RUN domain-containing protein

Overview
NameRUN domain-containing protein
Smed IDSMED30027021
Length (bp)1897
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RUN domain-containing protein (SMED30027021) t-SNE clustered cells

Violin plots show distribution of expression levels for RUN domain-containing protein (SMED30027021) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RUN domain-containing protein (SMED30027021) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RUN domain-containing protein (SMED30027021) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027021

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027021h1SMcG0012765 dd_Smed_v4_10989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027021h1SMcG0012765 dd_Smed_v4_10989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027021h1SMcG0012765 dd_Smed_v4_10989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30027021h1SMcG0012765 dd_Smed_v4_10989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30027021h1SMcG0012765 OX_Smed_1.0.00834ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RUN domain-containing protein vs. Ensembl Human
Match: RUNDC1 (RUN domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25418])

HSP 1 Score: 263.848 bits (673), Expect = 5.285e-79
Identity = 207/605 (34.21%), Postives = 314/605 (51.90%), Query Frame = 1
Query:  127 SVRMAPLGATASPEPDFN---------EMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXMLTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDV----------------------WSIKNDKS----KENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINL-ENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHER------------QISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSS--EDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLI--SISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            +VR AP+GA A   P            E    P  P  ++    +++L  E+ +L+S+L+ L+SHFAQ+Q RL+Q+V    +  +  L+ELE+FAF+G P V                      W    D+S    +E ++ + EKQ ++I  LK +L++LE++AYQ G     P S VL  Q+ II++L  +LD+NL E+  +LS  +L+  VD A+ +I+NP +V+E+LV+QLKTQI DLE FI ++QD+  S  +            +  N    T       G     AE  KK  ET   L+R+AL +LQ+ A SQFGC      P +      + D       +  +  +LEV ++RV + +  L+ Q  D   +S+  +DL+                  + +L   +RK+ +  +  L+ HG+       SL+   I+C     LP    +  + HPW++ V +Y  K GR  + SP  KLS SF L   GG  +T KQ LL AI ++L  H  +KRS D++ KA VC ALNE++L  W+ +I K+  +I   Y+PWSY    GF+  L+ L RLS + F LP D+++RQL  IKDA
Sbjct:   37 AVRWAPVGAVAEARPGATAFLEEATAEEPGAAPGSP-PDSPGRTLRRLRAERRRLDSALLALSSHFAQVQFRLRQVVRGAPAEQQRLLRELEDFAFRGCPHVLGYEGPGDPASDEGDGLPGDRPWLRGEDQSEQEKQERLETQREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQRVIIDELIKKLDMNLNEDISSLSTEELRQRVDAAVAQIVNPARVKEQLVEQLKTQIRDLEMFINFIQDEVGSPLQTGGGHCECKAGGKTGNGCSRTGSSRTPPGNSKTKAEDVKKVRETGLHLMRRALAVLQIFAVSQFGCATGQIPPTLWQRVQADRD-------YSPLLKRLEVSVDRVKQLA--LRQQPHDHVITSANLQDLSLGG---------------KDELTMAVRKELTVAVRDLLAHGLYASSPGMSLVMAPIACL----LPAFSSAPEAMHPWELFVKYYHAKNGRAYVESPARKLSQSFALPVTGGTVVTPKQSLLTAIHMVLTEHDPFKRSADSELKALVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLPVDLAVRQLKNIKDA 612          
BLAST of RUN domain-containing protein vs. Ensembl Human
Match: SGSM3 (small G protein signaling modulator 3 [Source:HGNC Symbol;Acc:HGNC:25228])

HSP 1 Score: 56.9954 bits (136), Expect = 1.650e-8
Identity = 48/181 (26.52%), Postives = 76/181 (41.99%), Query Frame = 1
Query: 1216 VIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI------INSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDL 1740
            ++R      L  L EHG+       SL+  +C                HPW     F E   GRE+      + S +  L  +F LD   G  +T ++ L RA+  +  TH A     D + ++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR L    F L
Sbjct:    4 LVRGTLCPALKALFEHGLKKP----SLLGGAC----------------HPW----LFIEEAAGREVERDFASVYSRL-VLCKTFRLDE-DGKVLTPEELLYRAVQSVNVTHDAVHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSL 158          
BLAST of RUN domain-containing protein vs. Ensembl Human
Match: SGSM3 (small G protein signaling modulator 3 [Source:HGNC Symbol;Acc:HGNC:25228])

HSP 1 Score: 57.7658 bits (138), Expect = 5.555e-8
Identity = 49/184 (26.63%), Postives = 77/184 (41.85%), Query Frame = 1
Query: 1216 VIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI------INSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            ++R      L  L EHG+       SL+  +C                HPW     F E   GRE+      + S +  L  +F LD   G  +T ++ L RA+  +  TH A     D + ++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR L    F L  D
Sbjct:  559 LVRGTLCPALKALFEHGLKKP----SLLGGAC----------------HPW----LFIEEAAGREVERDFASVYSRLV-LCKTFRLDE-DGKVLTPEELLYRAVQSVNVTHDAVHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQD 716          
BLAST of RUN domain-containing protein vs. Ensembl Celegans
Match: rund-1 (RUN Domain containing protein; RUND-1 [Source:UniProtKB/TrEMBL;Acc:Q22585])

HSP 1 Score: 238.424 bits (607), Expect = 1.802e-70
Identity = 173/512 (33.79%), Postives = 287/512 (56.05%), Query Frame = 1
Query:  283 LTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIKNDKSKEN-----IKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVK--VSTMHWGDIRAQLEVVI---ERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGM-SDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            L+SHFAQ+Q R+KQ+ +   S+  + L +L++FAFKG  D+  ++  +S+       +  +NE+Q ++++ L+E++E+LE  AY+ GE  E P++ +L  QK ++++LR ++++NL +   +++ +++  VD+A+ +++NP K + +LVDQL+TQI DLERF+ +LQ +N  +  Q +  +          G    S  KSK  S    FL            +   GC         +   F  + +K  +   H+GD RA +++ +   ++V+E     KY     + ++   L  +  E   ++E F+  E  ++++ ++RK     L  L+EHGM S+      +  + CF  +S  + K +  S H WD+I+YFY  K GR+  ++PV KLS SF LD++GG  IT KQ LL  I  I+ TH+  KRSKDA +KAFV  ALNEKKL  WL+II + R ++   Y  WSY  + G ++    L  L K +  LP D+++R   +IKDA
Sbjct:   83 LSSHFAQVQFRIKQMNEADPSDRLKLLSDLQKFAFKGCTDMNELQRLRSESESGNDVLDKQNERQKELLKQLREQVEDLERTAYENGE-GELPSTDILKKQKAVLDKLREKIELNL-DIDKMNQTEIQRQVDDALKQLVNPFKEKGQLVDQLQTQITDLERFVNFLQKENAENSNQTTPVRSM--------GSTPLSGAKSKNGS----FL------------SGIIGC---------STGRFQKNQLKNTLKGNHYGDERAHVQLAVDATQQVLE-----KYTLLTFDSATKGQLEEVQVE---NDEVFERSE--EEVVTIVRKQLCLALKALLEHGMLSETVVHKRIPGLGCFVAKSSADEKSTSLS-HIWDVILYFYNLKTGRDTTDAPVRKLSQSFKLDHVGGRSITSKQVLLTTIENIISTHARLKRSKDAHWKAFVSAALNEKKLPAWLRIIFRTRQVVEMCYNSWSYVARTGCEELYTLLEGLHKYSIHLPVDLALRPFEQIKDA 548          
BLAST of RUN domain-containing protein vs. Ensembl Fly
Match: CG3703 (gene:FBgn0040348 transcript:FBtr0070187)

HSP 1 Score: 214.927 bits (546), Expect = 1.832e-60
Identity = 177/609 (29.06%), Postives = 290/609 (47.62%), Query Frame = 1
Query:  292 HFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIKN---DKSKENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLEN--FITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKDETNDKAQFEGKP--TYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCH-----IHNKKPPVNNASFVNSDVKVSTM----------------------HWGDIR--------------AQLEVVIERVIEFSDQLKYQQRDSN-------------------------------------YSSS--------EDLAFLDTEYNSDNE-------KFDNFE-IRKQLIYVIRKDFSTRLMQLIEHGM---SDKCHSNSLIS-ISCF----SGRSLPETKDSH-----TSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKI 1776
            HFA +QLR++QIV+  +   ++ L++LE+FAF+G+PD    K    DK   + + ++    ++I+ LK +L ELE  AY+ GE    P   +L  QKFI+++LR++L++ +E      LS   L++ VDNAI E + P+K++E+LV QLKTQI DLERFI +LQ D           +    D+ +       +Y+A+++ ++S+ +               +S  G H     +H+K   + + + V   +  ST                       HWGD+R              A L    E++      L+ QQ+ +                                      Y+S         ED+++ + E+  +++       + D+   I ++L  V+RK+F+  L QLI+HG+   ++   S+ ++  + C              DS       + H W++++ +Y  K G E  N+P  KLS SF LD +    +T KQ LL A+G+IL  H  YKRS +A FKAFVC  LN   L +WL +IL    +++++Y   SY  + GF D+L S+  LS+ +FDLP D++IR    I
Sbjct:  112 HFAHVQLRVRQIVEAPAEERDQLLRDLEDFAFQGIPDAVQSKESHPDKPASDGEKDHGPDSQLIQQLKSQLTELEQIAYEAGEPGILPQHVLLEKQKFILDELRAKLNLQVEQHELPALSTEQLRHQVDNAIGEFVGPLKMKEQLVAQLKTQITDLERFIAFLQCDA---------IEGSVGDRLKLLSGAYNSYAAKQTARSSQASYVATNAPATTATTPPSSGLGAHSSGESLHSKAHGLLDKASVLMQMFASTHLVKPRTHDEFQQNSLKKTHKGNHWGDLRAQLEVDIQEVAALAATLSCDREKLANIKRALRKQQQQAESTEFSDTGNPVINSQNGALTLPPRCRRAVPTGHELAPYASGGAISSDSDEDISYSNFEWEKESKSRRTTHARGDSIATIGRELTTVVRKNFARTLQQLIQHGLRIPAESAASSLMVPFMRCLHPGPPVVPPAVGGDSQFLGLGRAMHAWELVLAYYRLKHGEEYNNTPARKLSQSFQLDIVDAQAVTAKQSLLSAVGMILAMHRPYKRSNNAHFKAFVCAGLNSHLLVEWLNLILSCHELVDTYYSADSYVARTGFRDSLRSIDALSRFDFDLPVDLAIRHFRNI 711          
BLAST of RUN domain-containing protein vs. Ensembl Zebrafish
Match: RUNDC1 (si:dkey-151m15.5 [Source:ZFIN;Acc:ZDB-GENE-120215-63])

HSP 1 Score: 275.789 bits (704), Expect = 4.053e-84
Identity = 208/580 (35.86%), Postives = 307/580 (52.93%), Query Frame = 1
Query:  133 RMAPLGATASPEPDFNEMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXML--TSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIKNDKS-----------KENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINL-ENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISN--FKDETNDKAQFEGKPTYSA---------EKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLI--SISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPIT--KKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            R AP+GA A+PE +  +         + + +++ +  + E EQ   +  +L  TSHFAQ+Q RLKQIV  +S   E  L ELEEFAF+G P V   +   +           +E ++ +  KQ ++I  LK +L++LE +AYQ G     P S V+  Q+ II++L  +LD+NL E+   L+  +L+  VD AI +I+NP +V+E+LV+QLKTQI DLE FI ++QD+       + N    D T  +      P   A         E++++  ET   LI+KAL +LQ+ A SQFGC   +   P N  S            +G +  +LE  +ERV       + Q      SS      LD    S +        R +L   +RK+ +  L  L+ HG+       SL+   ISC     LP +    T  HPW++ V +Y +K G+  + SP  +LS SF L  +GG P+T   KQ LL AI  +L  H  +KRS D++FKA VC ALNE++L  WL ++ K+  +I+S Y+PWSY  + GF+  L  L R+S + F LP D+++RQL  IKDA
Sbjct:   21 RWAPVGAVANPEDEHWKTGAQAGSVSSGDGEMVSRLRKMEDEQEQLNSSLLALTSHFAQVQFRLKQIVHAQSDEKERMLLELEEFAFRGCPHVVGCRAQDAHMLENSSEREKRERLEAQRNKQKELIFQLKNQLDDLERFAYQEGSYDSLPQSVVMERQRVIIDELIKKLDVNLNEDIGNLTPEELRQRVDAAIAQIVNPARVKEQLVEQLKTQIRDLEMFINFIQDE-------VGNPLLNDGTKSQPTHAAGPNTGATGGVKRVDPEQAQRMRETGLQLIQKALAVLQIFALSQFGCAAGHV--PQNMWS-----QGAEAQDYGPLLQKLEGAVERV-------RLQASRHQPSS------LDEHVVSYSASLSPEGPRDELTASVRKELAIALRDLLAHGLYAPSQGMSLVLAPISCL----LPFSSSPQTL-HPWELFVKYYHSKNGQAFVESPARQLSQSFSLP-VGGGPVTVTPKQSLLWAIHTVLKEHRRFKRSTDSEFKALVCMALNEQRLVSWLNLLCKSGTLIHSHYQPWSYMAQTGFEGALRILGRISHLKFSLPVDLAVRQLKNIKDA 567          
BLAST of RUN domain-containing protein vs. Ensembl Zebrafish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:406635])

HSP 1 Score: 53.1434 bits (126), Expect = 1.363e-7
Identity = 39/138 (28.26%), Postives = 64/138 (46.38%), Query Frame = 1
Query: 1360 HPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISI 1758
            HPW     F E    +E+    NS   +L    ++ LD   G  +T ++ L RA+  +  +H       D +F++ +C  LNE+ L  WL+++  +   +  +Y PWS+    G+      LR LSK  F L  D  +
Sbjct:   36 HPW----LFIEEAASKEVERDFNSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNMSHDTAHVQMDVKFRSLICVGLNEQVLHLWLEVLCSSMSAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQDCEL 168          
BLAST of RUN domain-containing protein vs. Ensembl Zebrafish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:406635])

HSP 1 Score: 53.1434 bits (126), Expect = 9.434e-7
Identity = 39/138 (28.26%), Postives = 64/138 (46.38%), Query Frame = 1
Query: 1360 HPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISI 1758
            HPW     F E    +E+    NS   +L    ++ LD   G  +T ++ L RA+  +  +H       D +F++ +C  LNE+ L  WL+++  +   +  +Y PWS+    G+      LR LSK  F L  D  +
Sbjct:  591 HPW----LFIEEAASKEVERDFNSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNMSHDTAHVQMDVKFRSLICVGLNEQVLHLWLEVLCSSMSAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQDCEL 723          
BLAST of RUN domain-containing protein vs. Ensembl Xenopus
Match: rundc1 (RUN domain containing 1 [Source:NCBI gene;Acc:100493791])

HSP 1 Score: 276.174 bits (705), Expect = 3.542e-84
Identity = 180/515 (34.95%), Postives = 286/515 (55.53%), Query Frame = 1
Query:  283 LTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIK-------NDKS----KENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINL-ENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLI--SISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            LTSHFAQ+Q RLKQIV  +    E  L ELE+FAFKG P V   +       +D S    +E I+ + +KQ ++I  LK +L++LE++AYQ G     P S V+  Q+ II++L  +LD+N  E+   LS  +L+  VD AI +I+NP +V+E+LV+QLKTQI DLE FI+++QD+  S     ++  +  +   +   +   + E++++  +T   L+R+AL +LQ+ A SQFGC        +      N D       +  +  +LE  +E+V + + + +  +   +YSS+++L+                  + +L   +RK+ +  +  L+ HG+       SL+   I+C     +P    S  + HPW++ V +Y  + G+  + SP  KLS SF L   G   +T KQ LL AI  +L  H  +KR  D++FKA +C ALNE++L  WL ++ K+ ++I + Y+PWSY    GF+  L+ L RLS + F LP D+++RQL  IKDA
Sbjct:   83 LTSHFAQVQFRLKQIVRAEGGEKETLLAELEDFAFKGSPHVLGTRKLEEQVLDDSSEWEKRERIEAQRQKQRELIVQLKTQLDDLETFAYQEGSYDSLPQSMVMEKQRVIIDELIKKLDVNFHEDITCLSPEELRQRVDAAIAQIVNPARVKEQLVEQLKTQIRDLEMFIQFIQDEVGSPVDCSASGTEGYSPNTKTNPRNKMTPEQARQMRQTRLHLLRRALAVLQMFAVSQFGCGTGAVPANLWKQDESNRD-------FSPLIKKLEESVEKVRQLAQRNQTYEHVISYSSTKELSMGG---------------KDELTIAVRKELAVAIRDLLSHGLYATSQGMSLVLAPIACL----IPVFSTSPPTMHPWELFVKYYNEQNGKAFVESPARKLSQSFSLPVSGNSKVTPKQSLLTAIHTVLTEHDPFKRGADSEFKALICMALNEQRLVSWLNLLCKSGVLIQTHYQPWSYMASSGFESALNILSRLSTLKFSLPVDLAVRQLKNIKDA 571          
BLAST of RUN domain-containing protein vs. Ensembl Xenopus
Match: mak (male germ cell associated kinase [Source:Xenbase;Acc:XB-GENE-490935])

HSP 1 Score: 51.9878 bits (123), Expect = 3.279e-6
Identity = 42/170 (24.71%), Postives = 72/170 (42.35%), Query Frame = 1
Query: 1255 IEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            +  G++D        SI       L +        HPW     F E    RE+    +S   +L    ++ LD   G  +T ++ L R +  +  +H A     D + ++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR LS+  F L  D
Sbjct:  554 VTEGITDLVRGTLCPSIKSIFEHGLKKPSLLGGPCHPW----LFIEEAASREVERDFDSVYSRLVLCKTYRLDE-DGKVLTPEELLYRGVQSVNVSHDAAHAQMDVKLRSLICIGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLSRFAFSLSPD 718          
BLAST of RUN domain-containing protein vs. Ensembl Xenopus
Match: mak (male germ cell associated kinase [Source:Xenbase;Acc:XB-GENE-490935])

HSP 1 Score: 51.9878 bits (123), Expect = 3.279e-6
Identity = 42/170 (24.71%), Postives = 72/170 (42.35%), Query Frame = 1
Query: 1255 IEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            +  G++D        SI       L +        HPW     F E    RE+    +S   +L    ++ LD   G  +T ++ L R +  +  +H A     D + ++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR LS+  F L  D
Sbjct:  554 VTEGITDLVRGTLCPSIKSIFEHGLKKPSLLGGPCHPW----LFIEEAASREVERDFDSVYSRLVLCKTYRLDE-DGKVLTPEELLYRGVQSVNVSHDAAHAQMDVKLRSLICIGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLSRFAFSLSPD 718          
BLAST of RUN domain-containing protein vs. Ensembl Xenopus
Match: mak (male germ cell associated kinase [Source:Xenbase;Acc:XB-GENE-490935])

HSP 1 Score: 51.9878 bits (123), Expect = 3.416e-6
Identity = 42/170 (24.71%), Postives = 72/170 (42.35%), Query Frame = 1
Query: 1255 IEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            +  G++D        SI       L +        HPW     F E    RE+    +S   +L    ++ LD   G  +T ++ L R +  +  +H A     D + ++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR LS+  F L  D
Sbjct:  554 VTEGITDLVRGTLCPSIKSIFEHGLKKPSLLGGPCHPW----LFIEEAASREVERDFDSVYSRLVLCKTYRLDE-DGKVLTPEELLYRGVQSVNVSHDAAHAQMDVKLRSLICIGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLSRFAFSLSPD 718          
BLAST of RUN domain-containing protein vs. Ensembl Mouse
Match: Rundc1 (RUN domain containing 1 [Source:MGI Symbol;Acc:MGI:2144506])

HSP 1 Score: 257.299 bits (656), Expect = 1.233e-76
Identity = 186/542 (34.32%), Postives = 287/542 (52.95%), Query Frame = 1
Query:  283 LTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIKN-----------------------DKS----KENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINL-ENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKDETNDKAQF-----------EGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLI--SISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            L+SHFAQ+Q RL+Q+V    +  +  L+ELE+FAF+G P V   +                        D+S    +E ++ + EKQ ++I  LK +L++LE++AYQ G     P S VL  Q+ II++L  +LD+NL E+  +LS  +L+  VD A+ +I+NPV+V+E+LV+QLKTQI DLE FI ++QD+  S  +   + + + + K               G     AE +K+  ET   L+R+AL +LQ+   SQ GC        +   S  + D       +  +  +LEV ++RV + +  L++Q  D   +S+      D      +E          L  V+RK+ +  +  L+ HG+       SL+   ++C     LP    +  + HPW++ V +Y  K GR  + SP  KLS SF L  +G   +T KQ LL AI ++L  H  +KRS D++ KA VC ALNE++L  W+ +I K+  +I   Y+PWSY    GF+  L+ L RLS + F LP D+++RQL  IKDA
Sbjct:   99 LSSHFAQVQFRLRQVVRGAPAEQQRLLRELEDFAFRGCPHVLGYEGLADPCGGDESDVLPGDRPRVRGEDQSEQEKRERLETQREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQRVIIDELIKKLDMNLNEDISSLSTEELRQRVDAAVAQIVNPVRVKEQLVEQLKTQIRDLEMFISFIQDEVGSPLQTGGHCECQASGKVGIGSTRVGGSTLPPGPGKAKAEDAKRARETGLHLMRRALAVLQIFTVSQLGCATGQIPQTLWQRSQADRD-------YSHLLKRLEVSVDRVKQLA--LRHQPHDHVITSAN---LQDLSLGGKDE----------LTTVVRKELTVAVRDLLAHGLYASSSGMSLVMAPLACL----LPVFSSAPETMHPWELFVKYYHAKNGRAYVESPARKLSQSFALPIMGDTAVTPKQSLLTAIHLVLTEHDPFKRSADSELKALVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLPVDLAVRQLKNIKDA 614          
BLAST of RUN domain-containing protein vs. Ensembl Mouse
Match: Sgsm3 (small G protein signaling modulator 3 [Source:MGI Symbol;Acc:MGI:1916329])

HSP 1 Score: 56.6102 bits (135), Expect = 7.655e-8
Identity = 48/183 (26.23%), Postives = 77/183 (42.08%), Query Frame = 1
Query: 1216 VIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            ++R      L  L EHG+       SL+  +C                HPW     F E   GRE+    +S   +L    ++ LD   G  +T ++ L RA+  +  TH A     D + ++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR L    F L  D
Sbjct:  559 LVRGTLCPALKALFEHGLKKP----SLLGGAC----------------HPW----LFIEEAAGREVERDFDSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQD 716          
BLAST of RUN domain-containing protein vs. Ensembl Mouse
Match: Sgsm3 (small G protein signaling modulator 3 [Source:MGI Symbol;Acc:MGI:1916329])

HSP 1 Score: 53.1434 bits (126), Expect = 9.184e-7
Identity = 39/137 (28.47%), Postives = 64/137 (46.72%), Query Frame = 1
Query: 1354 SNHPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            + HPW     F E   GRE+    +S   +L    ++ LD   G  +T ++ L RA+  +  TH A     D + ++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR L    F L  D
Sbjct:  487 ACHPW----LFIEEAAGREVERDFDSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQD 618          
BLAST of RUN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96C34|RUND1_HUMAN (RUN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUNDC1 PE=1 SV=3)

HSP 1 Score: 263.848 bits (673), Expect = 2.538e-78
Identity = 207/605 (34.21%), Postives = 314/605 (51.90%), Query Frame = 1
Query:  127 SVRMAPLGATASPEPDFN---------EMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXMLTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDV----------------------WSIKNDKS----KENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINL-ENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHER------------QISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSS--EDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLI--SISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            +VR AP+GA A   P            E    P  P  ++    +++L  E+ +L+S+L+ L+SHFAQ+Q RL+Q+V    +  +  L+ELE+FAF+G P V                      W    D+S    +E ++ + EKQ ++I  LK +L++LE++AYQ G     P S VL  Q+ II++L  +LD+NL E+  +LS  +L+  VD A+ +I+NP +V+E+LV+QLKTQI DLE FI ++QD+  S  +            +  N    T       G     AE  KK  ET   L+R+AL +LQ+ A SQFGC      P +      + D       +  +  +LEV ++RV + +  L+ Q  D   +S+  +DL+                  + +L   +RK+ +  +  L+ HG+       SL+   I+C     LP    +  + HPW++ V +Y  K GR  + SP  KLS SF L   GG  +T KQ LL AI ++L  H  +KRS D++ KA VC ALNE++L  W+ +I K+  +I   Y+PWSY    GF+  L+ L RLS + F LP D+++RQL  IKDA
Sbjct:   37 AVRWAPVGAVAEARPGATAFLEEATAEEPGAAPGSP-PDSPGRTLRRLRAERRRLDSALLALSSHFAQVQFRLRQVVRGAPAEQQRLLRELEDFAFRGCPHVLGYEGPGDPASDEGDGLPGDRPWLRGEDQSEQEKQERLETQREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQRVIIDELIKKLDMNLNEDISSLSTEELRQRVDAAVAQIVNPARVKEQLVEQLKTQIRDLEMFINFIQDEVGSPLQTGGGHCECKAGGKTGNGCSRTGSSRTPPGNSKTKAEDVKKVRETGLHLMRRALAVLQIFAVSQFGCATGQIPPTLWQRVQADRD-------YSPLLKRLEVSVDRVKQLA--LRQQPHDHVITSANLQDLSLGG---------------KDELTMAVRKELTVAVRDLLAHGLYASSPGMSLVMAPIACL----LPAFSSAPEAMHPWELFVKYYHAKNGRAYVESPARKLSQSFALPVTGGTVVTPKQSLLTAIHMVLTEHDPFKRSADSELKALVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLPVDLAVRQLKNIKDA 612          
BLAST of RUN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0VDN7|RUND1_MOUSE (RUN domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rundc1 PE=1 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 8.623e-76
Identity = 186/542 (34.32%), Postives = 287/542 (52.95%), Query Frame = 1
Query:  283 LTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIKN-----------------------DKS----KENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINL-ENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKDETNDKAQF-----------EGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLI--SISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            L+SHFAQ+Q RL+Q+V    +  +  L+ELE+FAF+G P V   +                        D+S    +E ++ + EKQ ++I  LK +L++LE++AYQ G     P S VL  Q+ II++L  +LD+NL E+  +LS  +L+  VD A+ +I+NPV+V+E+LV+QLKTQI DLE FI ++QD+  S  +   + + + + K               G     AE +K+  ET   L+R+AL +LQ+   SQ GC        +   S  + D       +  +  +LEV ++RV + +  L++Q  D   +S+      D      +E          L  V+RK+ +  +  L+ HG+       SL+   ++C     LP    +  + HPW++ V +Y  K GR  + SP  KLS SF L  +G   +T KQ LL AI ++L  H  +KRS D++ KA VC ALNE++L  W+ +I K+  +I   Y+PWSY    GF+  L+ L RLS + F LP D+++RQL  IKDA
Sbjct:   99 LSSHFAQVQFRLRQVVRGAPAEQQRLLRELEDFAFRGCPHVLGYEGLADPCGGDESDVLPGDRPRVRGEDQSEQEKRERLETQREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQRVIIDELIKKLDMNLNEDISSLSTEELRQRVDAAVAQIVNPVRVKEQLVEQLKTQIRDLEMFISFIQDEVGSPLQTGGHCECQASGKVGIGSTRVGGSTLPPGPGKAKAEDAKRARETGLHLMRRALAVLQIFTVSQLGCATGQIPQTLWQRSQADRD-------YSHLLKRLEVSVDRVKQLA--LRHQPHDHVITSAN---LQDLSLGGKDE----------LTTVVRKELTVAVRDLLAHGLYASSSGMSLVMAPLACL----LPVFSSAPETMHPWELFVKYYHAKNGRAYVESPARKLSQSFALPIMGDTAVTPKQSLLTAIHLVLTEHDPFKRSADSELKALVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLPVDLAVRQLKNIKDA 614          
BLAST of RUN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96HU1|SGSM3_HUMAN (Small G protein signaling modulator 3 OS=Homo sapiens OX=9606 GN=SGSM3 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.668e-7
Identity = 49/184 (26.63%), Postives = 77/184 (41.85%), Query Frame = 1
Query: 1216 VIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI------INSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            ++R      L  L EHG+       SL+  +C                HPW     F E   GRE+      + S +  L  +F LD   G  +T ++ L RA+  +  TH A     D + ++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR L    F L  D
Sbjct:  559 LVRGTLCPALKALFEHGLKKP----SLLGGAC----------------HPW----LFIEEAAGREVERDFASVYSRLV-LCKTFRLDE-DGKVLTPEELLYRAVQSVNVTHDAVHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQD 716          
BLAST of RUN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2KI13|SGSM3_BOVIN (Small G protein signaling modulator 3 OS=Bos taurus OX=9913 GN=SGSM3 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 4.095e-7
Identity = 48/183 (26.23%), Postives = 78/183 (42.62%), Query Frame = 1
Query: 1216 VIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            ++R      L  L+EHG+       SL+  +C                HPW     F E   GRE+    +S   +L    ++ LD   G  +T ++ L RA+  +  TH A     D + ++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR L    F L  D
Sbjct:  556 LVRGTLCPALKALLEHGLKKP----SLLGGAC----------------HPW----LFIEEAAGREVERDFDSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQD 713          
BLAST of RUN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8VCZ6|SGSM3_MOUSE (Small G protein signaling modulator 3 OS=Mus musculus OX=10090 GN=Sgsm3 PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 5.355e-7
Identity = 48/183 (26.23%), Postives = 77/183 (42.08%), Query Frame = 1
Query: 1216 VIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            ++R      L  L EHG+       SL+  +C                HPW     F E   GRE+    +S   +L    ++ LD   G  +T ++ L RA+  +  TH A     D + ++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR L    F L  D
Sbjct:  559 LVRGTLCPALKALFEHGLKKP----SLLGGAC----------------HPW----LFIEEAAGREVERDFDSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQD 716          
BLAST of RUN domain-containing protein vs. TrEMBL
Match: A0A433TVE9 (RUN domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_006733 PE=4 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 4.512e-116
Identity = 250/579 (43.18%), Postives = 354/579 (61.14%), Query Frame = 1
Query:   97 DSDSTEE---ERPSVRMAPLGATASPEPDFNEMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXMLTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIK----------NDKSKE-NIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHN-KKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTE-YNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            D DS +E   ERP+ R APLGA  SP P        P  P + N    +++LEEEQEQLNSSL+ LT+HFAQ+Q RLKQIV  +  + E  LKELEEFAFKG+PDV   K          +DK  E  I  + EKQ ++IE LK +LE+LE+YAY+TG+    PTSKV+  QK ++E+L+ +LD+NLENF +LS  +L+  VD+A+ +I+NP KV+EKLVDQLKTQI+DLERFIE+LQ +  S             D+      P +       ++E+A  +++KAL +LQ+   SQ GC   + K+  +   +  N        HWGDIRA+LEV I + IE ++Q K + ++            DTE Y+SD+++  + +    L+  +R+D +  +  L++HG+ +   S+SL+   CF  RS   T       H WD+ + FYE K GRE   SP  KLS SF LD IGG  IT KQ LL AI  ++++H+ +KRS+D   KAF+C ALNE+KL  WL+++ + + +I+++Y+ WSY  + GF+D L SL RL  INF+LP D+++R  S IKDA
Sbjct:   26 DYDSFDEGGSERPAERWAPLGAAVSPTPS-------PYEPSHVNDADELRRLEEEQEQLNSSLLALTTHFAQVQFRLKQIVSAEPDDKETLLKELEEFAFKGIPDVRGCKIQDAQMLEEMSDKQHEIKISEQREKQRELIEQLKSQLEDLETYAYETGDADALPTSKVMEKQKVVLEELKHKLDLNLENFDSLSAEELRQVVDHAVGQIVNPAKVKEKLVDQLKTQIVDLERFIEFLQGEATSP-------GPLGKDRCLC---PMHEDVSKHFSNESAANIMKKALTVLQIYVISQLGCGSRDFKRNLLKKTARGN--------HWGDIRAKLEVAINKCIEVAEQQKQEAKEDT----------DTEDYSSDSDELLH-QSSPALVQAVRRDLAMAIRDLMQHGLMEVGQSSSLVPFGCFPSRSAQATH----MLHAWDLFLKFYEMKHGREYNESPARKLSQSFHLDMIGGKAITAKQTLLGAIDTVINSHTPFKRSEDTHLKAFICMALNERKLVTWLRLLFRTQSLIDTYYQDWSYVARTGFEDALRSLERLLVINFNLPVDLAVRPFSNIKDA 564          
BLAST of RUN domain-containing protein vs. TrEMBL
Match: A0A2C9K3H6 (RUN domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106079855 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 2.879e-114
Identity = 249/596 (41.78%), Postives = 361/596 (60.57%), Query Frame = 1
Query:  103 DSTEEERPSVRMAPLGATASPEPDFNEMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXMLTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIKNDKS--------KEN---IKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWS-----HERQISNFKDETND-----------KAQFEGKPTYSAEKSKKTS-------ETATFLIRKALNLLQLIAASQFGCHIHN-KKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            D    +RP+ R APLGA  SP P        P  P ++     +Q+LEEEQEQLNSSL+ LT+HFAQ+Q RLKQIV+ +  + E+ LKELEEFAFKG+PDV   K   +        KE+   I  + EKQ ++IE LK +LE+LE+YAY+TG+ +  PTS+V+  QK ++E+L+ +LD++LENF  LS  +L+  VD+A+ +I+NP KV+EKLV+QLKTQI DLERFIE+LQ +  S      ER I    +E+ +           KAQ + + +  + + K+ S       E+A  ++RKAL +LQ+   SQ GC   + K+  +   +  N        HWGD+RA+LE+ + R IE +++ K + +    + SED       Y+S +++ +N +   +L   +RKD +  L  L++HG+ +   S SL+   CF  RS   T       H WD+ + +YE K GRE   SP  KLS SF LD IGG PIT KQ  L AI  ++++H+  KRS+DA  KAF+C ALNE+KL  WL+++ + + +I+++Y+ WSY  + GF+D L SL RL  INF LP D+++R  S IKDA
Sbjct:   31 DEGGSDRPAERWAPLGAAVSPTPS-------PYEPRHSYDKDELQRLEEEQEQLNSSLLALTTHFAQVQFRLKQIVNAQPEDKEKLLKELEEFAFKGIPDVRGCKGQDAQILEEVSEKEHELKISEQREKQRQLIEQLKSQLEDLETYAYETGDAETLPTSRVMEKQKVVLEELKHKLDLDLENFDNLSTEELRQIVDHAVGQIVNPAKVKEKLVEQLKTQISDLERFIEFLQGEATSPGPLGKERCICPLHEESQNREGLGQKSLGSKAQHKHQDSSRSRERKQESSNSQHLNESANSMMRKALTILQIYVISQLGCGSRDFKRNLLKKTAKGN--------HWGDLRAKLEMAVTRCIELAEEQKSKSKQD--TDSED-------YSSGSDEQEN-QSSPELTQCVRKDLAMALRDLMQHGLMEMGQSTSLVPFGCFPSRSAQVTH----MLHAWDLFLKYYEMKHGREYNESPARKLSQSFHLDMIGGKPITAKQTFLGAIDTVINSHTPLKRSEDAHLKAFICLALNERKLVTWLRLLFRTQTLIDTYYQDWSYVARTGFEDALRSLERLLVINFSLPVDLAVRTFSNIKDA 597          
BLAST of RUN domain-containing protein vs. TrEMBL
Match: A0A210QS98 (RUN domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18032 PE=4 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 2.282e-113
Identity = 256/612 (41.83%), Postives = 365/612 (59.64%), Query Frame = 1
Query:   46 IDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATA-SPEPDFNEMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXMLTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWS------------IKNDKSKE-NIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWS-----HER---QISNFKDETND------KAQFEGKPTY--SAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTM--HWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            +D+S+    + FD+  +D       RP+ R APLGA A SP          P      +    ++KLEEEQEQLNSSL+ LT+HFAQ+Q RLKQIV   + + E  LKELE+FAFKG+PDV              + +D+  E  I  + EKQ ++I+ LK +LE+LE+YAY+TGE  E PT+K++  QK +I++LR++LD++L+N+  LS  DLK  VD A+ +I+NP KV+EKLVDQLKTQI DLERFI++LQ D  S      ER    +  F DE +D      KA   G+P+      ++K   ET  F+ R+ + +LQ+   SQFGC          +  F  + +K +T   HWGD+RA+LEV + +V E    L  +Q+D      E+      EY SD+E+    +    L  V+RKD S  +  L++HG+ +   S S++   C   RS   TK  H     WD+++ FYE K GRE  +SP  KLS SF LD +GG P+T KQ LL AI  ++ +H+  KR++D+ FKAF+  ALNEKKL+ WLK++ + + +I+ +Y+ WSY  +  FDD+L S+ RLSK+NF LP D+++R  S IKDA
Sbjct:   12 LDDSVEYNYDSFDEQTDD-------RPAERWAPLGAAATSP---------VPGAAAEADHIEQLEKLEEEQEQLNSSLLALTTHFAQVQFRLKQIVSADAEDKEVLLKELEQFAFKGIPDVRGTAVQEAQSLHENLMSDREHEMKISEQREKQQELIKQLKTQLEDLETYAYETGEA-EIPTNKMMEKQKVVIDELRNKLDLDLDNYQKLSMEDLKLVVDRAVGQIVNPAKVKEKLVDQLKTQITDLERFIDFLQGDASSPGPLGKERCTCPVHKFGDEGSDHGKDCCKAPHSGRPSLKDGKARAKNIRETTAFM-RRTITVLQMFLLSQFGC---------GSRDFQRNVLKKTTKGNHWGDLRARLEVAVAKVAE----LAKEQQDEKDLRQEN----QDEYGSDSEESQE-QSSPALTQVVRKDLSMAIRDLMQHGLMEIGQSTSVVPFGCIPNRSAAVTKQMHA----WDLLLRFYEMKHGREYNDSPFRKLSQSFHLDMVGGKPVTAKQTLLGAIDTVITSHTPLKRTEDSHFKAFISLALNEKKLSTWLKLLFRTQTLIDQYYQDWSYVARTSFDDSLKSMDRLSKVNFQLPVDLAVRPFSNIKDA 583          
BLAST of RUN domain-containing protein vs. TrEMBL
Match: K1QI92 (RUN domain-containing protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10022478 PE=4 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 9.007e-110
Identity = 242/603 (40.13%), Postives = 362/603 (60.03%), Query Frame = 1
Query:   55 SIPKYIERFDKSINDSDSTEEE--RPSVRMAPLGATASPEPDFNEMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXMLTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIK----------NDKSKE-NIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWS-----HER------QISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTM--HWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            ++P   E  D    D DS +E+  RP+ R APLG   SP P   E+       ++      +++LE+EQEQLNSSL+ LT+HFAQ+Q RLKQIV  ++ + E  LKELEEFAFKG+PDV   +          +DK  E  I  + EKQ ++I  LK +LE+LE+YAY+TG+V+E PT+K++  Q+ +I++L+++LD+N++NF  LS +DLKN VD+AI +I+NP KV+EKLVDQL+TQ++DLERFI +LQ +  S      ER      +++N KD          K     E+ K   +T  F ++K L +LQ+   +QFGC             F  + +K +T   HWGD+RA+LE+ I + +E + + + + +D             +E+ SD+E+    +    L   +RKD +  +  L++HG+ +   S SL+   C   RS   T+    S H WD+++ FYE K GR+   SP  KLS SF L+ +GG PIT KQ +L AI  ++ +H+  KRS+D+ FKAF+  ALNE+KL  WLK++ + + +I+++Y+ WSY  + GFDD L SL +L+ I F LP D+++R  S IKDA
Sbjct:    5 TLPAAEEELDV---DYDSFDEQYDRPTERWAPLGQATSPAPSRMEL-------NHETHLEEMERLEKEQEQLNSSLLALTTHFAQVQFRLKQIVSAEAEDKEILLKELEEFAFKGIPDVRGSRVQDAQILEEMSDKEHEVKINEQREKQRELIHQLKSQLEDLENYAYETGDVEELPTNKMMEKQRVVIDELKTKLDLNMDNFDKLSTDDLKNVVDHAIGQIVNPAKVKEKLVDQLRTQVVDLERFIAFLQGEASSPGPLGEERCTCPVHKVNNSKDCKGLHHHHNRKLKEKVEREKNVKDTQAF-VKKTLAILQMFIITQFGC---------GAGEFKRNMMKKTTKGNHWGDLRARLELAINKTLELAQKQEEEPQDDQ-----------SEFGSDSEESQE-QSSPALTQCVRKDLAMAVRDLMQHGLMEIGQSKSLVPFGCLPNRSAAITQ----SLHAWDLLLKFYEMKHGRQYNESPARKLSQSFHLEMVGGKPITVKQTMLGAINTVISSHTPLKRSEDSHFKAFISMALNERKLVVWLKLLFRTQTLIDNYYQDWSYVARTGFDDALKSLDKLNSIPFKLPVDLAVRPFSNIKDA 571          
BLAST of RUN domain-containing protein vs. TrEMBL
Match: V4AKN6 (RUN domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_104100 PE=4 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 6.993e-105
Identity = 213/533 (39.96%), Postives = 322/533 (60.41%), Query Frame = 1
Query:  283 LTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDV---------WSIKNDKSKE-NIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWS-----HERQIS-----------NFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGC------HIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            LTSHFAQ+QLRLKQIV   + + E+ L ELE+FAF+G+PDV           + ++K  E  I  + EKQ ++I  LK +LE+LE+YAY+TG   E PT+KV+  QK +I++L+ ++D++L +F  LS +DLK  V++AI +I+NP KV+EKLVDQL+TQI+DLERFI++LQ +  S      ER               F  +++ +  F+ K     ++S +T+      ++K L +LQ+   SQ GC      H   KK P  N             HWGD+RA+LEV I++ I+    +K Q++  + + +ED       Y+ D+ +   F    +++  +R+D +  +  L+EHG+ +   S+S++   CF  RS   T+    + H WD+++ FYE K GRE  +SP  KLS SF LD +GG PIT KQ LL AI  I+ TH+  KRS+D+ FKAF+C ALNE+KL  WL+++ + + +I+ +Y+ WSY  + GFDD L +L RL+ + F LP D+++R  SKI+DA
Sbjct:   19 LTSHFAQVQLRLKQIVSAPADDKEKLLTELEQFAFRGIPDVRGCSEIEDAMKVMSEKEHEAKISQQREKQKELITQLKTQLEDLETYAYETGNA-ELPTTKVIEKQKIVIDELKQKIDLDLHDFDYLSPDDLKEVVNHAIAQIVNPGKVKEKLVDQLQTQIIDLERFIQFLQGEASSPGPLGKERCTCLNPIDVNKCTDRFLPKSSSQTDFKKKHHEDVKESTRTT------VKKVLTVLQIYIISQLGCGSREFKHNMMKKTPKGN-------------HWGDLRAKLEVAIDKTIQ---TVKAQEQKKSDTDTED-------YSDDSTEARIFS--AEVVQAVRRDLAMSIKDLMEHGLMEVGQSSSIVPFGCFPSRSATITR----ALHGWDLLLKFYEMKHGREYNDSPARKLSQSFHLDIVGGKPITAKQTLLGAIDTIVTTHTPLKRSEDSHFKAFICMALNERKLVTWLRLLFRTQTLIDLYYQDWSYVARTGFDDALKALDRLNTVQFKLPVDMAVRPFSKIRDA 515          
BLAST of RUN domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-151m15.5 (RUN domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25418])

HSP 1 Score: 254.218 bits (648), Expect = 1.001e-75
Identity = 192/542 (35.42%), Postives = 287/542 (52.95%), Query Frame = 1
Query:  283 LTSHFAQIQLRLKQIVDDKS--SNMXXXXXXXXXFAFKGVPDVWSIKND----------------------KSKENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINL-ENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDD---------NWSHERQISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERV-IEFSDQLKYQQRDS--NYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLI--SISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGH--PITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            ++SHFAQ+Q RL+Q+    +        L+ELEEFAF+G P V  ++                        + +E ++ + EKQ ++I  LK +L++LE +AYQ G     P S V+  Q+ II++L  +LD+NL E+   L+  +L+  VD AI +I+NPV+V+E+LV+QLKTQI DLE FI ++QD+           S E   S  K +T       G      E++++  ET   LI++AL +LQ+ A SQFGC        V  + +   D       +G +  +LEV +ERV ++ S +    Q +   +Y+SS  L     E                L  ++RKD +  L  L+ HG+       SL+   ISC     LP +    T  HPW++ V +Y +K G+  + SP  +LS SF L  +G     IT K  LL AI  +L  H  YKRS D++FKA VC ALNE++L  W+ ++ K+  +I+S Y+PWSY  + GF+  L  L RLS + F+LP D+++RQL  IKDA
Sbjct:   97 VSSHFAQVQFRLQQVARAPADERERTRMLEELEEFAFRGCPHVLGLRGTDPDSGHILGLDRGLNRGLNSEREKRERLEAQREKQKELIFQLKTQLDDLERFAYQEGSYDSLPQSVVMERQRVIIDELIKKLDVNLNEDIGKLTPEELRQRVDTAIAQIVNPVRVKEQLVEQLKTQIRDLEMFINFIQDEVGSPLQSEGGNSQEAHTSGPKPQTQG-----GMKQVDPEQAQRLRETGLQLIQRALAVLQIFALSQFGCSAGR----VPQSVWPQGD---GAQEYGPLLQKLEVAVERVRVQASRRQPAGQEEHVVSYTSSLCLGGPGDE----------------LTALVRKDLALALRDLLAHGLYTPSQGMSLVLAPISCL----LPFSPSPQTL-HPWELFVKYYHSKNGQAFVESPARQLSQSFSLP-LGRSKVTITPKHSLLWAIHSVLHEHDRYKRSADSEFKALVCMALNEQRLVSWVNLLCKSGTLIHSHYQPWSYMAQTGFEGALRILGRLSHLKFNLPVDLAVRQLKNIKDA 604          
BLAST of RUN domain-containing protein vs. Ensembl Cavefish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:103030541])

HSP 1 Score: 55.4546 bits (132), Expect = 1.534e-7
Identity = 40/138 (28.99%), Postives = 66/138 (47.83%), Query Frame = 1
Query: 1360 HPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISI 1758
            HPW     F E    RE+    NS   +L    ++ LD   G  +T ++ L RA+  +  +H +     D +F++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR LSK  F L  D  +
Sbjct:  591 HPW----LFIEEAASREVERDFNSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNMSHDSAHVQMDVKFRSLICVGLNEQVLHLWLEVLCSSINAVEKWYQPWSFLRSPGWVQIKCELRVLSKFAFSLSQDCEL 723          
BLAST of RUN domain-containing protein vs. Ensembl Cavefish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:103030541])

HSP 1 Score: 55.0694 bits (131), Expect = 1.764e-7
Identity = 40/138 (28.99%), Postives = 66/138 (47.83%), Query Frame = 1
Query: 1360 HPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISI 1758
            HPW     F E    RE+    NS   +L    ++ LD   G  +T ++ L RA+  +  +H +     D +F++ +C  LNE+ L  WL+++  +   +  +Y+PWS+    G+      LR LSK  F L  D  +
Sbjct:  591 HPW----LFIEEAASREVERDFNSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNMSHDSAHVQMDVKFRSLICVGLNEQVLHLWLEVLCSSINAVEKWYQPWSFLRSPGWVQIKCELRVLSKFAFSLSQDCEL 723          
BLAST of RUN domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001231.1 (pep scaffold:Pmarinus_7.0:GL481795:15544:20027:1 gene:ENSPMAG00000001103.1 transcript:ENSPMAT00000001231.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.639 bits (579), Expect = 7.646e-68
Identity = 161/481 (33.47%), Postives = 242/481 (50.31%), Query Frame = 1
Query:  430 KENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFI-TLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWS----HERQISN-FKDETNDKAQFEGKPT--YSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNS-----LISISC----FSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHP------------ITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            +E +  E +KQ ++I  LK +L+++E +AYQ G     P ++++   K I+E+LR +L +NL++ I  LS  +L+  VD A+ +IINP KV+E+LVDQLKTQI DLE FI++LQD+  +      RQ +     +    A   G PT    AEK+++   +   ++++AL +LQL A SQFGC         +       D       +  +  +LE  + +V   + Q       +   S  D+ F D          D+  +       +RKD +  L  L+ HG+     S S     L  I+C    FS         +    HPW I   +Y+TK GR  + SP  KLS+SF L  I G              ++ K  LL AI  +L  H  +KRS D++FKA VC  LNE++L  WL ++ K   ++ + Y+ WSY  + GF+  L  L RLS + FDL  D+S+RQL  I DA
Sbjct:    6 QERLDAERQKQQELIVQLKAQLDDVERFAYQEGSSDSVPQAELMERHKVIVEELRQKLGMNLQDDIGVLSTEELRERVDAAVAQIINPAKVKEQLVDQLKTQIRDLEMFIDFLQDEVGAPLQPGIRQCTCPVHGQPKAGAMGAGVPTGHVDAEKARQMRASGLHILKRALTMLQLFAVSQFGCGAAQVAGAWSTEPSDQQD-------YSPLLGRLEAAVSKVRRLALQRFPDGCSAGSGSDSDVFFEDAAAARGGSGADDVTV------AVRKDLAPALRDLLSHGLQPPLRSASGGSLVLAPIACLLPAFSPVRSSRGSAAAPGIHPWLIFKEYYDTKNGRAYMESPARKLSESFGL-RIDGETGGAGGAGGRARGVSAKHGLLVAIHEVLSDHDRFKRSADSEFKALVCRGLNEQRLVSWLNLVCKAGTLVEAHYQAWSYMARTGFEGALTILGRLSDLQFDLAADLSVRQLKNINDA 472          
BLAST of RUN domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001230.1 (pep scaffold:Pmarinus_7.0:GL481795:15541:20027:1 gene:ENSPMAG00000001103.1 transcript:ENSPMAT00000001230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 225.713 bits (574), Expect = 4.721e-67
Identity = 161/486 (33.13%), Postives = 242/486 (49.79%), Query Frame = 1
Query:  430 KENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFI-TLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWS----HERQISN-FKDETNDKAQFEGKPT-------YSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNS-----LISISC----FSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHP------------ITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            +E +  E +KQ ++I  LK +L+++E +AYQ G     P ++++   K I+E+LR +L +NL++ I  LS  +L+  VD A+ +IINP KV+E+LVDQLKTQI DLE FI++LQD+  +      RQ +     +    A   G PT         AEK+++   +   ++++AL +LQL A SQFGC            +   S        +  +  +LE  + +V   + Q       +   S  D+ F D          D+  +       +RKD +  L  L+ HG+     S S     L  I+C    FS         +    HPW I   +Y+TK GR  + SP  KLS+SF L  I G              ++ K  LL AI  +L  H  +KRS D++FKA VC  LNE++L  WL ++ K   ++ + Y+ WSY  + GF+  L  L RLS + FDL  D+S+RQL  I DA
Sbjct:    7 QERLDAERQKQQELIVQLKAQLDDVERFAYQEGSSDSVPQAELMERHKVIVEELRQKLGMNLQDDIGVLSTEELRERVDAAVAQIINPAKVKEQLVDQLKTQIRDLEMFIDFLQDEVGAPLQPGIRQCTCPVHGQPKAGAMGAGVPTAHPALRHVDAEKARQMRASGLHILKRALTMLQLFAVSQFGCG-------AAQVAGAWSTEPSDQQDYSPLLGRLEAAVSKVRRLALQRFPDGCSAGSGSDSDVFFEDAAAARGGSGADDVTV------AVRKDLAPALRDLLSHGLQPPLRSASGGSLVLAPIACLLPAFSPVRSSRGSAAAPGIHPWLIFKEYYDTKNGRAYMESPARKLSESFGL-RIDGETGGAGGAGGRARGVSAKHGLLVAIHEVLSDHDRFKRSADSEFKALVCRGLNEQRLVSWLNLVCKAGTLVEAHYQAWSYMARTGFEGALTILGRLSDLQFDLAADLSVRQLKNINDA 478          
BLAST of RUN domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001233.1 (pep scaffold:Pmarinus_7.0:GL481795:15568:20027:1 gene:ENSPMAG00000001103.1 transcript:ENSPMAT00000001233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.642 bits (322), Expect = 7.317e-32
Identity = 88/278 (31.65%), Postives = 128/278 (46.04%), Query Frame = 1
Query: 1015 VSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNS-----LISISC----FSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHP------------ITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            +S   +  +  +LE  + +V   + Q       +   S  D+ F D          D+  +       +RKD +  L  L+ HG+     S S     L  I+C    FS         +    HPW I   +Y+TK GR  + SP  KLS+SF L  I G              ++ K  LL AI  +L  H  +KRS D++FKA VC  LNE++L  WL ++ K   ++ + Y+ WSY  + GF+  L  L RLS + FDL  D+S+RQL  I DA
Sbjct:  237 LSPQDYSPLLGRLEAAVSKVRRLALQRFPDGCSAGSGSDSDVFFEDAAAARGGSGADDVTV------AVRKDLAPALRDLLSHGLQPPLRSASGGSLVLAPIACLLPAFSPVRSSRGSAAAPGIHPWLIFKEYYDTKNGRAYMESPARKLSESFGL-RIDGETGGAGGAGGRARGVSAKHGLLVAIHEVLSDHDRFKRSADSEFKALVCRGLNEQRLVSWLNLVCKAGTLVEAHYQAWSYMARTGFEGALTILGRLSDLQFDLAADLSVRQLKNINDA 507          

HSP 2 Score: 88.1965 bits (217), Expect = 1.055e-18
Identity = 45/93 (48.39%), Postives = 65/93 (69.89%), Query Frame = 1
Query:  511 YAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFI-TLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDN-WS 783
            +AYQ G     P ++++   K I+E+LR +L +NL++ I  LS  +L+  VD A+ +IINP KV+E+LVDQLKTQI DLE FI++LQ +  WS
Sbjct:   25 FAYQEGSSDSVPQAELMERHKVIVEELRQKLGMNLQDDIGVLSTEELRERVDAAVAQIINPAKVKEQLVDQLKTQIRDLEMFIDFLQGERAWS 117          
BLAST of RUN domain-containing protein vs. Ensembl Nematostella
Match: EDO47845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKZ4])

HSP 1 Score: 192.586 bits (488), Expect = 1.569e-55
Identity = 126/392 (32.14%), Postives = 203/392 (51.79%), Query Frame = 1
Query:  637 ENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDD-NWSHERQISNFKDETNDK----AQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQ--QRDSNYSSSEDLAFLDT-EYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSN-HPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            E D++  VD A+   +NP K +E++V QL  QI+DLERF+++LQ + N    +   +F+          ++ E +P    EK K+  + +  +IR+AL +LQ+ A SQFGC     +  +     +     V+   + D+ A+L+  +++V      LKY   Q + ++S        D+  Y  D E          L+  +RKD S  L +L+ HG+     ++ +IS        +P T+ S     H W++   +Y  K GRE  ++P  +LS++F +   G   +T KQ LLR +  I  TH   +RS DA FK+ VC  LN+KKL  W +I+++   ++   Y+ WSY VK G  + + SL RL   +F LP D++IR L+KI DA
Sbjct:    2 EEDVRRNVDAALGNALNPEKTKEQIVKQLTNQIMDLERFVQFLQGEVNDDQPKTEKHFQYPCTQYPFQVSEMEKRPPTHKEKYKRIRDASVAIIRRALAILQIFAISQFGCTGKQIQDQI-----IQKATNVAIPGYFDLLAKLQSAVDKVAS----LKYALDQMEGDFSEPCCPCSPDSFNYARDGE----------LVNAVRKDLSMALKELLSHGLVRV--NSRIISSKSLVACIVPTTRTSLPKKMHVWELFNEYYNLKHGREYNSTPASRLSEAFGIQVDGSSAVTGKQTLLRTLHRIKSTHEPCRRSMDAMFKSLVCSGLNQKKLVQWCRIVMRTSCLVEEHYQSWSYVVKTGMSEAMGSLDRLQPFDFYLPEDLAIRHLTKINDA 372          
BLAST of RUN domain-containing protein vs. Ensembl Nematostella
Match: EDO35021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP1])

HSP 1 Score: 57.7658 bits (138), Expect = 9.903e-9
Identity = 50/196 (25.51%), Postives = 82/196 (41.84%), Query Frame = 1
Query: 1216 VIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI------INSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            ++R      L  + EHGM       S++   C                HPW     F E    RE+      + S +  L  +F LD   G  ++ ++ L RA+  I  +H A     D +F++ VC+ LNE+ L  WL+ +      +  +Y PWS+    G+      LR L+   F+L  +  +   SK+ +A
Sbjct:  540 LVRGGLCPALKNIFEHGM----RRPSILGGPC----------------HPW----LFIEEASQREVERDFQSVYSRLV-LCKTFRLDE-DGKVLSPEEILYRAVQSINMSHDAASAQMDVKFRSLVCYGLNEQCLHLWLESLCACEDTVAKWYHPWSFLRSPGWIQIKCELRVLATFAFNLNVEWELVHTSKVVEA 709          
BLAST of RUN domain-containing protein vs. Ensembl Medaka
Match: si:dkey-151m15.5 (RUN domain containing 1 [Source:NCBI gene;Acc:101167539])

HSP 1 Score: 285.034 bits (728), Expect = 8.027e-88
Identity = 214/574 (37.28%), Postives = 305/574 (53.14%), Query Frame = 1
Query:  133 RMAPLGATASPEPDFNEMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXML--TSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIKND----------KSKENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINL-ENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNW------SHERQISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLI--SISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPIT--KKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            R AP+GA ASPE +                ++  +  + E EQ   +  +L  TSHFAQ+Q RLKQIV  +S   E  L ELEEFAF+G P V   K+D          + +E ++ + EKQ  +I  LK +L++LE +AYQ G     P S V+  QK II++L  +LD+NL E+   LS  +L+  VD AI +I+NP +V+E+LV+QLKTQI DLE FI ++QD+          +RQ       TN +A   GK     E++++  E+   LI++AL +LQ+ AASQFGC    + P     S  N D       +G +  +LE   E+V     +         + S E          S      +   R +L   +RK+ +  L  L+ HG+     + SL+   ISC     LP T  SH S HPW++ V +Y +K G+  + SP  +LS SF L  +G  P+T   KQ LL AI  +L  H  YKR  D++FKA VC ALNE++L  WL +I K   +I   Y+PWSY  + GF+  L  L R+S + F+LP D+++RQL  IKDA
Sbjct:   21 RWAPVGAVASPEVESGGSGQPKQGVSAGEGEMAARLRKLEGEQEQLNSSLLALTSHFAQVQFRLKQIVHAQSEEKERMLAELEEFAFRGCPHVVGCKSDAEQLENSTEREKRERLEAQREKQKDLIFQLKTQLDDLERFAYQEGSYDSLPQSVVMERQKVIIDELIKKLDVNLNEDIGNLSPEELRQRVDAAIAQIVNPARVKEQLVEQLKTQIRDLEMFINFIQDEVGNPLLSDGGQRQQPQ---PTNGRAP-GGKKKVDPEQAERMRESGLQLIQRALAVLQIFAASQFGC-ASGRVP----QSMWNQDS--GERDYGPLLQRLEAATEKVRVLGSR--------RHPSVE-------HVVSYTSSTSSLGGRDELTSAVRKELAIALKDLLAHGLFSPSQAVSLVLAPISCL----LPYTPTSH-SIHPWELFVKYYHSKNGKAFVESPARQLSQSFSL-QVGAGPVTVTPKQSLLWAIHTVLKEHGRYKRGPDSEFKALVCMALNEQRLVSWLNLICKAGTLIPPHYQPWSYMAQTGFEGALRILGRISHLRFNLPVDLAVRQLKNIKDA 562          
BLAST of RUN domain-containing protein vs. Ensembl Medaka
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:101173226])

HSP 1 Score: 55.0694 bits (131), Expect = 2.159e-7
Identity = 40/135 (29.63%), Postives = 64/135 (47.41%), Query Frame = 1
Query: 1360 HPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            HPW     F E    RE+    NS   +L    ++ LD   G  +T ++ L RA+  +  +H +     D +F++ +C  LNE+ L  WL+++  +   +  +Y PWS+    G+      LR LSK  F L  D
Sbjct:  595 HPW----LFIEEAASREVERDFNSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNMSHDSAHAQMDVKFRSLICVGLNEQVLHLWLEVLCSSMAAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQD 724          
BLAST of RUN domain-containing protein vs. Ensembl Medaka
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:101173226])

HSP 1 Score: 54.6842 bits (130), Expect = 2.289e-7
Identity = 40/135 (29.63%), Postives = 64/135 (47.41%), Query Frame = 1
Query: 1360 HPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            HPW     F E    RE+    NS   +L    ++ LD   G  +T ++ L RA+  +  +H +     D +F++ +C  LNE+ L  WL+++  +   +  +Y PWS+    G+      LR LSK  F L  D
Sbjct:  589 HPW----LFIEEAASREVERDFNSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNMSHDSAHAQMDVKFRSLICVGLNEQVLHLWLEVLCSSMAAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQD 718          
BLAST of RUN domain-containing protein vs. Ensembl Medaka
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:101173226])

HSP 1 Score: 54.6842 bits (130), Expect = 2.469e-7
Identity = 40/135 (29.63%), Postives = 64/135 (47.41%), Query Frame = 1
Query: 1360 HPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFD 1749
            HPW     F E    RE+    NS   +L    ++ LD   G  +T ++ L RA+  +  +H +     D +F++ +C  LNE+ L  WL+++  +   +  +Y PWS+    G+      LR LSK  F L  D
Sbjct:  589 HPW----LFIEEAASREVERDFNSVYSRLVLCKTYRLDE-DGKVLTPEELLYRAVQSVNMSHDSAHAQMDVKFRSLICVGLNEQVLHLWLEVLCSSMAAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQD 718          
BLAST of RUN domain-containing protein vs. Planmine SMEST
Match: SMESG000080383.1 (SMESG000080383.1)

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 588/590 (99.66%), Postives = 588/590 (99.66%), Query Frame = 1
Query:   16 MTTNEKEFYYIDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATASPEPDFNEMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXMLTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIKNDKSKENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            MTTNEKEFYYIDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATASPEPDFNEMKNFPNF HNNNQDIIIQKLEEEQEQLNSSLIMLTSHFAQIQLRLKQIVDDKSSNMEEKLKELEEFAFKGVPDVWSIKNDKSKENIKLENEKQMKIIEDLKEKLEELESYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNN SFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWLKIILKNRIIINSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA
Sbjct:    1 MTTNEKEFYYIDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATASPEPDFNEMKNFPNFTHNNNQDIIIQKLEEEQEQLNSSLIMLTSHFAQIQLRLKQIVDDKSSNMEEKLKELEEFAFKGVPDVWSIKNDKSKENIKLENEKQMKIIEDLKEKLEELESYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNTSFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWLKIILKNRIIINSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 590          
BLAST of RUN domain-containing protein vs. Planmine SMEST
Match: SMESG000080383.1 (SMESG000080383.1)

HSP 1 Score: 1073.54 bits (2775), Expect = 0.000e+0
Identity = 588/601 (97.84%), Postives = 588/601 (97.84%), Query Frame = 1
Query:   16 MTTNEKEFYYIDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATASPEPDFNEMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXMLTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIKNDKSKENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFK-----------DETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            MTTNEKEFYYIDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATASPEPDFNEMKNFPNF HNNNQDIIIQKLEEEQEQLNSSLIMLTSHFAQIQLRLKQIVDDKSSNMEEKLKELEEFAFKGVPDVWSIKNDKSKENIKLENEKQMKIIEDLKEKLEELESYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFK           DETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNN SFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWLKIILKNRIIINSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA
Sbjct:    1 MTTNEKEFYYIDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATASPEPDFNEMKNFPNFTHNNNQDIIIQKLEEEQEQLNSSLIMLTSHFAQIQLRLKQIVDDKSSNMEEKLKELEEFAFKGVPDVWSIKNDKSKENIKLENEKQMKIIEDLKEKLEELESYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKVFYYSSKSLNQDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNTSFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWLKIILKNRIIINSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 601          
BLAST of RUN domain-containing protein vs. Planmine SMEST
Match: SMESG000080383.1 (SMESG000080383.1)

HSP 1 Score: 1069.69 bits (2765), Expect = 0.000e+0
Identity = 588/608 (96.71%), Postives = 588/608 (96.71%), Query Frame = 1
Query:   16 MTTNEKEFYYIDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATASPEPDFNEMKNFPNFPHNNNXXXXXXXXXXXXXXXXXXXXMLTSHFAQIQLRLKQIVDDKSSNMXXXXXXXXXFAFKGVPDVWSIKNDKSKENIKLENEKQMXXXXXXXXXXXXXXSYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFK------------------DETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 1785
            MTTNEKEFYYIDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATASPEPDFNEMKNFPNF HNNNQDIIIQKLEEEQEQLNSSLIMLTSHFAQIQLRLKQIVDDKSSNMEEKLKELEEFAFKGVPDVWSIKNDKSKENIKLENEKQMKIIEDLKEKLEELESYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFK                  DETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNN SFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWLKIILKNRIIINSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA
Sbjct:    1 MTTNEKEFYYIDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATASPEPDFNEMKNFPNFTHNNNQDIIIQKLEEEQEQLNSSLIMLTSHFAQIQLRLKQIVDDKSSNMEEKLKELEEFAFKGVPDVWSIKNDKSKENIKLENEKQMKIIEDLKEKLEELESYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINLENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYLQDDNWSHERQISNFKVFYYDHFNCKDSSKSLNQDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKALNLLQLIAASQFGCHIHNKKPPVNNTSFVNSDVKVSTMHWGDIRAQLEVVIERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWLKIILKNRIIINSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDA 608          
BLAST of RUN domain-containing protein vs. Planmine SMEST
Match: SMESG000012909.1 (SMESG000012909.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.269e-7
Identity = 51/199 (25.63%), Postives = 86/199 (43.22%), Query Frame = 1
Query: 1195 IRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKI 1776
            + +++  +IR  F   L  + EHGM  + H   L+   C                HPW     F E    RE+    +S   +L    +F LD   G  +T ++ L +AI  +  TH       D + ++ +C  LN++ L  WL+ +  +  ++  +Y PWS+    G+      LR L + +F L  DI ++ L  I
Sbjct:  578 VNEEITDLIRGLFCPALKAIFEHGMK-RAH---LLESKC----------------HPW----LFIEEAASREVEKDFHSVYSRLMLCKTFRLDE-DGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCELRLLCQFSFTLNKDIELQSLLSI 751          
BLAST of RUN domain-containing protein vs. Planmine SMEST
Match: SMESG000012909.1 (SMESG000012909.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.283e-7
Identity = 51/199 (25.63%), Postives = 86/199 (43.22%), Query Frame = 1
Query: 1195 IRKQLIYVIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHPWDIIVYFYETKRGREI---INSPVCKL--SDSFDLDNIGGHPITKKQHLLRAIGIILDTHSAYKRSKDAQFKAFVCFALNEKKLADWXXXXXXXXXXXXSFYEPWSYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKI 1776
            + +++  +IR  F   L  + EHGM  + H   L+   C                HPW     F E    RE+    +S   +L    +F LD   G  +T ++ L +AI  +  TH       D + ++ +C  LN++ L  WL+ +  +  ++  +Y PWS+    G+      LR L + +F L  DI ++ L  I
Sbjct:  573 VNEEITDLIRGLFCPALKAIFEHGMK-RAH---LLESKC----------------HPW----LFIEEAASREVEKDFHSVYSRLMLCKTFRLDE-DGKVLTPEEILFKAIQSVNFTHDNAHAQMDVKLRSLICCGLNDQVLHLWLETLCSSLDVVKKWYHPWSFIRSPGWVQIKCELRLLCQFSFTLNKDIELQSLLSI 746          
The following BLAST results are available for this feature:
BLAST of RUN domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RUNDC15.285e-7934.21RUN domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
SGSM31.650e-826.52small G protein signaling modulator 3 [Source:HGNC... [more]
SGSM35.555e-826.63small G protein signaling modulator 3 [Source:HGNC... [more]
back to top
BLAST of RUN domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rund-11.802e-7033.79RUN Domain containing protein; RUND-1 [Source:Uni... [more]
back to top
BLAST of RUN domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG37031.832e-6029.06gene:FBgn0040348 transcript:FBtr0070187[more]
back to top
BLAST of RUN domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RUNDC14.053e-8435.86si:dkey-151m15.5 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
sgsm31.363e-728.26small G protein signaling modulator 3 [Source:NCBI... [more]
sgsm39.434e-728.26small G protein signaling modulator 3 [Source:NCBI... [more]
back to top
BLAST of RUN domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rundc13.542e-8434.95RUN domain containing 1 [Source:NCBI gene;Acc:1004... [more]
mak3.279e-624.71male germ cell associated kinase [Source:Xenbase;A... [more]
mak3.279e-624.71male germ cell associated kinase [Source:Xenbase;A... [more]
mak3.416e-624.71male germ cell associated kinase [Source:Xenbase;A... [more]
back to top
BLAST of RUN domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rundc11.233e-7634.32RUN domain containing 1 [Source:MGI Symbol;Acc:MGI... [more]
Sgsm37.655e-826.23small G protein signaling modulator 3 [Source:MGI ... [more]
Sgsm39.184e-728.47small G protein signaling modulator 3 [Source:MGI ... [more]
back to top
BLAST of RUN domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96C34|RUND1_HUMAN2.538e-7834.21RUN domain-containing protein 1 OS=Homo sapiens OX... [more]
sp|Q0VDN7|RUND1_MOUSE8.623e-7634.32RUN domain-containing protein 1 OS=Mus musculus OX... [more]
sp|Q96HU1|SGSM3_HUMAN2.668e-726.63Small G protein signaling modulator 3 OS=Homo sapi... [more]
sp|Q2KI13|SGSM3_BOVIN4.095e-726.23Small G protein signaling modulator 3 OS=Bos tauru... [more]
sp|Q8VCZ6|SGSM3_MOUSE5.355e-726.23Small G protein signaling modulator 3 OS=Mus muscu... [more]
back to top
BLAST of RUN domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433TVE94.512e-11643.18RUN domain-containing protein OS=Elysia chlorotica... [more]
A0A2C9K3H62.879e-11441.78RUN domain-containing protein OS=Biomphalaria glab... [more]
A0A210QS982.282e-11341.83RUN domain-containing protein 1 OS=Mizuhopecten ye... [more]
K1QI929.007e-11040.13RUN domain-containing protein 1 OS=Crassostrea gig... [more]
V4AKN66.993e-10539.96RUN domain-containing protein (Fragment) OS=Lottia... [more]
back to top
BLAST of RUN domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-151m15.51.001e-7535.42RUN domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
sgsm31.534e-728.99small G protein signaling modulator 3 [Source:NCBI... [more]
sgsm31.764e-728.99small G protein signaling modulator 3 [Source:NCBI... [more]
back to top
BLAST of RUN domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001231.17.646e-6833.47pep scaffold:Pmarinus_7.0:GL481795:15544:20027:1 g... [more]
ENSPMAT00000001230.14.721e-6733.13pep scaffold:Pmarinus_7.0:GL481795:15541:20027:1 g... [more]
ENSPMAT00000001233.17.317e-3231.65pep scaffold:Pmarinus_7.0:GL481795:15568:20027:1 g... [more]
back to top
BLAST of RUN domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO478451.569e-5532.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350219.903e-925.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RUN domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:dkey-151m15.58.027e-8837.28RUN domain containing 1 [Source:NCBI gene;Acc:1011... [more]
sgsm32.159e-729.63small G protein signaling modulator 3 [Source:NCBI... [more]
sgsm32.289e-729.63small G protein signaling modulator 3 [Source:NCBI... [more]
sgsm32.469e-729.63small G protein signaling modulator 3 [Source:NCBI... [more]
back to top
BLAST of RUN domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080383.10.000e+099.66SMESG000080383.1[more]
SMESG000080383.10.000e+097.84SMESG000080383.1[more]
SMESG000080383.10.000e+096.71SMESG000080383.1[more]
SMESG000012909.12.269e-725.63SMESG000012909.1[more]
SMESG000012909.12.283e-725.63SMESG000012909.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027021 ID=SMED30027021|Name=RUN domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1897bp
TACAAATAGTGCGAAATGACAACGAATGAAAAAGAATTTTATTATATTGA
CAATAGTATACCCAAATATATCGAAAGATTTGATAAAAGTATAAATGACA
GTGATTCAACCGAAGAAGAAAGACCTAGTGTAAGAATGGCTCCATTAGGT
GCTACAGCAAGTCCTGAACCAGATTTCAATGAAATGAAAAATTTTCCAAA
TTTTCCTCATAATAACAATCAAGATATAATTATTCAAAAATTAGAAGAAG
AACAGGAACAATTAAATTCTTCTTTAATTATGTTAACTAGTCATTTTGCA
CAAATTCAACTTAGACTAAAACAAATTGTTGACGATAAGTCATCTAATAT
GGAAGAGAAACTTAAAGAATTGGAAGAATTCGCTTTTAAAGGAGTGCCAG
ATGTCTGGTCAATTAAAAATGATAAATCTAAAGAAAATATAAAATTAGAA
AATGAAAAACAAATGAAAATAATTGAAGATCTAAAAGAAAAGCTTGAGGA
ATTAGAATCCTATGCATATCAAACTGGTGAGGTTAAGGAGCCTCCTACCA
GCAAAGTTTTAGCCAGTCAAAAATTTATCATCGAACAACTTCGATCACAA
TTAGATATAAATCTGGAAAATTTTATTACTCTTAGTGAAAATGATTTGAA
AAACGCTGTAGACAATGCAATAAACGAGATAATAAATCCTGTCAAAGTCC
GTGAAAAATTAGTTGACCAGCTAAAAACACAGATTCTTGATTTGGAGAGA
TTCATAGAATATTTGCAAGATGATAATTGGTCTCATGAACGACAAATATC
TAATTTTAAGGATGAAACTAATGACAAAGCGCAATTTGAAGGAAAGCCCA
CCTATAGCGCCGAGAAGTCTAAAAAAACTAGTGAAACGGCAACATTTCTA
ATTCGTAAAGCGCTAAATCTTCTCCAGTTGATAGCCGCATCACAGTTCGG
CTGTCACATTCACAATAAAAAACCCCCAGTTAACAATGCATCATTTGTCA
ATTCAGATGTCAAAGTATCTACAATGCACTGGGGCGATATCAGAGCTCAA
CTCGAAGTAGTTATCGAAAGAGTGATTGAATTTTCAGATCAATTAAAATA
CCAACAAAGAGATTCAAATTACTCTAGTTCAGAAGATCTAGCGTTTTTGG
ACACAGAATACAATTCAGACAATGAAAAATTTGACAATTTCGAAATAAGA
AAACAACTAATTTATGTAATCCGAAAAGATTTTTCAACGCGGTTGATGCA
ACTTATAGAGCATGGAATGTCTGACAAATGTCACTCTAATTCTCTCATTT
CAATTTCTTGTTTCTCAGGCAGATCCTTACCCGAAACGAAAGATTCTCAC
ACTTCAAACCATCCGTGGGATATTATTGTTTATTTTTATGAAACAAAGAG
AGGTCGAGAGATAATTAATTCTCCTGTCTGTAAATTGTCAGATAGTTTTG
ATTTGGATAATATCGGGGGTCATCCGATCACCAAAAAACAGCATTTATTA
AGGGCAATAGGAATTATTTTAGATACACACTCAGCATATAAAAGAAGTAA
AGACGCTCAATTTAAAGCATTCGTTTGTTTTGCTTTAAATGAAAAGAAAT
TAGCAGATTGGTTAAAGATTATTTTGAAAAACAGAATTATTATAAATTCA
TTTTACGAGCCGTGGAGTTACACAGTCAAAATGGGATTCGATGATACTCT
GCACTCACTGCGAAGGCTTTCTAAAATCAATTTCGATTTACCATTTGATA
TTTCCATTCGTCAGTTATCAAAAATAAAAGATGCATTTTAATTTATTTTT
TATTTTTTCCCGAAAAAAATGTACTTTTTTATGGAACAAAGGTTCATTTA
TTGTAATTGTTCTATATCTTTTGTGGGTGTCATCATGTTCTTGTAAG
back to top

protein sequence of SMED30027021-orf-1

>SMED30027021-orf-1 ID=SMED30027021-orf-1|Name=SMED30027021-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=592bp
MTTNEKEFYYIDNSIPKYIERFDKSINDSDSTEEERPSVRMAPLGATASP
EPDFNEMKNFPNFPHNNNQDIIIQKLEEEQEQLNSSLIMLTSHFAQIQLR
LKQIVDDKSSNMEEKLKELEEFAFKGVPDVWSIKNDKSKENIKLENEKQM
KIIEDLKEKLEELESYAYQTGEVKEPPTSKVLASQKFIIEQLRSQLDINL
ENFITLSENDLKNAVDNAINEIINPVKVREKLVDQLKTQILDLERFIEYL
QDDNWSHERQISNFKDETNDKAQFEGKPTYSAEKSKKTSETATFLIRKAL
NLLQLIAASQFGCHIHNKKPPVNNASFVNSDVKVSTMHWGDIRAQLEVVI
ERVIEFSDQLKYQQRDSNYSSSEDLAFLDTEYNSDNEKFDNFEIRKQLIY
VIRKDFSTRLMQLIEHGMSDKCHSNSLISISCFSGRSLPETKDSHTSNHP
WDIIVYFYETKRGREIINSPVCKLSDSFDLDNIGGHPITKKQHLLRAIGI
ILDTHSAYKRSKDAQFKAFVCFALNEKKLADWLKIILKNRIIINSFYEPW
SYTVKMGFDDTLHSLRRLSKINFDLPFDISIRQLSKIKDAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037213Run_dom_sf
IPR004012Run_dom
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0031338regulation of vesicle fusion
GO:0090630activation of GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0012505endomembrane system
GO:0005622intracellular
Vocabulary: molecular function
TermDefinition
GO:0017137Rab GTPase binding
GO:0005096GTPase activator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 139..166
NoneNo IPR availableCOILSCoilCoilcoord: 66..93
NoneNo IPR availablePANTHERPTHR22957TBC1 DOMAIN FAMILY MEMBER GTPASE-ACTIVATING PROTEINcoord: 65..584
NoneNo IPR availablePANTHERPTHR22957:SF2RUN DOMAIN-CONTAINING PROTEIN 1coord: 65..584
IPR004012RUN domainSMARTSM00593893paper3coord: 516..578
e-value: 4.0E-11
score: 52.9
IPR004012RUN domainPFAMPF02759RUNcoord: 410..578
e-value: 5.8E-26
score: 91.1
IPR004012RUN domainPROSITEPS50826RUNcoord: 397..580
score: 21.924
IPR037213RUN domain superfamilyGENE3DG3DSA:1.20.58.900coord: 344..587
e-value: 7.9E-28
score: 99.1
IPR037213RUN domain superfamilySUPERFAMILYSSF140741RUN domain-likecoord: 505..578