +++ M+ +                       RTL  H+  V+ + +  D   + + S S D T+K+F+     + K  K     + V    F+     ++ G++ +++RI+DV T  C +  +P   H+  ++ V+++ + S+ AS S DG  +IWD  + +CI T     E  P++ V+FS N KY+L S  DS +KLW+ S G+ L +YTG
Sbjct:   81 CTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICE-----------------------RTLTGHKLGVNDIAWSSDS--RCVVSASDDKTLKIFEIVTSRMTKTLKG--HNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMC-IKTLPA--HSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVD-DENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTG 296          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 107.457 bits (267), Expect = 1.473e-25
Identity = 70/247 (28.34%), Postives = 124/247 (50.20%), Query Frame = 1
Query:  319 CYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            C +  H  +  +A F+  G+ + T S D ++KI +++ M+ +                       RTL  H+  V+ + +  D   + + S S D T+K+F+     + K  K     + V    F+     ++ G++ +++RI+DV T  C +  +P   H+  ++ V+++ + S+ AS S DG  +IWD  + +CI T     E  P++ V+FS N KY+L S  DS +KLW+ S G+ L +YTG
Sbjct:   81 CTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICE-----------------------RTLTGHKLGVNDIAWSSDS--RCVVSASDDKTLKIFEIVTSRMTKTLKG--HNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMC-IKTLPA--HSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVD-DENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTG 296          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Celegans
Match: wdr-5.2 (WD repeat-containing protein wdr-5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q93847])

HSP 1 Score: 89.3521 bits (220), Expect = 3.094e-19
Identity = 87/327 (26.61%), Postives = 145/327 (44.34%), Query Frame = 1
Query:  331 AHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHT---EDYVMFPDEDTKSLCCWDSRKADRQRLLSLN-HNGAVRCFVHSPTTAAFLSCS--DDNRARFW 1293
            AHK +     F+  G+ + +GS D SIKI  ++ +  K                        TL  H+  ++  +F    + +++ S S D  +K+FD S+    K  K     + V    F+ SG  +  G++ +T+RI+         S +P   H   ++ V ++ + +  AS S DG  +IWD  +  C+ T     E  PI+ V+FS N KY+L S  ++ +KLW+    R L EY     TG +  + C   N +     +++   ED K +  W+ +   R+ L +L+ HN AV C    P      S +   D R + W
Sbjct:  105 AHKKSISGIKFSPDGRYMGSGSADCSIKIWRMDFVYEK------------------------TLMGHRLGIN--EFSWSSDSKLIVSCSDDKLVKVFDVSSGRCVKTLKG--HTNYVFCCCFNPSGTLIASGSFDETIRIWCARNGNTIFS-IP--GHEDPVSSVCFNRDGAYLASGSYDGIVRIWDSTTGTCVKTLID-EEHPPITHVKFSPNGKYILASNLNNTLKLWDYQKLRVLKEY-----TGHENSKYCVAANFSVTGGKWIVSGSEDHK-VYIWNLQT--REILQTLDGHNTAVMCTDCHPGQNIIASAALEPDMRIKIW 391          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Fly
Match: CstF50 (gene:FBgn0039867 transcript:FBtr0085865)

HSP 1 Score: 446.047 bits (1146), Expect = 6.247e-155
Identity = 232/423 (54.85%), Postives = 288/423 (68.09%), Query Frame = 1
Query:   34 MYKDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKR 1302
            + K+R++LYRL+ISQL++DG +  A+ +   V  +    PS RLL +M  G+    D+ D+ N   D + PG  +DL+ E E+S +APE   YET YVT+HK ACRA AF+  G LVATGS D+SIKILDVERMLAKS  P D      QQ     HPVIRTLYDH  EVS ++FHP  +  ILAS S+D T+KLFD + PSVKKA K   +  PV  + FH +GD + +GT H  LR+YDV TTQCFVSA+P  QH   +  V +SP   ++A+ S DG  KIWDG+S RCINT  +AH G  I S++F+RN KYLL+SG DS+V LWEL T R +  YTGAGTTG+Q H++ AVFNHTEDYV+FPDE T SLC W+SR   R  L SL HNG VR   HSP   AFL+CSDD RARFWY+R
Sbjct:   11 LVKNREILYRLMISQLMYDGLEKFAMELSMLVK-ADQCAPSERLLHVMIAGMQTLSDK-DKTN--SDDVLPG--IDLEFEPEASALAPEPHSYETAYVTSHKQACRAGAFSCDGSLVATGSVDASIKILDVERMLAKSA-PEDIEPGREQQG----HPVIRTLYDHTDEVSYLEFHPKEH--ILASASRDGTVKLFDIAKPSVKKAHKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVYDVATTQCFVSAIPSQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAHGGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGAGTTGKQEHQTEAVFNHTEDYVLFPDEATTSLCSWNSRNGCRLTLNSLGHNGPVRYITHSPNGPAFLTCSDDFRARFWYRR 420          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 98.5969 bits (244), Expect = 2.181e-22
Identity = 86/327 (26.30%), Postives = 148/327 (45.26%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSC--AVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCS--DDNRARFW 1293
            +  H  A  A  F+  G+ +A+ S D  IKI           G  D   +             +T+  H+  +S V +  D  L  L SGS D T+K+++ S     K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  Y     TG +  + C  A F+ T    +    +   +  W+ +  +  + L   H   V C    PT     S +  +D   + W
Sbjct:   68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIW----------GAYDGKFE-------------KTISGHKLGISDVAWSSDSRL--LVSGSDDKTLKVWELSTGKSLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKC-LKTLPA--HSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTY-----TGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ-GHTDTVLCTACHPTENIIASAALENDKTIKLW 357          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 98.5969 bits (244), Expect = 2.181e-22
Identity = 86/327 (26.30%), Postives = 148/327 (45.26%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSC--AVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCS--DDNRARFW 1293
            +  H  A  A  F+  G+ +A+ S D  IKI           G  D   +             +T+  H+  +S V +  D  L  L SGS D T+K+++ S     K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  Y     TG +  + C  A F+ T    +    +   +  W+ +  +  + L   H   V C    PT     S +  +D   + W
Sbjct:   68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIW----------GAYDGKFE-------------KTISGHKLGISDVAWSSDSRL--LVSGSDDKTLKVWELSTGKSLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKC-LKTLPA--HSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTY-----TGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ-GHTDTVLCTACHPTENIIASAALENDKTIKLW 357          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Fly
Match: Prp19 (gene:FBgn0261119 transcript:FBtr0086723)

HSP 1 Score: 75.485 bits (184), Expect = 2.738e-14
Identity = 67/269 (24.91%), Postives = 112/269 (41.64%), Query Frame = 1
Query:  499 THPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEY-TGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCC--WDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWY 1296
            T  ++  L  H  +++ V +HP+ +  I  +GS D  I+++       +   +      PV  +  H +GD LL  +  K     D+ T +     +  D     +    + P+  +F + +VD   KIWD      +  F   H G PIS++ FS N  YL T+  D+ VKLW+L   R L  + T     G ++   C  F+ +  Y+     D +   C  W       Q L   N + A+   V     A +L+ +  +R    Y
Sbjct:  254 TEQMVAILKGHTKKITKVIYHPNEDTVI--TGSPDMNIRIWHVPTSQTQLLLRC--HEGPVTGLSLHPTGDYLLSTSSDKHWAFSDIRTGRLLTKVI--DTAEVGLTTAQFHPDGLIFGTGTVDSQVKIWDLKEQSNVANF-PGHTG-PISAISFSENGYYLATAADDACVKLWDL---RKLKNFKTIQLDDGYEVKDLC--FDQSGTYLAIAGSDVRVYLCKQW-------QELKVFNDHTALATGVRFGKHAQYLASTSMDRTLKLY 502          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0087241)

HSP 1 Score: 70.4774 bits (171), Expect = 7.312e-13
Identity = 64/268 (23.88%), Postives = 113/268 (42.16%), Query Frame = 1
Query:  298 EAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHN-------------------GAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCL 1044
            E   YE   +  H  + +  AF+A G+L+A+ S D SIK+ D ++                      ++  I+T++ H   VS V F P  +   + S S+D TIK+++ +     K +    E   VR ++ H  G      +  +T+R++  N+  C V  + + +H                    GA N           AS S D + +IWD     C+ T    H+ + +  + F    KYL+++  D  +++W+L   RC+
Sbjct:  138 ETGEYERS-LKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQ----------------------SYECIKTMHGHDHNVSSVAFVPAGDY--VLSASRDRTIKMWEVATGYCVKTYTGHREW--VRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVE-LRDHEHTVECIAWAPEAAASAINEAAGADNKKG-HHQGPFLASGSRDKTIRIWDVSVGLCLLTLS-GHDNW-VRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCM 374          

HSP 2 Score: 69.707 bits (169), Expect = 1.177e-12
Identity = 74/309 (23.95%), Postives = 131/309 (42.39%), Query Frame = 1
Query:  313 ETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASP----VRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRC-INTFEKAHEGFPISSVQF-----------SRNSK------YLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSR 1173
            E   +T H+A+     F+    L+ + SED++I+I D E                       T    R+L  H   V  V F  D   ++LAS S D +IKL+DF     +++++ I         V ++ F  +GD +L  +  +T+++++V T  C  +      H   + MV      S+FA+CS D + ++W   S  C +   +  H    I+               + N K      +L +  +D  +++W++S G CL+  +G     R L      F+    Y++   +D K++  WD R
Sbjct:  100 EKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFE-----------------------TGEYERSLKGHTDSVQDVAF--DAQGKLLASCSADLSIKLWDF-----QQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTG---HREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGL-----AFHPGGKYLVSASDD-KTIRVWDLR 369          

HSP 3 Score: 65.855 bits (159), Expect = 2.103e-11
Identity = 50/186 (26.88%), Postives = 79/186 (42.47%), Query Frame = 1
Query:  505 PVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWD-GVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            P   +L  H+A ++ V FHP     ++ S S+D TI+++DF                                G Y ++L+                  H  ++  V +     + ASCS D S K+WD   S  CI T    H+   +SSV F     Y+L++ +D  +K+WE++TG C+  YTG
Sbjct:   99 PEKFSLTGHRASITRVIFHP--IFALMVSASEDATIRIWDFET------------------------------GEYERSLK-----------------GHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMH-GHD-HNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTG 233          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Zebrafish
Match: cstf1 (cleavage stimulation factor, 3' pre-RNA, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2958])

HSP 1 Score: 520.39 bits (1339), Expect = 0.000e+0
Identity = 248/425 (58.35%), Postives = 313/425 (73.65%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQLL+DGY   A  +++ V P     PS +L++L ++G+   D        + D++ PG G+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  P++ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK + EA  +R+I FH SGD LLVGT H TLR+YDVNT QCFVS  P DQH   I  V ++P+++ + +CS DGS K+WDGVS RC+ TF+KAHEG  + S  FS+NSKY+L++GKDS+ KLWE+STGR L++YTGAG +GRQ HR+  VFNHTEDYV+ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQHLYKLIISQLLYDGYTIIANSLISEVKPQNVVSPSEQLMQLAKIGMENDDSAVQYAIGRSDTVAPGVGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPLEVMMNETAQQNMENHPVIRTLYDHVDEVTCLSFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKHVQEAEMLRSISFHPSGDFLLVGTQHPTLRLYDVNTFQCFVSCNPLDQHTDTICGVCYNPSANSYVTCSKDGSIKLWDGVSNRCVTTFDKAHEGAEVCSAVFSKNSKYILSTGKDSVAKLWEISTGRTLVKYTGAGLSGRQTHRTQGVFNHTEDYVLLPDERTISLCCWDSRTAERKNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRTTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Zebrafish
Match: cstf1 (cleavage stimulation factor, 3' pre-RNA, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2958])

HSP 1 Score: 520.39 bits (1339), Expect = 0.000e+0
Identity = 248/425 (58.35%), Postives = 313/425 (73.65%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQLL+DGY   A  +++ V P     PS +L++L ++G+   D        + D++ PG G+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  P++ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK + EA  +R+I FH SGD LLVGT H TLR+YDVNT QCFVS  P DQH   I  V ++P+++ + +CS DGS K+WDGVS RC+ TF+KAHEG  + S  FS+NSKY+L++GKDS+ KLWE+STGR L++YTGAG +GRQ HR+  VFNHTEDYV+ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQHLYKLIISQLLYDGYTIIANSLISEVKPQNVVSPSEQLMQLAKIGMENDDSAVQYAIGRSDTVAPGVGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPLEVMMNETAQQNMENHPVIRTLYDHVDEVTCLSFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKHVQEAEMLRSISFHPSGDFLLVGTQHPTLRLYDVNTFQCFVSCNPLDQHTDTICGVCYNPSANSYVTCSKDGSIKLWDGVSNRCVTTFDKAHEGAEVCSAVFSKNSKYILSTGKDSVAKLWEISTGRTLVKYTGAGLSGRQTHRTQGVFNHTEDYVLLPDERTISLCCWDSRTAERKNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRTTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Zebrafish
Match: cstf1 (cleavage stimulation factor, 3' pre-RNA, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2958])

HSP 1 Score: 287.345 bits (734), Expect = 6.088e-95
Identity = 144/255 (56.47%), Postives = 181/255 (70.98%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQH 804
            KDR  LY+LIISQLL+DGY   A  +++ V P     PS +L++L ++G+   D        + D++ PG G+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  P++ M  E  QQ ME HPVIRTLYDH  EV+C+ FH  P  QILASGS+DYT+KLFD+S PS K+AFK + EA  +R+I FH SGD LLVGT H TLR+YDVNT QCFVS  P DQH
Sbjct:    9 KDRQHLYKLIISQLLYDGYTIIANSLISEVKPQNVVSPSEQLMQLAKIGMENDDSAVQYAIGRSDTVAPGVGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPLEVMMNETAQQNMENHPVIRTLYDHVDEVTCLSFH--PTEQILASGSRDYTLKLFDYSKPSAKRAFKHVQEAEMLRSISFHPSGDFLLVGTQHPTLRLYDVNTFQCFVSCNPLDQH 261          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Zebrafish
Match: cstf1 (cleavage stimulation factor, 3' pre-RNA, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2958])

HSP 1 Score: 278.485 bits (711), Expect = 1.205e-91
Identity = 139/247 (56.28%), Postives = 176/247 (71.26%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFV 780
            KDR  LY+LIISQLL+DGY   A  +++ V P     PS +L++L ++G+   D        + D++ PG G+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  P++ M  E  QQ ME HPVIRTLYDH  EV+C+ FH  P  QILASGS+DYT+KLFD+S PS K+AFK + EA  +R+I FH SGD LLVGT H TLR+YDVNT QCFV
Sbjct:    9 KDRQHLYKLIISQLLYDGYTIIANSLISEVKPQNVVSPSEQLMQLAKIGMENDDSAVQYAIGRSDTVAPGVGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPLEVMMNETAQQNMENHPVIRTLYDHVDEVTCLSFH--PTEQILASGSRDYTLKLFDYSKPSAKRAFKHVQEAEMLRSISFHPSGDFLLVGTQHPTLRLYDVNTFQCFV 253          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Zebrafish
Match: cstf1 (cleavage stimulation factor, 3' pre-RNA, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2958])

HSP 1 Score: 163.696 bits (413), Expect = 3.058e-48
Identity = 83/162 (51.23%), Postives = 110/162 (67.90%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLY 525
            KDR  LY+LIISQLL+DGY   A  +++ V P     PS +L++L ++G+   D        + D++ PG G+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  P++ M  E  QQ ME HPVIRTLY
Sbjct:    9 KDRQHLYKLIISQLLYDGYTIIANSLISEVKPQNVVSPSEQLMQLAKIGMENDDSAVQYAIGRSDTVAPGVGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPLEVMMNETAQQNMENHPVIRTLY 170          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Xenopus
Match: cstf1 (cleavage stimulation factor, 3' pre-RNA, subunit 1 [Source:NCBI gene;Acc:407896])

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 249/425 (58.59%), Postives = 318/425 (74.82%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQ+L+DGY   A  +++ +   +   PS +LL L+++G+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGSKDYT+KLFD+S PS K+AFK I EA  +R+I FH SGD ++VGT H TLR+YD+NT QCFVS  P+DQH  AI  V ++P+++ + +CS DGS K+WDGVS RCI T+EKAH+G  + S  FS+NSKY+L+SGKDS+ +LWE+STGR L++YTGAG +GRQ+HR+ AVFNHTEDYV+ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQQLYKLIISQMLYDGYINIANGLISELKIHSVCAPSEQLLHLIKVGMENDDSAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSKDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFIIVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNPSANTYVTCSKDGSIKLWDGVSNRCITTYEKAHDGAEVCSAIFSKNSKYILSSGKDSVARLWEISTGRMLVKYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 97.4413 bits (241), Expect = 4.708e-22
Identity = 75/265 (28.30%), Postives = 129/265 (48.68%), Query Frame = 1
Query:  262 LDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYT 1056
            + + +  S + P   L  T  +  H  A  +  F+  G+ +A+ S D  IKI           G  D   +             +T+  H+  +S V +  D NL  L S S D T+K++D S+    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YT
Sbjct:   20 ISIHSPFSLVKPNYTLKFT--LAGHTKAVSSVKFSPNGEWLASSSADKLIKIW----------GAYDGKFE-------------KTISGHKLGISDVAWSSDSNL--LVSASDDKTLKIWDVSSGKCLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC-LKTLPA--HSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT 251          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 97.4413 bits (241), Expect = 6.058e-22
Identity = 78/276 (28.26%), Postives = 134/276 (48.55%), Query Frame = 1
Query:  229 EDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYT 1056
            E S T  T    + +++ + + P   L  T  +  H  A  +  F+  G+ +A+ S D  IKI           G  D   +             +T+  H+  +S V +  D NL  L S S D T+K++D S+    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YT
Sbjct:   11 EASKTQSTPSSSNNQSKPAPVKPNYTLKFT--LAGHTKAVSSVKFSPNGEWLASSSADKLIKIW----------GAYDGKFE-------------KTISGHKLGISDVAWSSDSNL--LVSASDDKTLKIWDVSSGKCLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC-LKTLP--AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT 253          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 97.4413 bits (241), Expect = 6.058e-22
Identity = 78/276 (28.26%), Postives = 134/276 (48.55%), Query Frame = 1
Query:  229 EDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYT 1056
            E S T  T    + +++ + + P   L  T  +  H  A  +  F+  G+ +A+ S D  IKI           G  D   +             +T+  H+  +S V +  D NL  L S S D T+K++D S+    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YT
Sbjct:   11 EASKTQSTPSSSNNQSKPAPVKPNYTLKFT--LAGHTKAVSSVKFSPNGEWLASSSADKLIKIW----------GAYDGKFE-------------KTISGHKLGISDVAWSSDSNL--LVSASDDKTLKIWDVSSGKCLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC-LKTLP--AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT 253          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 97.4413 bits (241), Expect = 6.058e-22
Identity = 78/276 (28.26%), Postives = 134/276 (48.55%), Query Frame = 1
Query:  229 EDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYT 1056
            E S T  T    + +++ + + P   L  T  +  H  A  +  F+  G+ +A+ S D  IKI           G  D   +             +T+  H+  +S V +  D NL  L S S D T+K++D S+    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YT
Sbjct:   11 EASKTQSTPSSSNNQSKPAPVKPNYTLKFT--LAGHTKAVSSVKFSPNGEWLASSSADKLIKIW----------GAYDGKFE-------------KTISGHKLGISDVAWSSDSNL--LVSASDDKTLKIWDVSSGKCLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC-LKTLP--AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT 253          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Mouse
Match: Cstf1 (cleavage stimulation factor, 3' pre-RNA, subunit 1 [Source:MGI Symbol;Acc:MGI:1914587])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 317/425 (74.59%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQLL+DGY + A  ++  + P +   PS +LL L++LG+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD +LVGT H TLR+YD+NT QCFVS  P+DQH  AI  V ++P+++M+ + S DG  K+WDGVS RCI TFEKAH+G  + S  FS+NSKY+L+SGKDS+ KLWE+STGR L+ YTGAG +GRQ+HR+ AVFNHTEDY++ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNPSANMYVTGSKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYILLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Mouse
Match: Cstf1 (cleavage stimulation factor, 3' pre-RNA, subunit 1 [Source:MGI Symbol;Acc:MGI:1914587])

HSP 1 Score: 152.525 bits (384), Expect = 4.649e-44
Identity = 72/141 (51.06%), Postives = 98/141 (69.50%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPID 462
            KDR  LY+LIISQLL+DGY + A  ++  + P +   PS +LL L++LG+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+
Sbjct:    9 KDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIE 149          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Mouse
Match: Wdr5b (WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:1916794])

HSP 1 Score: 103.99 bits (258), Expect = 2.699e-24
Identity = 80/262 (30.53%), Postives = 127/262 (48.47%), Query Frame = 1
Query:  277 ESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFP-ISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            E     P  AL  T  +  H AA  +  F+  G+ +A+ + D+ I I           G  D   +             +TLY H  E+S V +  D +   L S S D T+K++D  +    K  K    +  V    F+   + ++ G++ ++++I++V T +C  +      H+  I+ V ++ N S+  S S DG  +IWD  S +C+ T   A EG P +S V+FS N KY+LT+  D+ +KLW+ S GRCL  YTG
Sbjct:   21 EEEPQKPNYALRLT--LAGHSAAISSVKFSPNGEWLASSAADALIIIW----------GAYDGNCK-------------KTLYGHSLEISDVAWSSDSSR--LVSASDDKTLKVWDMRSGKCLKTLKG--HSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTL---SAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRTL--ADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTG 248          

HSP 2 Score: 82.0333 bits (201), Expect = 8.563e-17
Identity = 47/184 (25.54%), Postives = 92/184 (50.00%), Query Frame = 1
Query:  511 IRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFE-KAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            ++TL  H   V C DF+P  NL  + SGS D ++K+++       K   +   + P+  + F+ +G  ++ G+Y    RI+D  + QC  +    D+ N  ++ V +SPN     + ++D + K+WD    RC+ T+    +E + + +       K++++  +D++V +W L T   +    G
Sbjct:  116 LKTLKGHSDFVFCCDFNPPSNL--IVSGSFDESVKIWEVKTGKCLKTLSA--HSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRTLA--DEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCLFASFSVTGRKWVVSGSEDNMVYIWNLQTKEIVQRLQG 293          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 101.293 bits (251), Expect = 2.401e-23
Identity = 76/263 (28.90%), Postives = 131/263 (49.81%), Query Frame = 1
Query:  271 ETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            +++ + + P  AL  T  +  H  A  +  F+  G+ +A+ S D  IKI           G  D   +             +T+  H+  +S V +  D NL  L S S D T+K++D S+    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YTG
Sbjct:   25 QSKPTPVKPNYALKFT--LAGHTKAVSSVKFSPNGEWLASSSADKLIKIW----------GAYDGKFE-------------KTISGHKLGISDVAWSSDSNL--LVSASDDKTLKIWDVSSGKCLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC-LKTLP--AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG 254          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 94.3597 bits (233), Expect = 3.141e-21
Identity = 63/197 (31.98%), Postives = 106/197 (53.81%), Query Frame = 1
Query:  514 RTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINT---FEKAHEGF------------PISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            +T+  H+  +S V +  D NL  L S S D T+K++D S+    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T   F  +HE              P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YTG
Sbjct:   12 KTISGHKLGISDVAWSSDSNL--LVSASDDKTLKIWDVSSGKCLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC-LKTLP--AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIVFVTSHEKRSPLRTPCDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG 201          

HSP 2 Score: 87.0409 bits (214), Expect = 8.979e-19
Identity = 62/261 (23.75%), Postives = 118/261 (45.21%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEAS-PVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQC------FVSA--------VPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFE-KAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            ++ HK      A+++   L+ + S+D ++KI DV                        +   ++TL  H   V C +F+P  NL  + SGS D +++++D       K  K++P  S PV  + F+  G  ++  +Y    RI+D  + QC      FV++         P D  N  ++ V +SPN     + ++D + K+WD    +C+ T+    +E + I +       K++++  +D++V +W L T   + +  G
Sbjct:   14 ISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVS-----------------------SGKCLKTLKGHSNYVFCCNFNPQSNL--IVSGSFDESVRIWDV---KTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIVFVTSHEKRSPLRTPCDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQG 246          
BLAST of Cleavage stimulation factor subunit 1 vs. UniProt/SwissProt
Match: sp|Q5BJQ6|CSTF1_RAT (Cleavage stimulation factor subunit 1 OS=Rattus norvegicus OX=10116 GN=Cstf1 PE=2 SV=1)

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 317/425 (74.59%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQLL+DGY + A  ++  + P +   PS +LL L++LG+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD +LVGT H TLR+YD+NT QCFVS  P+DQH  AI  V ++P+++M+ + S DG  K+WDGVS RCI TFEKAH+G  + S  FS+NSKY+L+SGKDS+ KLWE+STGR L+ YTGAG +GRQ+HR+ AVFNHTEDY++ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNPSANMYVTGSKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYILLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. UniProt/SwissProt
Match: sp|Q99LC2|CSTF1_MOUSE (Cleavage stimulation factor subunit 1 OS=Mus musculus OX=10090 GN=Cstf1 PE=1 SV=1)

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 317/425 (74.59%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQLL+DGY + A  ++  + P +   PS +LL L++LG+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD +LVGT H TLR+YD+NT QCFVS  P+DQH  AI  V ++P+++M+ + S DG  K+WDGVS RCI TFEKAH+G  + S  FS+NSKY+L+SGKDS+ KLWE+STGR L+ YTGAG +GRQ+HR+ AVFNHTEDY++ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNPSANMYVTGSKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYILLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. UniProt/SwissProt
Match: sp|Q05048|CSTF1_HUMAN (Cleavage stimulation factor subunit 1 OS=Homo sapiens OX=9606 GN=CSTF1 PE=1 SV=1)

HSP 1 Score: 524.628 bits (1350), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 316/425 (74.35%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQLL+DGY + A  ++  + P +   PS +LL L++LG+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD +LVGT H TLR+YD+NT QCFVS  P+DQH  AI  V ++ +++M+ + S DG  K+WDGVS RCI TFEKAH+G  + S  FS+NSKY+L+SGKDS+ KLWE+STGR L+ YTGAG +GRQ+HR+ AVFNHTEDYV+ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTGSKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. UniProt/SwissProt
Match: sp|Q5R8K2|CSTF1_PONAB (Cleavage stimulation factor subunit 1 OS=Pongo abelii OX=9601 GN=CSTF1 PE=2 SV=1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 316/425 (74.35%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQLL+DGY + A  ++  + P +   PS +LL L++LG+   D        + D++ PGTG+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD +LVGT H TLR+YD+NT QCFVS  P+DQH  AI  V ++ +++M+ + S DG  K+WDGVS RCI TFEKAH+G  + S  FS+NSKY+L+SGKDS+ KLWE+STGR L+ YTGAG +GRQ+HR+ AVFNHTEDYV+ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHADAICSVNYNSSANMYVTGSKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRIAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. UniProt/SwissProt
Match: sp|Q8L4J2|CTF50_ARATH (Cleavage stimulation factor subunit 50 OS=Arabidopsis thaliana OX=3702 GN=CSTF50 PE=1 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 3.074e-80
Identity = 156/426 (36.62%), Postives = 227/426 (53.29%), Query Frame = 1
Query:   55 LYRLIISQLLFDGY-QTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDS--------ITPGTG-MDLDVE--TESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFV-SAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFW 1293
            L  LI++ L      Q A+     T+ P     P NRLL+L+  GL+  ++   R                TP T  +D  V     SS   P+   +E+  ++ HK+  R A F+  G   ATG  D+SIK+ +V ++     G              +  P+IRT YDH   ++ +DFHP     IL S +KD  IK FDFS  + K+AFK   +   VR+I FH SG+ LL GT H    +YDVNT QCF+ S  P+   +GAIN V +S   S++ + S DG+ +++DGVS +C+ +   AH    ++S  F+++ +++L+SGKDS VKLWE+ +GR + EY GA    R   RS A+FN TE++V+  DE +  +  WD+R AD+      NHNGA R   HSP  + F++C  D   RFW
Sbjct:   20 LNALIVAHLRHHNLSQVASAVASATMTPLNIEVPPNRLLELVAKGLAAENNGTLRGVSSSVLLPSSYGSITTPRTASIDFSVNHAKGSSKTIPK---HESKTLSEHKSVVRCARFSPDGMFFATGGADTSIKLFEVPKVKQMISG------------DTQARPLIRTFYDHAEPINDLDFHPRST--ILISSAKDNCIKFFDFSKTTAKRAFKVFQDTHNVRSISFHPSGEFLLAGTDHPIPHLYDVNTYQCFLPSNFPDSGVSGAINQVRYSSTGSIYITASKDGAIRLFDGVSAKCVRSIGNAHGKSEVTSAVFTKDQRFVLSSGKDSTVKLWEIGSGRMVKEYLGA---KRVKLRSQAIFNDTEEFVISIDEASNEVVTWDARTADKVAKWPSNHNGAPRWIEHSPVESVFVTCGIDRSIRFW 425          
BLAST of Cleavage stimulation factor subunit 1 vs. TrEMBL
Match: G4VBS1 (WD_REPEATS_REGION domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_045250 PE=4 SV=1)

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 328/427 (76.81%), Postives = 375/427 (87.82%), Query Frame = 1
Query:   37 YKDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKE-DSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            +K+RDLLYRLIISQL +DG+QT A++++  V+PS + GPSNRL +L++LGLS S+DE ++  + E +SI PGTG+DL+VE+ESSTMAPEAALYETCYVTAHKAACRAA+FN+TGQLVATGS DSSIKILDVERMLAKS  P D++GQE  QQQMETHPVIRTLYDH AEV+CVDFHPDP LQIL SGSKDYTIKLFDFSNPSVKKA ++IPEASP+RT+ FH SG+ LLVGT HKTLR+YDV T +C+VSAVPEDQH  A+NMV WSPN + F +  +DGSFKIWDGVSCRC+NTFE AH+G P+ SV FSRN KY+L+SGKDS VKLWEL+TGRCLI YTGAGT G Q HRS AVFNHTEDYV+FPDE TKSLCCWDSR ADRQRLLSLNHNG +RCFVHSPTTAAF+SCSDDNRARFWYKRPISD
Sbjct:    3 FKERDLLYRLIISQLFYDGFQTMAVNLVNLVSPSAACGPSNRLFRLVKLGLSASEDEHEKSGVIEGESIAPGTGIDLEVESESSTMAPEAALYETCYVTAHKAACRAASFNSTGQLVATGSHDSSIKILDVERMLAKSVSPTDHLGQETPQQQMETHPVIRTLYDHTAEVTCVDFHPDPTLQILVSGSKDYTIKLFDFSNPSVKKAQRNIPEASPIRTLHFHPSGNFLLVGTQHKTLRLYDVQTCRCYVSAVPEDQHLSAVNMVRWSPNGTAFVTAGMDGSFKIWDGVSCRCVNTFEAAHDGAPVCSVVFSRNGKYILSSGKDSAVKLWELATGRCLITYTGAGTVGHQTHRSMAVFNHTEDYVLFPDEATKSLCCWDSRNADRQRLLSLNHNGPIRCFVHSPTTAAFMSCSDDNRARFWYKRPISD 429          
BLAST of Cleavage stimulation factor subunit 1 vs. TrEMBL
Match: C1L516 (Cleavage stimulation factor 50 kDa subunit OS=Schistosoma japonicum OX=6182 GN=CstF-50 PE=2 SV=1)

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 327/427 (76.58%), Postives = 377/427 (88.29%), Query Frame = 1
Query:   37 YKDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKE-DSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            +K+RDLLYRLIISQL +DG+QT A++++  V+PST+ GPSNRL +L++LGLS+S+DE ++  + E +SI PGTG+DL+VE+ESSTMAPE+ALYETCYVTAHKAACRAA+FN+TGQLVATGS DSSIKILDVERMLAKS  P D++GQE  QQQMETHPVIRTLYDH AEV+CVDFHPDP LQIL SGSKDYTIKLFDFSNPSVKKA ++IPEASP+RT+ FH SG+ LLVGT HKTLR+YDV T +C+VSAVPEDQH  A+NMV WSPN + F +  +DGSFKIWDGVSCRC+NTFE AH+G P+ SV FSRN KY+L+SGKDS VKLWEL+TGRCLI YTGAGT G Q HRS AVFNHTEDYV+FPDE TKSLCCWDSR ADRQRLL+LNHNG +RCFVHSPTTAAF+SCSDDNRARFWYKRPISD
Sbjct:    3 FKERDLLYRLIISQLFYDGFQTMAVNLVNLVSPSTACGPSNRLFRLVKLGLSVSEDEHEKSGVIEGESIAPGTGIDLEVESESSTMAPESALYETCYVTAHKAACRAASFNSTGQLVATGSHDSSIKILDVERMLAKSVSPTDHLGQETPQQQMETHPVIRTLYDHTAEVTCVDFHPDPTLQILVSGSKDYTIKLFDFSNPSVKKAQRNIPEASPIRTLHFHPSGNFLLVGTQHKTLRLYDVQTCRCYVSAVPEDQHLSAVNMVRWSPNGTAFVTAGMDGSFKIWDGVSCRCVNTFEAAHDGAPVCSVVFSRNGKYILSSGKDSAVKLWELATGRCLIIYTGAGTVGHQTHRSMAVFNHTEDYVLFPDEATKSLCCWDSRNADRQRLLALNHNGPIRCFVHSPTTAAFMSCSDDNRARFWYKRPISD 429          
BLAST of Cleavage stimulation factor subunit 1 vs. TrEMBL
Match: A0A5K3ELD3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 329/426 (77.23%), Postives = 366/426 (85.92%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADR-CNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            ++RDLLYRLIISQL  DGYQT AI++M  VNPS S GPS RLLKL++LGLSI+DDE DR   L+ D+I PGTG+DL++E+ESSTMAPEAALYETCYVTAHKAACR AAFN TGQLVATGS DSSIKILDVERMLAKS    D+  QE  QQQME HPVIRTLYDH AEV+CVDFHPD + QIL SGSKDYTIK FDFSNPSVKKA +SIPEASP++T+ FH SG+ LLVGT HKTLRIY+VNT QC+VSAVPEDQHNGA+ M  W+PN++ F + SVDGSFKIWD VS RC++TFE AH+G P+ S  FSRNSKY+LTSGKDS+VKLWELST RCLI YTGAGT G Q HRS AVFNHTEDYV+FPDE TKSLCCWDSR ADRQRLL L+HNG +RCFVHSPTTAAFLSCSDDNRARFWYKRPISD
Sbjct:    4 RERDLLYRLIISQLFHDGYQTMAINLMNLVNPSMSCGPSARLLKLVKLGLSIADDEQDRPVTLEGDNIAPGTGIDLEIESESSTMAPEAALYETCYVTAHKAACRTAAFNTTGQLVATGSHDSSIKILDVERMLAKSVSGADHTNQETPQQQMEAHPVIRTLYDHTAEVTCVDFHPDASQQILVSGSKDYTIKFFDFSNPSVKKAQRSIPEASPIKTLNFHPSGNYLLVGTQHKTLRIYNVNTCQCYVSAVPEDQHNGAVTMARWAPNANYFVTSSVDGSFKIWDAVSGRCVSTFESAHDGAPVCSAVFSRNSKYVLTSGKDSVVKLWELSTSRCLISYTGAGTVGLQTHRSNAVFNHTEDYVLFPDEATKSLCCWDSRNADRQRLLPLSHNGPIRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 429          
BLAST of Cleavage stimulation factor subunit 1 vs. TrEMBL
Match: A0A0X3NRG8 (Cleavage stimulation factor subunit 1 OS=Schistocephalus solidus OX=70667 GN=CSTF1 PE=4 SV=1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 333/427 (77.99%), Postives = 374/427 (87.59%), Query Frame = 1
Query:   37 YKDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADR-CNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            +K+RDLLYRLIISQL +DGYQT A+++M  V+PS + GPSNRLLKL++ GLS+SDDE DR   L+ DSI PGTG+DL++E+ESSTMAPEAALYETCYVTAHKAACRAAAFN+TGQLVATGS DSSIKILDVERMLAKS    D+  QE  QQQMETHPVIRTLYDH AEV+CVDFHPDP+LQIL SGSKDYTIK FDFSNPSVKKA +SIPEASP++T+ FH SG+ LLVGT HKTLR+Y+VNT QC+VSAVPEDQHNGA+ M  W+PN++ F + SVDGSFK+WDGVS RC++TFE AH+G P+ S  FSRNSKY+LTSGKDSIVKLWELST RCLI YTGAGT G Q HRS A FNHTEDYV+FPDE TKSLCCWDSR ADRQRLLSLNHNG +RCFVHSPTTAAFLSCSDDNRARFWYKRPISD
Sbjct:    3 FKERDLLYRLIISQLFYDGYQTLAMNLMNLVSPSNACGPSNRLLKLVKTGLSVSDDEQDRPAFLEGDSIAPGTGIDLEIESESSTMAPEAALYETCYVTAHKAACRAAAFNSTGQLVATGSHDSSIKILDVERMLAKSVTGADHANQETPQQQMETHPVIRTLYDHTAEVTCVDFHPDPSLQILVSGSKDYTIKFFDFSNPSVKKAQRSIPEASPIKTLHFHPSGNYLLVGTQHKTLRLYNVNTCQCYVSAVPEDQHNGAVTMARWAPNANYFVTSSVDGSFKLWDGVSGRCVSTFESAHDGAPVCSAVFSRNSKYVLTSGKDSIVKLWELSTSRCLISYTGAGTVGLQTHRSMAAFNHTEDYVLFPDEATKSLCCWDSRNADRQRLLSLNHNGPIRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 429          
BLAST of Cleavage stimulation factor subunit 1 vs. TrEMBL
Match: A0A158RAD7 (WD_REPEATS_REGION domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9069 PE=4 SV=1)

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 325/426 (76.29%), Postives = 365/426 (85.68%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADR-CNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            ++RD+LYRLIISQL  DGYQ  AI++M  V PS S GPS RLLKL++LGLSI+DDE DR   L+ D+I PGTG+DL++E+ESSTMAPEAALYETCYVTAHKAACRAAAFN+TGQL+ATGS DSSIKILDVERMLAK     ++  QE  QQQME HPVIRTLYDH AEV+CVDFHPD + QIL SGSKDYTIK FDFSNPSVKKA +SIPEASP++T+ FH SG+ LLVGT+HKTLRIY VNT QCFVSAVPEDQHNGA+ M  W+PN++ F + SVDGSFKIWDGVS RC++TFE AH+G P+ S  FSRNSKY+LTSGKDS+VKLWELST RCLI YTGAGT G   HRS AVFNHTEDYV+FPDE TKSLCCWDSR ADRQRLL L+HNG +RCFVHSPTTAAFLSCSDDNRARFWYKRPISD
Sbjct:    4 RERDVLYRLIISQLFHDGYQAIAINLMNEVTPSVSCGPSARLLKLVKLGLSIADDEQDRSVALEGDNIAPGTGIDLEIESESSTMAPEAALYETCYVTAHKAACRAAAFNSTGQLIATGSHDSSIKILDVERMLAKGNSGPEHSAQETPQQQMEAHPVIRTLYDHTAEVTCVDFHPDASQQILVSGSKDYTIKFFDFSNPSVKKAQRSIPEASPIKTLHFHPSGNYLLVGTHHKTLRIYSVNTCQCFVSAVPEDQHNGAVTMARWAPNANYFVTSSVDGSFKIWDGVSGRCVSTFEAAHDGLPVCSAVFSRNSKYVLTSGKDSVVKLWELSTSRCLISYTGAGTLGLHTHRSNAVFNHTEDYVLFPDEVTKSLCCWDSRNADRQRLLPLSHNGPIRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 429          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Cavefish
Match: cstf1 (cleavage stimulation factor subunit 1 [Source:NCBI gene;Acc:103032378])

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 249/425 (58.59%), Postives = 312/425 (73.41%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQLL+DGY   A  ++  V P     PS +L++L ++G+   D        + D++ PG G+DL+ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  P++ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD LLVGT H TLR+YDVNT QCFVS  P DQH   I+ V ++P ++ + +CS DGS K+WDGVS RC+ TFEKAH+G  + S  FS+NSKY+L+SGKDS+ KLWE+STGR L++YTGAG +GRQ HR+  VFNHTEDY++ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQHLYKLIISQLLYDGYTNIANSLINEVKPQNVVSPSEQLMQLAKIGMENDDSAVQYAIGRSDTVAPGVGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPLEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKHIQEAEMLRSISFHPSGDFLLVGTQHPTLRLYDVNTFQCFVSWNPLDQHTDTISGVNYNPTANSYVTCSKDGSIKLWDGVSNRCVTTFEKAHDGAEVCSAVFSKNSKYILSSGKDSVAKLWEISTGRTLVKYTGAGLSGRQTHRTQGVFNHTEDYILLPDERTVSLCCWDSRTAERKNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRTTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 102.449 bits (254), Expect = 6.493e-24
Identity = 80/278 (28.78%), Postives = 134/278 (48.20%), Query Frame = 1
Query:  226 KEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            K DS T  T       T+ + + P   L  T  +  H  A  +  F+  G+ +A+ S D  IKI           G  D   +             ++L  H+  +S V + PD NL  L S S D T+K++D  +    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  ++WD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YTG
Sbjct:    7 KPDSATNKTHSSSAPATKPAPVKPNYTLKFT--LAGHTKAISSVKFSPNGEWLASSSADKLIKIW----------GSFDGKFE-------------KSLSGHKLGISDVAWSPDSNL--LVSASDDKTLKIWDMGSGKCLKTLKG--HSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKC-LKTLP--AHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG 251          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Cavefish
Match: ENSAMXT00000007962.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 102.834 bits (255), Expect = 6.845e-24
Identity = 80/278 (28.78%), Postives = 134/278 (48.20%), Query Frame = 1
Query:  226 KEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            K DS T  T       T+ + + P   L  T  +  H  A  +  F+  G+ +A+ S D  IKI           G  D   +             ++L  H+  +S V + PD NL  L S S D T+K++D  +    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  ++WD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YTG
Sbjct:    7 KPDSATNKTHSSSAPATKPAPVKPNYTLKFT--LAGHTKAISSVKFSPNGEWLASSSADKLIKIW----------GSFDGKFE-------------KSLSGHKLGISDVAWSPDSNL--LVSASDDKTLKIWDMGSGKCLKTLKG--HSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKC-LKTLPA--HSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG 251          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Cavefish
Match: ENSAMXT00000052579.1 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 102.834 bits (255), Expect = 6.845e-24
Identity = 80/278 (28.78%), Postives = 134/278 (48.20%), Query Frame = 1
Query:  226 KEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            K DS T  T       T+ + + P   L  T  +  H  A  +  F+  G+ +A+ S D  IKI           G  D   +             ++L  H+  +S V + PD NL  L S S D T+K++D  +    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  ++WD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YTG
Sbjct:    7 KPDSATNKTHSSSAPATKPAPVKPNYTLKFT--LAGHTKAISSVKFSPNGEWLASSSADKLIKIW----------GSFDGKFE-------------KSLSGHKLGISDVAWSPDSNL--LVSASDDKTLKIWDMGSGKCLKTLKG--HSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKC-LKTLPA--HSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG 251          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 100.138 bits (248), Expect = 4.136e-23
Identity = 72/245 (29.39%), Postives = 123/245 (50.20%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            +  H  A  +  F+ +G+ +A+ S D  IKI           G  D   +             +T+  H+  +S V +  D NL  L S S D T+K++D S+    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YTG
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIW----------GAYDGKFE-------------KTISGHKLGISDVAWSSDSNL--LVSASDDKTLKIWDVSSGKCLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC-LKTLP--AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG 254          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Sea Lamprey
Match: cstf1 (cleavage stimulation factor, 3' pre-RNA, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2958])

HSP 1 Score: 513.457 bits (1321), Expect = 0.000e+0
Identity = 246/427 (57.61%), Postives = 314/427 (73.54%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXX--XXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            +DR+ LYRLIISQLL+DG+   A  ++  VN   +  PS RLL L ++G    D    R   + D + PGTG+DL+ + +  T +PEA  YETCYVT+HK  CR+A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+         QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DY++KLFDFS PSVK+A+KS+ EA  +R + FH +GD LLVGT H TLR+YDV T +C+VS  P DQH  A+  V ++P ++ + SCS DG+ K+WDGVS RC+ T+++AH G P+ SV FSRN+KY+L+SGKDS+V+LWELS GR L+ YTGAG +G+Q HR+ AVFNHTEDYV+FPDE T SLCCWDSR  +R+ LLSL HN AVRC VHSPT+A F++CSDD RARFWY+R  ++
Sbjct:   11 RDREELYRLIISQLLYDGHAAIAATLIGAVNLGPAVPPSERLLHLARIGKEQEDTNPSRPVGRSDMVAPGTGVDLEFDADVQTSSPEACEYETCYVTSHKGPCRSATYSRDGQLIATGSADASIKILDTERMLAKSATPIETQVMMNETAQQNMENHPVIRTLYDHTDEVTCLAFHPTE--QILASGSRDYSLKLFDFSKPSVKRAYKSLQEAEVLRCLAFHPAGDFLLVGTRHPTLRMYDVTTCECYVSPNPADQHTDAVTGVAYNPTANSYVSCSRDGTIKLWDGVSSRCVATYDRAHGGAPVCSVVFSRNAKYVLSSGKDSMVRLWELSAGRALLTYTGAGLSGKQTHRTQAVFNHTEDYVLFPDEWTVSLCCWDSRTTERKNLLSLGHNNAVRCLVHSPTSAGFMTCSDDYRARFWYRRAATE 435          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 85.5001 bits (210), Expect = 2.763e-18
Identity = 61/237 (25.74%), Postives = 100/237 (42.19%), Query Frame = 1
Query:  313 ETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWE 1023
            E+    AH A  R+ +F+A GQ + T S+D SIK+  V R                          + +L  H   V    F PD  L  + SGS D T++++D ++      F        V  + FH SG C+       T++++D+   +          H  A+N +++ P  +   + S D + K+ D V  R   T    H+G P ++V FSR   +  + G D  V +W+
Sbjct:   94 ESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQ-----------------------KFLYSLNQHSNWVRSAKFSPDGRL--IVSGSDDRTVRVWDSNSRECVHTFYE--HGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHY---QVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLH-GHQG-PATAVAFSRAGDFFASGGSDEQVMVWK 298          

HSP 2 Score: 70.4774 bits (171), Expect = 1.950e-13
Identity = 59/253 (23.32%), Postives = 110/253 (43.48%), Query Frame = 1
Query:  514 RTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSN---------------------------------------PSVK---KAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDT 1146
            R    H+  ++ VDF  +PN++ LASGS D  + +++F                                         PSVK     FK+    + VR++ F + G  L+  +  K+++++ V+  +   S    +QH+  +    +SP+  +  S S D + ++WD  S  C++TF + H GF ++ V F  +   +  +G D+ VK+W++   + L  Y   G     L      F+ T +Y++    D+
Sbjct:   12 RHFKGHRDTITSVDF--NPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKA--HTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSL---NQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYE-HGGF-VNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSL-----SFHPTGNYLITASNDS 250          

HSP 3 Score: 46.9802 bits (110), Expect = 5.489e-6
Identity = 45/166 (27.11%), Postives = 67/166 (40.36%), Query Frame = 1
Query:  802 HNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLL-SLN-HNGAVRCFVHSPTTAAFLSCSDDNRARFW 1293
            H   I  V ++PN    AS S+D    +W+         F    +   + SVQFS +   ++++ +D  V+LW  S       +     T R +  S       +   +    D KS+  W      RQ+ L SLN H+  VR    SP     +S SDD   R W
Sbjct:   17 HRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDA--VMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSA------DGQSLVTASDDKSIKVW---TVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVW 171          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 83.1889 bits (204), Expect = 8.460e-18
Identity = 80/348 (22.99%), Postives = 138/348 (39.66%), Query Frame = 1
Query:  313 ETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTF-EKAH-----------------EGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKR 1302
            E   ++ H++      F+    ++ + SED++IK+ D E                       T    RTL  H   V  + F  D + ++LAS S D T+KL+DF +    +          V ++ F  +GD L+  +  KT+++++V T  C  +      H   + MV  + + S+ ASCS D + ++W   +  C     E  H                 E     + +  +   YLL+  +D  +K+W++STG C+I   G     R       V  H     +    D K+L  WD +    Q+ L+ + +       H  T    ++ S D   + W  R
Sbjct:   39 EKYALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYE-----------------------TGDFERTLKGHTDSVQDISF--DLSGKMLASCSADMTVKLWDFQSFECLRTMHG--HDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFT---GHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVR------GVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHK-TAPYVITGSVDQSVKVWECR 349          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004902.1 (pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 gene:ENSPMAG00000004437.1 transcript:ENSPMAT00000004902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 1.863e-15
Identity = 78/268 (29.10%), Postives = 114/268 (42.54%), Query Frame = 1
Query:  508 VIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSS--GDC--------LLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSC--AVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDD 1275
            + +TL  H+  VS +  HP    +I+ + S D   K++            SIP    + T + H+   GDC        L  G    T++++D +   C ++    + H  A+   +W       AS S+D S K+WD  S RC  T  + H    ++SV+F   S  LLTS  D  + LW+  TGRC   + G       LH SC    FN   D V+  D     +  WD RK      L+L  + A R   H P+       SDD
Sbjct:  327 ISQTLKAHEMPVSSMALHP--RKEIIVTASDDQLWKMW------------SIPNGDIIMTGQGHTDWIGDCDFNPTGTNLATGGGDSTVKVWDFSQGACVLTL---EGHGHAVWGCSWHSCGDFIASSSMDNSSKVWDVNSERCRQTL-RGHTD-SVNSVEFLPYSSTLLTSSADKTLSLWDARTGRCAQIFYG------HLH-SCNHGTFNLKGDTVVSCDS-YGVIKVWDVRKGTATMTLNLGPHPANRLSFH-PSGHVMAVASDD 566          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Sea Lamprey
Match: wdsub1 (WD repeat, sterile alpha motif and U-box domain containing 1 [Source:NCBI gene;Acc:777721])

HSP 1 Score: 71.633 bits (174), Expect = 9.929e-14
Identity = 74/288 (25.69%), Postives = 119/288 (41.32%), Query Frame = 1
Query:  529 HQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHS---SGD-------------CLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHE-----------GFPISSVQ-FSRNSKYLLTSGKDSIVKLWELS---TGRCL-IEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLS-LNHNGAVRCFVHSPTTAAFLSCSDDNRARFW 1293
            H   V C  F+PD +L  LA+ S + T  L+D                S VR   F      GD             CLL G+   TL ++DV   +C   A  +D   G+++   +SP    F + S  G   +WD V+ RC++T   AH+             P++ V+ F      + + G+D+ + LW L+   TG CL + +   G T   L   C  F+ ++ +V+      KS+  W+      ++LLS + H   V     +P     ++ S D   + W
Sbjct:   53 HTYAVHCCCFNPDGSL--LATCSTEGTTALWDARTGQRITVLLQPGGGSGVRVCAFSPRPLGGDAGQAPATAAPPVECLLSGSTDGTLALWDVRAHRCLKVASLKD---GSVSGCAFSPCGRAFVTGSTIGELSVWDAVNMRCLHTTRSAHDLGVTAVSFSPPPRPVAGVERFETQRSIMASCGQDNKIALWTLALDRTGDCLTLRFCLEGHTAPVL---CCCFS-SDGHVLASGSVDKSVILWNPITG--EKLLSIMEHQRYVTSCAFTPGAPYLITGSMDKTVKLW 329          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Yeast
Match: PWP2 (Conserved 90S pre-ribosomal component; essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis [Source:SGD;Acc:S000000653])

HSP 1 Score: 87.0409 bits (214), Expect = 1.059e-18
Identity = 66/259 (25.48%), Postives = 113/259 (43.63%), Query Frame = 1
Query:  520 LYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYH-KTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFW 1293
             Y +QA+V CV FHP   L  LA G      +L+D  + ++ +        +PV T+  + +G+ L  G+     L +Y+  +    +    +  H  + N + +SP+ S   + S DG  K+WD  S  C+ TFE+      +++VQF++  + + +S  D  V+ W+L   R    +TG      ++  +C   + + + V     D   +  W  +       LS  H G V C   S   +   S S D   R W
Sbjct:  256 FYANQAKVKCVTFHPATRL--LAVGFTSGEFRLYDLPDFTLIQQLSM--GQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILK---QQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSS--VTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGT----ERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALS-GHEGPVSCLSFSQENSVLASASWDKTIRIW 500          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 79.337 bits (194), Expect = 2.600e-16
Identity = 63/271 (23.25%), Postives = 123/271 (45.39%), Query Frame = 1
Query:  568 PNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMF-ASCSVDGSFKIWDGVSCRCINTFEKAHEGF-----PISSVQFSRNSKYLLTSGKDSIVKLWEL------------STGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHS-----PTTAAFLSCSDDNRARFWYKRPIS 1311
            P+ + LA+G++D  I+++D  N  +    +       + ++ +  SGD L+ G+  +T+RI+D+ T QC ++   ED     +  V  SP    + A+ S+D + ++WD  +   +   +  +E        + SV F+R+ + +++   D  VKLW L            ++G C + Y G     +    S A   + E Y++   +D + +  WD +  +   +L  + N  +   V +     P    F + S D +AR W  + I+
Sbjct:  453 PDGKFLATGAEDRLIRIWDIENRKIVMILQG--HEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIED----GVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGH----KDFVLSVATTQNDE-YILSGSKD-RGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIA 711          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Yeast
Match: SWD3 (Essential subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3 on lysine 4 and is required in transcriptional silencing near telomeres; WD40 beta propeller superfamily member and ortholog of mammalian WDR5 [Source:SGD;Acc:S000000379])

HSP 1 Score: 71.2478 bits (173), Expect = 3.253e-14
Identity = 60/238 (25.21%), Postives = 112/238 (47.06%), Query Frame = 1
Query:  568 PNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPN-SSMFASCSVDGSFKIWDGVSCRCINT------FEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAV-FNHTEDY---VMFPDEDTKSLCCWDSRKADRQRLL--SLNHNG----AVRCF 1230
            P+ Q +A+ S D+++++   S   +      I   +PV ++ F+  G+ L   +  ++++I+D        +      H+ A+  V    N SS+ +S S DG  +I+D  +  C+ T      +++ +   PIS V+FS N++YLL    D +VK+W+   G  +  +         LH SC + F + ED    ++    +   + CW+S      +LL  SL H+     ++ CF
Sbjct:   65 PDGQCIATASDDFSVEIIHLSYGLLHTF---IGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTI---SAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLDGVVKIWDCIGGCVVRTFQVQPLEKGVLHHSCGMDFLNPEDGSTPLVISGYENGDIYCWNSDTKSLLQLLDGSLYHHSSPVMSIHCF 296          

HSP 2 Score: 58.9214 bits (141), Expect = 3.454e-10
Identity = 53/205 (25.85%), Postives = 89/205 (43.41%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPE---DQHNGA--INMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFE 924
            VT+H        ++  GQ +AT S+D S++I+ +                        ++ ++ T   H A V  + F+   NL  L + S D +IK++D  N S+ K   +  EA     +  + S   L  G+Y   +RI+D  T  C  +   +    + NG   I+ V +S N+      S+DG  KIWD +    + TF+
Sbjct:   51 VTSHARPFSELCWSPDGQCIATASDDFSVEIIHL------------------------SYGLLHTFIGHTAPVISLTFNRKGNL--LFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDS-SILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLDGVVKIWDCIGGCVVRTFQ 228          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Yeast
Match: PRP4 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000006382])

HSP 1 Score: 66.6254 bits (161), Expect = 2.020e-12
Identity = 44/177 (24.86%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  502 HPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPS--VKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWEL 1026
             P+ + L  H  ++  +D+HPD N Q++ S ++D  IK F +SN    ++     +     +  +K+H SG  +   ++  T R++D +T Q     + ++ H+  +  +++  + S+  S  +D    +WD  S   + T   A    PI +V +S N   + T G D I+ +W++
Sbjct:  208 QPLTQKLDSHVGKIGAIDWHPDSNNQMI-SCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQEL---LLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTL--AGHSKPIYTVAWSPNGYQVATGGGDGIINVWDI 378          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Yeast
Match: LST8 (Protein required for the transport of Gap1p; required for the transport of amino acid permease Gap1p from the Golgi to the cell surface; component of the TOR signaling pathway; associates with both Tor1p and Tor2p; contains a WD-repeat [Source:SGD;Acc:S000004951])

HSP 1 Score: 63.1586 bits (152), Expect = 1.340e-11
Identity = 51/223 (22.87%), Postives = 88/223 (39.46%), Query Frame = 1
Query:  529 HQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQ----------------------------------------------HNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            H+  V+ V F  D   + + + S+D TIK++D  +PS+ + +K     +PV  +  H +   L+       +RI+D+   QC     PED                                               H+  I  +  S +    A+CS D + ++W       + T    H+ + +    FS +S YL+T+  D  V+LW+LST   + +Y G
Sbjct:   74 HRGNVTSVSFQQDN--RWMVTSSEDGTIKVWDVRSPSIPRNYK---HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRW-VWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Nematostella
Match: EDO32178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVS3])

HSP 1 Score: 426.017 bits (1094), Expect = 2.008e-147
Identity = 217/421 (51.54%), Postives = 290/421 (68.88%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDE--ADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWY 1296
            K R+ LY+LIISQL +DG +  A  +  T N  +   P  RLL+++ LGL+   +   A    L  D  T   G+DL+ E+++ +  P AA+YET YVTAHKA CRAA+F+  G+LVATGS DSSIK+LDV+RM+AK+  P   +  + Q   +E HPVIRTLYDH  EV+ ++FHP     +L SGSKD T+KLFD S PSVKKA+K++ EA  + ++ FH SGD +LV T H T+R+YDVNT QCFV + P + H   + MV ++P+++++ASCS DGS KIWDGVS RC+ TF KAH G  I SVQFS NSKY+++SGKDS+V LWEL+TGR +  YTG+  T    +R+ A+FNHTED+++  DE   S+ CWD+R  ++ + L   HN  +RC  HSP  AAF+SCSDD RARFWY
Sbjct:    6 KQRETLYKLIISQLHYDGCEAVAAALAKTTNIISPCPPCARLLEIVNLGLAAEAEGIVAHLLTLANDLAT--KGIDLEYESDAHSTTPPAAIYETYYVTAHKAPCRAASFSPNGKLVATGSVDSSIKVLDVDRMVAKNTMP--QVHDQGQGMNLENHPVIRTLYDHAEEVTALEFHP--CAPVLISGSKDCTVKLFDISKPSVKKAYKAVQEAEVINSMSFHPSGDFVLVSTEHPTIRLYDVNTFQCFVPSNPREYHTEPVTMVKYAPSANLYASCSNDGSIKIWDGVSNRCVATFPKAHNGAEIFSVQFSFNSKYVISSGKDSLVYLWELATGRAVNMYTGSTMTN---YRTQAIFNHTEDFILVADEKNSSISCWDTRTTEKLKALPSGHNNHIRCLTHSPVGAAFVSCSDDFRARFWY 417          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 99.3673 bits (246), Expect = 1.087e-22
Identity = 77/270 (28.52%), Postives = 120/270 (44.44%), Query Frame = 1
Query:  313 ETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVF-NHTED 1119
            E+    AH A  R+  F+  GQ + T S+D S+K+  V R                          + +L  H   V C  F PD  L  + SGS D TIKL+D ++      F        V +++FH SG C+  G    T++++D+   +          H GA+N V++ P+ +   S S D + KI D +  R   T    H+G P +SV FSRN +Y  +   D  V +W+ +  +  ++Y     T R+  R+  V  +HT D
Sbjct:   94 ESTVFKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQ-----------------------KFLYSLNAHMNWVRCAKFSPDGRL--IVSGSDDKTIKLWDRTSKDCVHTFYD--PGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHY---QAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLH-GHQG-PATSVVFSRNGEYFASGSSDEQVMVWKTNFDK--VDYQEVLRTHRK--RAAPVSPSHTHD 327          

HSP 2 Score: 78.5666 bits (192), Expect = 6.834e-16
Identity = 85/334 (25.45%), Postives = 139/334 (41.62%), Query Frame = 1
Query:  322 YVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRT--LYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVK---KAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEY---TGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSL--NHNGAVRCFVHSPTTAAFLSCSDDNRARFW 1293
            +   H+    +  FN   + + TGS DSS+ I   +                         P +R      H+  +  V F P  +L  +AS S+D T++L+    PSVK     FK+    + VR++ F   G  LL  +  K+L+++ V+  +   S    + H   +    +SP+  +  S S D + K+WD  S  C++TF     GF ++SV+F  +   +   G DS VK+W++   + L  Y   TGA         +   F+ + +Y++    DT +L   D  +    RL      H G     V S     F S S D +   W
Sbjct:   13 HFKGHRDTVTSVDFNPNMKQLVTGSMDSSLMIWHFK-------------------------PHMRAYRFVGHKDAILSVKFSPSGHL--IASASRDKTVRLW---VPSVKGESTVFKA--HTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSL---NAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDP-GGF-VNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGA--------VNSVSFHPSGNYLVSASSDT-TLKILDLMEG---RLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVW 297          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 97.0561 bits (240), Expect = 2.378e-22
Identity = 72/251 (28.69%), Postives = 124/251 (49.40%), Query Frame = 1
Query:  310 YETCY-VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            Y+  Y +T H  A  +  F+  G+ +A+ S D  IKI           G  D   +             +T+  H+  +S V +  D   + L S S D T+K++DF+     K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  +  V ++ + ++  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YTG
Sbjct:   55 YQLKYTLTGHNKAVSSVKFSHNGEWLASSSADKVIKIW----------GAYDGKFE-------------KTITGHKLGISDVAWSTDS--RHLVSASDDKTLKIWDFATGKCLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC-LKTLPA--HSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG 274          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Nematostella
Match: EDO47404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLW2])

HSP 1 Score: 82.8037 bits (203), Expect = 4.417e-17
Identity = 55/176 (31.25%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  499 THPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWEL 1026
            T  VI TL  H  +++ V +HP   L I AS   D TI+++  +  S +   K+  +A  V  +  H++GD LL  +  +     D+ T +     + +   N  +    + P+  +F + + D   KIWD      +  F   H G PIS + FS N  YL TS  DS+VKLW+L
Sbjct:  256 TEQVIATLKGHTKKITNVIYHPTEELGITASA--DSTIRVWSITKGSCEHILKAHDQA--VTGLSLHATGDYLLSCSADQHWAFSDIRTGRVLTKCISDPAVNQGLTCAQFHPDGLIFGTGTSDSIIKIWDLKERTNVAKF-PGHSG-PISDITFSENGYYLATSADDSVVKLWDL 425          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 82.0333 bits (201), Expect = 4.973e-17
Identity = 65/244 (26.64%), Postives = 112/244 (45.90%), Query Frame = 1
Query:  319 CYVT--AHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCL 1044
            CY T   H A     AFN    ++ATGS D++ K+ DV+                       T   I TL  H AE+    F+     Q+L +GS D+T+ ++D    S ++    I     +   +F+     ++ G+  KT +I+D  T +C  +      H+  +  V +     + A+ S DG+ ++++ ++  C++  E  HEG  IS + F+     LLT+  D   +LW+ +TG+CL
Sbjct:  169 CYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQ-----------------------TGAEISTLSGHSAEIISCAFNS-TGTQLL-TGSFDHTVSVWD--TRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTL---RGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLE-GHEG-EISKITFNAQGTRLLTASSDKTARLWDPNTGKCL 380          

HSP 2 Score: 66.6254 bits (161), Expect = 5.264e-12
Identity = 54/237 (22.78%), Postives = 99/237 (41.77%), Query Frame = 1
Query:  313 ETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWE 1023
            E   ++ H A   + AFN+TG  + TGS D ++ + D      +SG                    + TL  H+ E+S   F+ D +   + +GS D T K++D          +       V  + F  +G  +   +   T R+Y+  T  C       + H G I+ +T++   +   + S D + ++WD  + +C+   E   +   I S  F+ +   ++T  KD+  +LW 
Sbjct:  211 EISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDT-----RSG------------------RRVHTLIGHRGEISNAQFNFDCSF--IVTGSMDKTCKIWDAGTGKCIGTLRG--HDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKL---EGHEGEISKITFNAQGTRLLTASSDKTARLWDPNTGKCLQVLEGHTD--EIFSCAFNYDGDIIITGSKDNTCRLWR 415          

HSP 3 Score: 57.7658 bits (138), Expect = 4.341e-9
Identity = 57/245 (23.27%), Postives = 92/245 (37.55%), Query Frame = 1
Query:  313 ETCYVTAHKAACRAAAFN-ATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCL 1044
            ET  +  HK    A AFN   G  +ATGS D + K+ + E                       T     T   H AE+ C+ F+P     ++A+GS D T KL+D    +          ++ + +  F+S+G  LL G++                                             D +  +WD  S R ++T    H G  IS+ QF+ +  +++T   D   K+W+  TG+C+
Sbjct:  126 ETLTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAE-----------------------TGKCYHTYRGHSAEIVCLAFNPQST--VIATGSMDTTAKLWDVQTGAEISTLSG--HSAEIISCAFNSTGTQLLTGSF---------------------------------------------DHTVSVWDTRSGRRVHTL-IGHRG-EISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCI 296          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Medaka
Match: cstf1 (cleavage stimulation factor subunit 1 [Source:NCBI gene;Acc:101173931])

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 317/425 (74.59%), Query Frame = 1
Query:   40 KDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            KDR  LY+LIISQLL+DGY + A  ++  V P     PS +L++L ++G+   D        + D++ PG G+D++ + +  TM+PEA+ YETCYVT+HK  CR A ++  GQL+ATGS D+SIKILD ERMLAKS  PI+ M  E  QQ ME HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD LLVGT H TLR+YDVNT QCFVS  P DQH   I+ V+++P+++ + SCS DGS K+WDGVS RC+ TFEKAH+G  + S  FS+NSKY+L+SGKDS+VKLWE+STGR L++YTGAG +GRQ+HR+  VFNHTEDYV+ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:    9 KDRQQLYKLIISQLLYDGYTSIANSLINEVKPQNVVSPSEQLMQLAKIGMENDDSAVQYAIGRSDTVAPGVGIDMEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFLLVGTQHPTLRLYDVNTFQCFVSCNPLDQHTDTISGVSYNPSANSYVSCSKDGSIKLWDGVSNRCVTTFEKAHDGAEVCSAIFSKNSKYVLSSGKDSVVKLWEISTGRTLVKYTGAGLSGRQMHRTQGVFNHTEDYVLLPDERTISLCCWDSRTAERKNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRTTTD 431          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Medaka
Match: cstf1 (cleavage stimulation factor subunit 1 [Source:NCBI gene;Acc:101173931])

HSP 1 Score: 385.185 bits (988), Expect = 3.139e-132
Identity = 177/271 (65.31%), Postives = 215/271 (79.34%), Query Frame = 1
Query:  502 HPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            HPVIRTLYDH  EV+C+ FHP    QILASGS+DYT+KLFD+S PS K+AFK I EA  +R+I FH SGD LLVGT H TLR+YDVNT QCFVS  P DQH   I+ V+++P+++ + SCS DGS K+WDGVS RC+ TFEKAH+G  + S  FS+NSKY+L+SGKDS+VKLWE+STGR L++YTGAG +GRQ+HR+  VFNHTEDYV+ PDE T SLCCWDSR A+R+ LLSL HN  VRC VHSPT   F++CSDD RARFWY+R  +D
Sbjct:   67 HPVIRTLYDHVDEVTCLAFHPTE--QILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFLLVGTQHPTLRLYDVNTFQCFVSCNPLDQHTDTISGVSYNPSANSYVSCSKDGSIKLWDGVSNRCVTTFEKAHDGAEVCSAIFSKNSKYVLSSGKDSVVKLWEISTGRTLVKYTGAGLSGRQMHRTQGVFNHTEDYVLLPDERTISLCCWDSRTAERKNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRTTTD 335          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 98.9821 bits (245), Expect = 1.072e-22
Identity = 71/245 (28.98%), Postives = 123/245 (50.20%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            +  H  A  +  F+ +G+ +A+ S D  IKI           G  D   +             +T+  H+  +S V +  D NL  L S S D T+K++D ++    K  K    ++ V    F+   + ++ G++ +++RI+DV T +C +  +P   H+  ++ V ++ + S+  S S DG  +IWD  S +C+ T     +  P+S V+FS N KY+L +  D+ +KLW+ S G+CL  YTG
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIW----------GAYDGKFE-------------KTISGHKLGISDVAWSSDSNL--LVSASDDKTLKIWDVNSGKCLKTLKG--HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC-LKTLP--AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLID-DDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTG 254          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Medaka
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:101167102])

HSP 1 Score: 80.8777 bits (198), Expect = 5.801e-16
Identity = 68/241 (28.22%), Postives = 106/241 (43.98%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSI-VKLWELSTGRCL 1044
            +T HK A     F+ + + VA GS+  SI++ D+E                          +++TL  H+A ++ + FH  P  Q LAS S D  IKL+D         FK   +A  VR++ F   G  L   +   T++++D++  +          H+ A+N+V + PN  + AS S D S ++WD      I T E       I  V FS +   L +   DS+ V  WE    RC+
Sbjct:   59 LTGHKTAVECIQFSLSEEQVAAGSQSGSIRVWDLE-----------------------AAKILQTLMGHKASITSLGFH--PYGQFLASSSMDTNIKLWDVRRKGYVFRFKGHTDA--VRSLAFSPDGKWLASASDDCTVKLWDLSQGKIITEF---KSHSAAVNIVQFHPNEYLLASGSSDRSVRLWDLEKFTMIGTLEGDTSA--IRCVCFSPDGSCLFSGATDSLRVFGWE--PDRCI 265          

HSP 2 Score: 68.9366 bits (167), Expect = 3.809e-12
Identity = 60/259 (23.17%), Postives = 112/259 (43.24%), Query Frame = 1
Query:  529 HQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCA--VFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYK 1299
            H   VSC+        ++LA+G +D  + L+  +  +   +       + V  I+F  S + +  G+   ++R++D+   +   + +    H  +I  + + P     AS S+D + K+WD      +  F K H    + S+ FS + K+L ++  D  VKLW+LS G+ + E+          H +    V  H  +Y++      +S+  WD  K      L      A+RC   SP  +   S + D+   F ++
Sbjct:   19 HARPVSCLALGKSTG-RLLATGGEDCRVNLWSLNKANCIMSLTG--HKTAVECIQFSLSEEQVAAGSQSGSIRVWDLEAAKILQTLM---GHKASITSLGFHPYGQFLASSSMDTNIKLWDVRRKGYVFRF-KGHTDA-VRSLAFSPDGKWLASASDDCTVKLWDLSQGKIITEFKS--------HSAAVNIVQFHPNEYLLASGSSDRSVRLWDLEKFTMIGTLE-GDTSAIRCVCFSPDGSCLFSGATDSLRVFGWE 260          
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Medaka
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:101167102])

HSP 1 Score: 80.8777 bits (198), Expect = 5.801e-16
Identity = 68/241 (28.22%), Postives = 106/241 (43.98%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSI-VKLWELSTGRCL 1044
            +T HK A     F+ + + VA GS+  SI++ D+E                          +++TL  H+A ++ + FH  P  Q LAS S D  IKL+D         FK   +A  VR++ F   G  L   +   T++++D++  +          H+ A+N+V + PN  + AS S D S ++WD      I T E       I  V FS +   L +   DS+ V  WE    RC+
Sbjct:   59 LTGHKTAVECIQFSLSEEQVAAGSQSGSIRVWDLE-----------------------AAKILQTLMGHKASITSLGFH--PYGQFLASSSMDTNIKLWDVRRKGYVFRFKGHTDA--VRSLAFSPDGKWLASASDDCTVKLWDLSQGKIITEF---KSHSAAVNIVQFHPNEYLLASGSSDRSVRLWDLEKFTMIGTLEGDTSA--IRCVCFSPDGSCLFSGATDSLRVFGWE--PDRCI 265          

HSP 2 Score: 68.9366 bits (167), Expect = 3.809e-12
Identity = 60/259 (23.17%), Postives = 112/259 (43.24%), Query Frame = 1
Query:  529 HQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCA--VFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYK 1299
            H   VSC+        ++LA+G +D  + L+  +  +   +       + V  I+F  S + +  G+   ++R++D+   +   + +    H  +I  + + P     AS S+D + K+WD      +  F K H    + S+ FS + K+L ++  D  VKLW+LS G+ + E+          H +    V  H  +Y++      +S+  WD  K      L      A+RC   SP  +   S + D+   F ++
Sbjct:   19 HARPVSCLALGKSTG-RLLATGGEDCRVNLWSLNKANCIMSLTG--HKTAVECIQFSLSEEQVAAGSQSGSIRVWDLEAAKILQTLM---GHKASITSLGFHPYGQFLASSSMDTNIKLWDVRRKGYVFRF-KGHTDA-VRSLAFSPDGKWLASASDDCTVKLWDLSQGKIITEFKS--------HSAAVNIVQFHPNEYLLASGSSDRSVRLWDLEKFTMIGTLE-GDTSAIRCVCFSPDGSCLFSGATDSLRVFGWE 260          
BLAST of Cleavage stimulation factor subunit 1 vs. Planmine SMEST
Match: SMESG000009269.1 (SMESG000009269.1)

HSP 1 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 427/427 (100.00%), Postives = 427/427 (100.00%), Query Frame = 1
Query:   34 MYKDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            MYKDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDNMGQENQQQQMETHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD
Sbjct:    1 MYKDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQLGLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDNMGQENQQQQMETHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 427          
BLAST of Cleavage stimulation factor subunit 1 vs. Planmine SMEST
Match: SMESG000054739.1 (SMESG000054739.1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.229e-15
Identity = 52/185 (28.11%), Postives = 80/185 (43.24%), Query Frame = 1
Query:  505 PVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            P    L  H+A ++CV FHP  N  +  SGS+D TIK++D+ +                              G Y +TLR                  H   +  + + P+  + ASCS D   K+WD V   C+ T    H+   +S V F  +  +LL++ +D  +KLWE+STG C+  + G
Sbjct:   66 PARHVLKGHRASITCVRFHPLYN--VFVSGSEDATIKIWDYES------------------------------GDYERTLR-----------------GHTNHVQDLAFDPSGKLLASCSADMQIKLWDFVEFTCVKTLS-GHD-HNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFEG 199          

HSP 2 Score: 70.8626 bits (172), Expect = 3.483e-13
Identity = 71/273 (26.01%), Postives = 114/273 (41.76%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFP------------------ISSVQFSRNSK-------------YLLTSG-KDSIVKLWELSTGRCLI 1047
            +  H+A+     F+    +  +GSED++IKI D E       G  +                 RTL  H   V  + F  DP+ ++LAS S D  IKL+DF   +  K          V  + F  SGD LL  +  KT+++++V+T  C  +    + H+  + +V  + + S+ ASCS D S ++W   +  C   F + HE                     +   Q + N               +LL SG +D  ++LW+ +TG CL 
Sbjct:   71 LKGHRASITCVRFHPLYNVFVSGSEDATIKIWDYE------SGDYE-----------------RTLRGHTNHVQDLAF--DPSGKLLASCSADMQIKLWDFVEFTCVKTLSG--HDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTF---EGHSDWVRVVKPNFDGSLIASCSNDNSVRVWSMANKECKFDF-REHEHVVQCIVWGGQKIHMETNQALLDDKQMTSNGDSSNKLDGYKMSGCHLLASGSRDRTIRLWDTNTGVCLF 312          
BLAST of Cleavage stimulation factor subunit 1 vs. Planmine SMEST
Match: SMESG000035997.1 (SMESG000035997.1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.770e-15
Identity = 52/185 (28.11%), Postives = 80/185 (43.24%), Query Frame = 1
Query:  505 PVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTG 1059
            P    L  H+A ++CV FHP  N  +  SGS+D TIK++D+ +                              G Y +TLR                  H   +  + + P+  + ASCS D   K+WD V   C+ T    H+   +S V F  +  +LL++ +D  +KLWE+STG C+  + G
Sbjct:  100 PARHVLKGHRASITCVRFHPLYN--VFVSGSEDATIKIWDYES------------------------------GDYERTLR-----------------GHTNHVQDLAFDPSGKLLASCSADMQIKLWDFVEFTCVKTLS-GHD-HNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFEG 233          

HSP 2 Score: 70.4774 bits (171), Expect = 6.315e-13
Identity = 71/273 (26.01%), Postives = 114/273 (41.76%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFP------------------ISSVQFSRNSK-------------YLLTSG-KDSIVKLWELSTGRCLI 1047
            +  H+A+     F+    +  +GSED++IKI D E       G  +                 RTL  H   V  + F  DP+ ++LAS S D  IKL+DF   +  K          V  + F  SGD LL  +  KT+++++V+T  C  +    + H+  + +V  + + S+ ASCS D S ++W   +  C   F + HE                     +   Q + N               +LL SG +D  ++LW+ +TG CL 
Sbjct:  105 LKGHRASITCVRFHPLYNVFVSGSEDATIKIWDYE------SGDYE-----------------RTLRGHTNHVQDLAF--DPSGKLLASCSADMQIKLWDFVEFTCVKTLSG--HDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTF---EGHSDWVRVVKPNFDGSLIASCSNDNSVRVWSMANKECKFDF-REHEHVVQCIVWGGQKIHMETNQALLDDKQMTSNGDSSNKLDGYKMSGCHLLASGSRDRTIRLWDTNTGVCLF 346          
BLAST of Cleavage stimulation factor subunit 1 vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.674e-14
Identity = 68/265 (25.66%), Postives = 121/265 (45.66%), Query Frame = 1
Query:  529 HQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVK-KAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSL--NHNGAVRCFVHSPTTAAFLSCSDDNRARFWYKRPISD 1314
            H+  +  V F   P  Q++AS S+D T++L+    PS+K ++       + VR++        ++ G+  KT++++ ++  Q F  ++ E  H   +  V +S +  + AS S D + K+WD  +  CI+TF++ H GF + S+ F  N  Y+ + G DS V +W++   + L  YT   +         AV  H     +    D  S+  +D  +    RLL     H G +     S     F S   D++   W    +S+
Sbjct:   55 HEDAILSVKF--SPTGQLVASASRDKTVRLW---VPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHR-QKFSYSLNE--HKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQE-HGGF-VPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSP------VNAVSFHPSGNFLISSSDDSSMKIYDLLEG---RLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSE 300          

HSP 2 Score: 62.7734 bits (151), Expect = 2.028e-10
Identity = 48/188 (25.53%), Postives = 77/188 (40.96%), Query Frame = 1
Query:  325 VTAHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIW 888
            +  HK   R   F++ GQL+A+ S+D +IK+ D                             I T  +H   V  + FH  PN   +ASG  D  + ++D     + + + S    SPV  + FH SG+ L+  +   +++IYD+   +   +      H G I    +S    MFAS   D    +W
Sbjct:  136 LNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD-----------------------RHNQECIHTFQEHGGFVPSLAFH--PNGSYIASGGTDSHVNIWDIRMNKLLQHYTS--HTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTV---QGHEGPILGTAFSHCGEMFASGGADHQVFLW 293          

HSP 3 Score: 52.7582 bits (125), Expect = 3.059e-7
Identity = 48/166 (28.92%), Postives = 69/166 (41.57%), Query Frame = 1
Query:  802 HNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRL-LSLN-HNGAVRCFVHSPTTAAFLSCSDDNRARFW 1293
            H   +  V ++PNSS  AS  +D    IW+         F   HE   I SV+FS   + + ++ +D  V+LW  S     + +     T R +  SC      ++  M    D K++  W   K  RQ+   SLN H   VRC   S       S SDD   + W
Sbjct:   13 HKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRF-VGHED-AILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISC------DNLEMVTGSDDKTIKVW---KMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLW 167          
BLAST of Cleavage stimulation factor subunit 1 vs. Planmine SMEST
Match: SMESG000071691.1 (SMESG000071691.1)

HSP 1 Score: 65.855 bits (159), Expect = 2.836e-11
Identity = 54/197 (27.41%), Postives = 90/197 (45.69%), Query Frame = 1
Query:  517 TLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAHEGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFN 1107
            T+  H+  V+C+  H   N ++  + S D + KL+   +  V    K     + V    F + G+ L   +   TL+I++++  +C  +    + H+ +I  V W  ++   A+ S D + K+WD  S +C  T  + H    ++SVQF  NS  LLTS  D  V LW+     C     G   +G Q   + A  N
Sbjct:  306 TIKAHEGAVTCIRTHK--NKKVFCTTSDDDSWKLWSLDSLQVLMTGKG--HTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTF---EGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKC-RTILRGHSD-SVNSVQFLVNSNILLTSSADKTVCLWDARISTC-----GQSISGHQYAVNSANIN 488          

HSP 2 Score: 58.9214 bits (141), Expect = 4.961e-9
Identity = 61/271 (22.51%), Postives = 113/271 (41.70%), Query Frame = 1
Query:  331 AHKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDXXXXXXXXXXXXTHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSNPSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCR----CINTFEKAHEGF-PISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQLHRSCAVFNHTEDYVM 1128
             H      AAF+  G+ +AT S D+++KI ++                            + T   H   +  VD+H   +   LA+ S D TIK++D ++   +   +    +  V +++F  + + LL  +  KT+ ++D   + C  S      H  A+N    +   +  ASC   G  K WD   CR     INT +    GF P + V++  +   +  S  DS++K+ E ++      +      G +     A+F+H  ++++
Sbjct:  351 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNL-----------------------SAAECLYTFEGHSQSIWSVDWHT--SAPFLATASHDKTIKVWDLNSLKCRTILRG--HSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISG---HQYAVNSANINEQGTNIASCDAFGFLKFWD---CRQLATSINTIDL---GFHPANDVRYDTSGSCVAMSSSDSVIKMVETAS------FNVTSLVGHEDSVQSAMFDHDGEFLI 579          
The following BLAST results are available for this feature:
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSTF10.000e+059.29cleavage stimulation factor subunit 1 [Source:HGNC... [more]
CSTF11.278e-13456.93cleavage stimulation factor subunit 1 [Source:HGNC... [more]
CSTF11.278e-13456.93cleavage stimulation factor subunit 1 [Source:HGNC... [more]
CSTF13.182e-4150.75cleavage stimulation factor subunit 1 [Source:HGNC... [more]
WDR5B1.152e-2329.00WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpf-14.613e-14649.18Cleavage and Polyadenylation Factor [Source:UniPr... [more]
cpf-14.613e-14649.18Cleavage and Polyadenylation Factor [Source:UniPr... [more]
wdr-5.11.473e-2528.34WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.11.473e-2528.34WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.23.094e-1926.61WD repeat-containing protein wdr-5.2 [Source:UniP... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CstF506.247e-15554.85gene:FBgn0039867 transcript:FBtr0085865[more]
wds2.181e-2226.30gene:FBgn0040066 transcript:FBtr0308566[more]
wds2.181e-2226.30gene:FBgn0040066 transcript:FBtr0070438[more]
Prp192.738e-1424.91gene:FBgn0261119 transcript:FBtr0086723[more]
Lis-17.312e-1323.88gene:FBgn0015754 transcript:FBtr0087241[more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cstf10.000e+058.35cleavage stimulation factor, 3' pre-RNA, subunit 1... [more]
cstf10.000e+058.35cleavage stimulation factor, 3' pre-RNA, subunit 1... [more]
cstf16.088e-9556.47cleavage stimulation factor, 3' pre-RNA, subunit 1... [more]
cstf11.205e-9156.28cleavage stimulation factor, 3' pre-RNA, subunit 1... [more]
cstf13.058e-4851.23cleavage stimulation factor, 3' pre-RNA, subunit 1... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cstf10.000e+058.59cleavage stimulation factor, 3' pre-RNA, subunit 1... [more]
ppp4r1l4.708e-2228.30protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l6.058e-2228.26protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l6.058e-2228.26protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l6.058e-2228.26protein phosphatase 4 regulatory subunit 1 like (p... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cstf10.000e+059.29cleavage stimulation factor, 3' pre-RNA, subunit 1... [more]
Cstf14.649e-4451.06cleavage stimulation factor, 3' pre-RNA, subunit 1... [more]
Wdr5b2.699e-2430.53WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr52.401e-2328.90WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
Wdr53.141e-2131.98WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5BJQ6|CSTF1_RAT0.000e+059.29Cleavage stimulation factor subunit 1 OS=Rattus no... [more]
sp|Q99LC2|CSTF1_MOUSE0.000e+059.29Cleavage stimulation factor subunit 1 OS=Mus muscu... [more]
sp|Q05048|CSTF1_HUMAN0.000e+059.29Cleavage stimulation factor subunit 1 OS=Homo sapi... [more]
sp|Q5R8K2|CSTF1_PONAB0.000e+059.29Cleavage stimulation factor subunit 1 OS=Pongo abe... [more]
sp|Q8L4J2|CTF50_ARATH3.074e-8036.62Cleavage stimulation factor subunit 50 OS=Arabidop... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VBS10.000e+076.81WD_REPEATS_REGION domain-containing protein OS=Sch... [more]
C1L5160.000e+076.58Cleavage stimulation factor 50 kDa subunit OS=Schi... [more]
A0A5K3ELD30.000e+077.23Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3NRG80.000e+077.99Cleavage stimulation factor subunit 1 OS=Schistoce... [more]
A0A158RAD70.000e+076.29WD_REPEATS_REGION domain-containing protein OS=Tae... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cstf10.000e+058.59cleavage stimulation factor subunit 1 [Source:NCBI... [more]
ENSAMXT00000007963.26.493e-2428.78WD repeat-containing protein 5-like [Source:NCBI g... [more]
ENSAMXT00000007962.26.845e-2428.78WD repeat-containing protein 5-like [Source:NCBI g... [more]
ENSAMXT00000052579.16.845e-2428.78WD repeat-containing protein 5-like [Source:NCBI g... [more]
wdr54.136e-2329.39WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cstf10.000e+057.61cleavage stimulation factor, 3' pre-RNA, subunit 1... [more]
POC1A2.763e-1825.74POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
pafah1b1b8.460e-1822.99platelet-activating factor acetylhydrolase 1b, reg... [more]
ENSPMAT00000004902.11.863e-1529.10pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 ge... [more]
wdsub19.929e-1425.69WD repeat, sterile alpha motif and U-box domain co... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PWP21.059e-1825.48Conserved 90S pre-ribosomal component; essential f... [more]
TUP12.600e-1623.25General repressor of transcription; forms complex ... [more]
SWD33.253e-1425.21Essential subunit of the COMPASS (Set1C) complex; ... [more]
PRP42.020e-1224.86Splicing factor; component of the U4/U6-U5 snRNP c... [more]
LST81.340e-1122.87Protein required for the transport of Gap1p; requi... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO321782.008e-14751.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453461.087e-2228.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332972.378e-2228.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474044.417e-1731.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348654.973e-1726.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cstf10.000e+059.29cleavage stimulation factor subunit 1 [Source:NCBI... [more]
cstf13.139e-13265.31cleavage stimulation factor subunit 1 [Source:NCBI... [more]
wdr51.072e-2228.98WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
katnb15.801e-1628.22katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
katnb15.801e-1628.22katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cleavage stimulation factor subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009269.10.000e+0100.00SMESG000009269.1[more]
SMESG000054739.11.229e-1528.11SMESG000054739.1[more]
SMESG000035997.11.770e-1528.11SMESG000035997.1[more]
SMESG000024482.13.674e-1425.66SMESG000024482.1[more]
SMESG000071691.12.836e-1127.41SMESG000071691.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027032 ID=SMED30027032|Name=Cleavage stimulation factor subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1324bp
TAAATAATTCATCATTTTATTGAAACTTTTAAAATGTATAAAGATCGAGA
TTTACTGTATCGACTTATTATAAGCCAGTTATTGTTTGATGGATATCAAA
CCGCAGCTATACATATAATGACAACAGTGAATCCCTCTACATCTTCTGGA
CCATCAAATCGCTTATTGAAACTAATGCAGTTGGGTTTATCAATCTCAGA
TGATGAAGCCGATCGATGCAATTTGAAAGAAGATAGTATTACACCAGGAA
CAGGCATGGATTTGGACGTTGAAACCGAAAGTTCGACAATGGCTCCTGAA
GCAGCTTTATATGAAACCTGCTATGTTACTGCTCATAAAGCAGCTTGTAG
AGCCGCTGCATTTAATGCTACCGGACAACTAGTTGCTACAGGATCTGAAG
ATTCATCAATTAAGATTCTTGACGTCGAGCGCATGCTGGCCAAAAGCGGA
GGTCCAATTGATAATATGGGCCAAGAAAATCAACAACAACAAATGGAAAC
TCACCCTGTCATAAGAACTCTTTATGACCATCAAGCAGAAGTTTCCTGTG
TCGATTTCCACCCTGATCCGAATCTTCAGATTCTTGCTAGTGGCAGTAAA
GATTACACTATAAAACTTTTTGATTTCTCTAATCCATCTGTCAAAAAGGC
ATTTAAAAGTATTCCAGAAGCATCTCCTGTAAGAACAATCAAATTTCATT
CATCTGGTGATTGTTTGTTGGTAGGAACTTATCACAAAACGCTGAGAATT
TACGATGTTAACACAACTCAGTGTTTCGTTTCTGCTGTTCCAGAAGATCA
GCACAATGGAGCTATAAACATGGTTACTTGGTCACCGAATTCTTCAATGT
TTGCTTCTTGTTCTGTTGATGGAAGTTTCAAAATCTGGGACGGGGTTTCT
TGTCGATGTATTAACACGTTTGAAAAAGCCCATGAAGGGTTTCCTATAAG
TTCCGTGCAGTTCTCACGGAATAGTAAATATTTGCTAACCTCGGGAAAAG
ATAGCATTGTAAAATTGTGGGAATTATCTACTGGACGATGTCTAATAGAA
TATACCGGAGCCGGAACCACTGGTCGACAGTTACATCGATCGTGTGCCGT
TTTCAACCACACTGAAGATTATGTTATGTTTCCCGACGAAGACACGAAAA
GTCTCTGTTGTTGGGATTCTCGGAAAGCAGACAGACAAAGGCTTCTTTCA
TTGAATCACAATGGGGCAGTGAGGTGTTTTGTGCATTCCCCAACGACGGC
TGCATTCCTGTCTTGTAGTGATGATAACCGAGCAAGATTCTGGTACAAAC
GGCCGATATCTGATTGAATGTGTT
back to top

protein sequence of SMED30027032-orf-1

>SMED30027032-orf-1 ID=SMED30027032-orf-1|Name=SMED30027032-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=428bp
MYKDRDLLYRLIISQLLFDGYQTAAIHIMTTVNPSTSSGPSNRLLKLMQL
GLSISDDEADRCNLKEDSITPGTGMDLDVETESSTMAPEAALYETCYVTA
HKAACRAAAFNATGQLVATGSEDSSIKILDVERMLAKSGGPIDNMGQENQ
QQQMETHPVIRTLYDHQAEVSCVDFHPDPNLQILASGSKDYTIKLFDFSN
PSVKKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVS
AVPEDQHNGAINMVTWSPNSSMFASCSVDGSFKIWDGVSCRCINTFEKAH
EGFPISSVQFSRNSKYLLTSGKDSIVKLWELSTGRCLIEYTGAGTTGRQL
HRSCAVFNHTEDYVMFPDEDTKSLCCWDSRKADRQRLLSLNHNGAVRCFV
HSPTTAAFLSCSDDNRARFWYKRPISD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038184CSTF1_dimer_sf
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR013979TIF_beta_prop-like
IPR032028CSTF1_dimer
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
GO:0005654nucleoplasm
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 245..286
e-value: 8.4E-7
score: 38.6
coord: 156..197
e-value: 2.2E-8
score: 43.9
coord: 383..421
e-value: 0.1
score: 21.7
coord: 200..241
e-value: 0.86
score: 17.4
coord: 289..330
e-value: 2.8E-7
score: 40.2
coord: 91..130
e-value: 0.0029
score: 26.8
IPR001680WD40 repeatPFAMPF00400WD40coord: 99..128
e-value: 0.074
score: 14.0
coord: 390..420
e-value: 0.16
score: 12.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 305..339
score: 12.113
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 98..132
score: 10.107
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 254..286
score: 13.215
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 163..206
score: 11.043
IPR038184CSTF1, dimerization domain superfamilyGENE3DG3DSA:1.20.960.50coord: 1..55
e-value: 1.1E-16
score: 62.0
IPR032028Cleavage stimulation factor subunit 1, dimerisation domainPFAMPF16699CSTF1_dimercoord: 3..55
e-value: 1.4E-19
score: 69.6
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 95..254
e-value: 2.8E-30
score: 107.4
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 255..426
e-value: 1.3E-30
score: 108.6
IPR013979Translation initiation factor, beta propellor-like domainPFAMPF08662eIF2Acoord: 191..321
e-value: 4.7E-6
score: 26.6
NoneNo IPR availablePANTHERPTHR44133FAMILY NOT NAMEDcoord: 3..423
NoneNo IPR availableCDDcd00200WD40coord: 114..420
e-value: 2.59043E-54
score: 180.223
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 317..331
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 98..427
score: 32.984
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 95..420