slc24a-7

Overview
Nameslc24a-7 (AKN21567.1)
Smed IDSMED30027012
Length (bp)2659
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc24a-7 (SMED30027012) t-SNE clustered cells

Violin plots show distribution of expression levels for slc24a-7 (SMED30027012) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc24a-7 (SMED30027012) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc24a-7 (SMED30027012) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027012

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
collecting ductSMED30027012 Smed-slc24a-7smed_ncbi_20240424PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc24a-7 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 154.451 bits (389), Expect = 5.642e-39
Identity = 95/271 (35.06%), Postives = 148/271 (54.61%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2568
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y          +  + +I G  +  V  F +   +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+   ++       V+L    +   VL   + L    +L+ +PL  FQ  R YG  L+  Y+ + V+ +L    +I +
Sbjct:  255 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHL 525          

HSP 2 Score: 79.7221 bits (195), Expect = 8.388e-15
Identity = 45/125 (36.00%), Postives = 70/125 (56.00%), Query Frame = 1
Query:   43 KFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMFL-WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNV-GLAFGAILG 408
            K    N S+ CD+I     C  + G ++Y +  +C F     P  + +++ W L+L   +  +A  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA GA+ G
Sbjct:   55 KVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFG 176          
BLAST of slc24a-7 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 152.525 bits (384), Expect = 5.187e-38
Identity = 95/272 (34.93%), Postives = 151/272 (55.51%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2568
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y   +     + V++ +++       V F +  D +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+   ++       V+L    +   VL   + L    +L+ +PL  FQ  R YG  L+  Y+ + V+ +L    +I +
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGV-YEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHL 581          

HSP 2 Score: 134.035 bits (336), Expect = 5.018e-32
Identity = 71/206 (34.47%), Postives = 115/206 (55.83%), Query Frame = 1
Query:   43 KFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMFL-WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPN-VGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKS 651
            K    N S+ CD+I     C  + G ++Y +  +C F     P  + +++ W L+L   +  +A  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA GA+ GAGV V  + AG I IL PF    RP  +D++FY VA+    ++  + ++ L  +L +L +YV Y++  ++   +Y R  + 
Sbjct:   55 KVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRG 257          
BLAST of slc24a-7 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 152.525 bits (384), Expect = 5.187e-38
Identity = 95/272 (34.93%), Postives = 151/272 (55.51%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2568
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y   +     + V++ +++       V F +  D +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+   ++       V+L    +   VL   + L    +L+ +PL  FQ  R YG  L+  Y+ + V+ +L    +I +
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGV-YEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHL 581          

HSP 2 Score: 134.035 bits (336), Expect = 5.018e-32
Identity = 71/206 (34.47%), Postives = 115/206 (55.83%), Query Frame = 1
Query:   43 KFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMFL-WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPN-VGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKS 651
            K    N S+ CD+I     C  + G ++Y +  +C F     P  + +++ W L+L   +  +A  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA GA+ GAGV V  + AG I IL PF    RP  +D++FY VA+    ++  + ++ L  +L +L +YV Y++  ++   +Y R  + 
Sbjct:   55 KVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRG 257          
BLAST of slc24a-7 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 139.813 bits (351), Expect = 4.890e-35
Identity = 77/196 (39.29%), Postives = 118/196 (60.20%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2349
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y   +     + V++ +++       V F +  D +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  181 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGV-YEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 375          

HSP 2 Score: 105.531 bits (262), Expect = 2.073e-23
Identity = 52/129 (40.31%), Postives = 80/129 (62.02%), Query Frame = 1
Query:  268 TMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPN-VGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKS 651
            T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA GA+ GAGV V  + AG I IL PF    RP  +D++FY VA+    ++  + ++ L  +L +L +YV Y++  ++   +Y R  + 
Sbjct:    2 TLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRG 127          
BLAST of slc24a-7 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 118.627 bits (296), Expect = 2.098e-29
Identity = 65/179 (36.31%), Postives = 101/179 (56.42%), Query Frame = 1
Query:   43 KFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMFL-WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPN-VGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIEL-WS 567
            K    N S+ CD+I     C  + G ++Y +  +C F     P  + +++ W L+L   +  +A  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA GA+ GAGV V  + AG I IL PF    RP  +D++FY VA+    ++  + ++ L W+
Sbjct:   55 KVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWA 230          
BLAST of slc24a-7 vs. Ensembl Celegans
Match: ncx-7 (Putative sodium/calcium exchanger 7 [Source:UniProtKB/Swiss-Prot;Acc:P34322])

HSP 1 Score: 155.606 bits (392), Expect = 3.696e-39
Identity = 89/258 (34.50%), Postives = 150/258 (58.14%), Query Frame = 1
Query: 1777 DLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVY-NTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGP-IPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2544
            + E+W E + FSK ++ I      +  LTIP+ + +     W K L  +H      F +     +  TPF  S  L VY   +   +  +++ FT    +P  Y+  +++ G I SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++ K  YPR+  +A +GGPLFNLL+G G+PF+I    G  I + +  T  +LI  + +     L+ +P+ KF+ +R +  +LI+IY+ + V VIL
Sbjct:  411 EAEDWEEMNIFSKVMAYINVVPNLLFKLTIPLNEMS-----WSKPLTLLHAFTCPAFLLFSIQFFLETPFSGSPGLWVYGLAVSIVLAILIMVFTELSVQPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQGKYISMTINPTYRLLILFLAISLLATLIGIPVQKFRLQRPHAAVLISIYIAFIVFVIL 663          

HSP 2 Score: 121.324 bits (303), Expect = 4.197e-28
Identity = 63/203 (31.03%), Postives = 112/203 (55.17%), Query Frame = 1
Query:   52 SFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFG--NRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFI-KKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKS 651
            ++     CDY+          G + + Q+  CA    +R    I+  ++ L L   ++++AD F +P +  +   +R+SE++AGVT +A GNGA DVF S+++V S+  P   LA G + G G+FV  +    I++ SPF +     ++DLLFY VAL +    F+   ++ LW  L FL +Y++Y++  + ++ ++ R  K+
Sbjct:   49 TWTQEQVCDYVNCNDNACEGGGYLLWTQYVECASSTFSRVILIIVGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGELFGGGLFVTTMVVSTIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLWMPLTFLGLYLLYVITVIGAQAVHNRKRKA 251          
BLAST of slc24a-7 vs. Ensembl Celegans
Match: ncx-6 (Putative sodium/calcium exchanger 6 [Source:UniProtKB/Swiss-Prot;Acc:P34315])

HSP 1 Score: 145.976 bits (367), Expect = 3.001e-36
Identity = 96/309 (31.07%), Postives = 170/309 (55.02%), Query Frame = 1
Query: 1645 EGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPV-DLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN-TPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGP-IPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2562
             G++ +H     + +  IE  E   +  +F G    F   + P   ++EW E + F K ++++ +   F+  LTIP  ++      W K +  + CL+  VF +    V + +PF  S  L +Y  I+   +   V+ FT    +PP Y+   ++ G + SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++AK  YPR+  +A +GG LFNLL+G G+PF+I    G  I + +  T  +L+  + +     L+ +   K+  +R +   L+ IY+ +FV + L   DI+
Sbjct:  285 HGHHVLHAHEVMKMEAEIEAVEPLKTW-SFRGVVHDFKEHLKPWPSMDEWDEMNIFQKVIAVLNTIPNFLFKLTIPHSEQP-----WSKPITLLQCLICPVFLLFCIQVCSISPFPNSPGLWMYGLILSVLLTAAVLFFTELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTIAKIQGKSISMIINPTYRLLMLFLAISLIFTLIAMFAQKYFLRRIHSYSLVFIYISFFVFIGLSLDDIL 587          

HSP 2 Score: 117.087 bits (292), Expect = 6.283e-27
Identity = 61/207 (29.47%), Postives = 114/207 (55.07%), Query Frame = 1
Query:   49 SSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFL------WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFI-KKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            + +N +  C+Y+          G + + ++  CA     +P + + L      + L L   ++++AD F +P +  +   +R+SE++AGVT +A GNGA DVF ++++V S+  P   LA G + GAG+FV  +   + +   PFK      ++D+ FY VAL +    F+    +E+W  + FL +Y+IY+   ++S++L+ R++K
Sbjct:   57 AGWNSTQVCEYVKCNDDNCEGGGYVLWTRYVECAS----SPAVRIILIITGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSSPTPKADLALGELFGAGLFVTTMVLAVTIFTRPFKAEVFSSIRDIAFYLVALAFLAFCFVYYDHVEIWMPITFLGVYLIYVCTVILSQILHNRHKK 259          
BLAST of slc24a-7 vs. Ensembl Celegans
Match: ncx-9 (Mitochondrial sodium/calcium exchanger protein [Source:UniProtKB/Swiss-Prot;Acc:O16242])

HSP 1 Score: 131.724 bits (330), Expect = 2.434e-31
Identity = 78/258 (30.23%), Postives = 144/258 (55.81%), Query Frame = 1
Query: 1783 EEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN-TPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG---PIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2544
            +E+ E + F K +++I+   +F   LT+P  + +     WCK L  +HC  S+ F +    +    PF  S  L +Y       +  V + F     +   Y+  ++++G + SI WIY  +NEIV+++++ GVV  +S  +LGL+++A++N  GD+V+++ + K  YP++  +A +GGPLFNLL+G G+PF+I    G    + +      ++L   I LVT    + L + +F  +R + ++LI I+V++ + + L
Sbjct:  442 DEFSEMNIFIKIVTVIKVVPVFFFKLTVPSNEMS-----WCKPLFILHCFASIQFALFSIQIITLKPFDGSPGLWLYGLGFSAILAMVAMYFLPLSKEQKYYKEIYSYLGFLMSIAWIYATSNEIVSVVTMIGVVTGLSMELLGLTIMAWSNCIGDIVADIAVVKQGYPKMAMAAAIGGPLFNLLIGFGLPFTIAAAQGKEMELLINPVYRLLMLFLGISLVT--TFVALFIQRFTVRRPHAVLLIFIFVVFLIFICL 692          

HSP 2 Score: 111.694 bits (278), Expect = 4.926e-25
Identity = 71/209 (33.97%), Postives = 109/209 (52.15%), Query Frame = 1
Query:    4 FDYKRCMAA-CTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAF--GNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIK-KQIELWSSLVFLAIYVIYILVTVI 618
            FD + C +  C   K  S+     C+YI   +      G + +  +  C +  G R    IL  L+ + L   +++ AD F  P +  +   +RMSE++AGVT LA GNGA DVFSS+S+V +   P   LA G + G  +FV  +   II+    FK+   P L+DL+FY   L + +  F+K  +IE+W    FL IY +Y++  +I
Sbjct:   47 FDEEMCSSEECLIDK--SWTSEEKCEYIKCNQDSCEGGGYLTWSHYVKCQYNIGVRVILIILGILYLIILFVIMSSIADDFFCPAISGIVSHLRMSESIAGVTFLAFGNGAPDVFSSISSVLTTPKPKADLALGDLFGTSIFVTTVVLAIIIFTKSFKVAIIPTLRDLIFYMTTLAFIVFCFLKFDKIEVWMPATFLGIYGVYVVTVII 253          
BLAST of slc24a-7 vs. Ensembl Celegans
Match: ncx-10 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q965R5])

HSP 1 Score: 123.25 bits (308), Expect = 4.436e-29
Identity = 77/274 (28.10%), Postives = 148/274 (54.01%), Query Frame = 1
Query: 1783 EEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNV-YNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLF-----------------NLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTAL--NLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2544
            +E+ E + FS+F++++     F L LTIP  +       W K +  IHC  S+   +    +   +PF  S  L +Y  +I   +  + + FT    +   Y+  ++++G + SI WIY I++EI+N++++ GV   +S  ILGL+++A++N  GD+VS+V + K  +P++  +A +GGPLF                 +LL+G G+PF+I    G   + L  T +  +  + L  +L  +L+ + + +F+ +  + + L+T++V + + V+L
Sbjct:  275 DEFYEMNYFSRFITVVAVIPTFFLKLTIPSNE-----MPWSKPILIIHCFCSIQLALFAVQISAKSPFHGSPGLWLYGLLISIILSLLALRFTPLDREQKYYREVYSYLGFLMSIAWIYTISSEIINVITMIGVATGVSQEILGLTIMAWSNCIGDIVSDVAVVKQGFPKMAMAAAIGGPLFSKLYSRPCQIKITTYISDLLIGFGLPFTIACLQGK-QIDLIITPVYRLLMLFLAISLFTSLIAIFVQRFKVRWPHAVALLTVFVAFLIFVLL 542          

HSP 2 Score: 92.8189 bits (229), Expect = 3.231e-19
Identity = 50/147 (34.01%), Postives = 88/147 (59.86%), Query Frame = 1
Query:  214 ITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIK-KQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKS 651
            +T  AD F +P +  + + +++SE++AGVT LA GNGA DVF S+++V +   P   LA G I+G G+FV  +    I++   F+I     ++D++F+ +A I+  I F+    +E+W  L FL +Y  Y++  ++ RL   R +++
Sbjct:    1 MTVVADDFFSPSIAGIVRHLKISESIAGVTFLAFGNGAPDVFGSIASVITTPKPKADLAIGDIIGGGIFVTTVVLSAIILTKSFRIAILATIRDIVFFIIADIFLAIWFLTFNHVEIWMPLTFLGLYAAYVVSVILMRLNSKRRKRA 147          
BLAST of slc24a-7 vs. Ensembl Celegans
Match: ncx-8 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:O16241])

HSP 1 Score: 124.405 bits (311), Expect = 5.198e-29
Identity = 73/218 (33.49%), Postives = 111/218 (50.92%), Query Frame = 1
Query:    4 FDYKRCMAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAF--GNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIK-KQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            F  + C A+   L    +     C YI   +      G + +  +  C +  G R    I+  ++ +FL   ++T AD F  P +  +   ++MSE++AGVT LA GNGA DVF S+S+V S   P   LA G + G  +FV  +   II+    FK+   P L+DL+FY + L +    F+K  +IE+W    FL IY +Y+L TVI+  +Y    K
Sbjct:   48 FTAEMCAASECELH-KGWTSEEKCAYIKCNQDSCEGGGYLTWSHYVKCQYNIGARVVLIIVGIIYLIFLFVVMSTIADDFFCPSISGIVTHLKMSESIAGVTFLAFGNGAPDVFGSISSVLSTPKPKAALALGDLFGTSIFVTTVVLAIIIFTKSFKVAIIPTLRDLIFYMITLAFITFCFLKFDKIEVWMPATFLGIYAVYLL-TVIAFSIYRTRRK 263          

HSP 2 Score: 118.242 bits (295), Expect = 4.168e-27
Identity = 66/199 (33.17%), Postives = 116/199 (58.29%), Query Frame = 1
Query: 1783 EEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN-TPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG 2376
            EE+ E + F K + II+    F + +TIP  + +     WCK L  +HC  S+ F +    + N  PF  S  L +Y       I  + + F     +   ++  ++++G + SI WIY  ANEI++++++ GVV  +S  +LGL+V+++++  GD+V+++ + K  YP++  +A +GGPLFNLL+G G+PF+I +  G
Sbjct:  444 EEFSEMNIFVKIIMIIRIIPSFFMKMTIPSNEMS-----WCKPLFLLHCFASIQFALFSIQIINLKPFDGSPGLWLYGLAFSATIALLALCFLPLNKELKYHKEVYSYLGFLMSIAWIYATANEIISVMTMVGVVTGLSQELLGLTVMSWSDCIGDIVADIAVIKQGYPKMAMAAAIGGPLFNLLIGFGLPFTIASAQG 637          
BLAST of slc24a-7 vs. Ensembl Fly
Match: CG5348 (gene:FBgn0034156 transcript:FBtr0305318)

HSP 1 Score: 100.908 bits (250), Expect = 1.179e-21
Identity = 97/415 (23.37%), Postives = 183/415 (44.10%), Query Frame = 1
Query: 1384 QKNL-SPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKV-HPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-----------------LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG---PIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2562
            QK + S R+ +++    +    +A  + D E + E        +      S+S+T          IRY +MR I+  +  +   +     N K+ + +++N+                  G ++ F L + P+  + W++    ++ L +I++P + I TL IP+VD      GW K+LN I+ +++                  ++++ L N     +G S+F+L            V + F ++ D PP Y   F  + L  S+  I+  A EI  +L V G + +I    +G +V AF  + G L +N  +A + YP++ +++ +GG  F ++V       +R+  G      ++  G  I  IF  M +  + LL    + F  +R  G+  I +YV+Y + V L   ++I
Sbjct:  236 QKTIASTRTKMQKLLDEKQTPEIALKLQDLERKLEYYSQDTRVEILEKSSSISIT---------RIRYTTMRMIRNPRVSVNRRY---TRNMKLDYTQSKNQ------------------GIFRDFFLALRPIKCQAWKQAELLNRVLLLIRAPAVVICTLYIPLVDYEMEKHGWNKLLNAINVVVNPALSISIFLSFMHRKGNFLWYISLQN--TLIYGASSFVLT-------VPFAVFILFHARTDVPPSYHWVFTIMNLTGSMFLIFLCATEIDTVLEVIGNILSIDDNYMGATVKAFTGNLGTLFANTAVAIHGYPKMAFASAIGGSFFTIVVTGNTVAYVRSLVGNRSEHHMEEYG-EIAFIFLNMALFTI-LLWSTTLGFFARRSMGLYSIGLYVVYLLFVTLVHEEVI 609          

HSP 2 Score: 70.0922 bits (170), Expect = 5.105e-12
Identity = 45/165 (27.27%), Postives = 88/165 (53.33%), Query Frame = 1
Query:   19 CMAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFG--NRWAPGILMFLWFLF---LLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDL 498
            C AA      ++F +   C+++   + C+ ++ +I Y +   C     N++   I + L+  F   +L  +  + + + +P L  V++ + M+E+LAGVTL+A GN +AD F++L++V  +        F   L + +FV  I+ G+I  +SPFK+     ++D+
Sbjct:   33 CFAA------NNFPFEERCEFVQKAEDCNSSTNVIPYMRLLACDLKCINQFQEMIFIALFVAFCFQILVLLIYTINVYYSPALKAVSRFLHMNEHLAGVTLMAFGNTSADFFANLASVERHVP-----VFANNLSSALFVITISGGLIFYISPFKMNSYETVRDI 186          
BLAST of slc24a-7 vs. Ensembl Fly
Match: CG12376 (gene:FBgn0033323 transcript:FBtr0088706)

HSP 1 Score: 100.908 bits (250), Expect = 1.209e-21
Identity = 78/288 (27.08%), Postives = 131/288 (45.49%), Query Frame = 1
Query: 1738 GPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-----LVFWVLLPNVYNT----PFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQ---LTGTSIVLIFTIMLVTALN-LLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2562
            G +K   + + P++ E+WR+ +   +   + + P + I  + IP+VD      GW K+LNCI  +L+     +    LL +  N+      G      +Y   I   I   +    S+ D PP Y   F  + L  S+  I+  A EI  +L V G +  +    +G +V A   S G L++NV +A + YPR+ Y++ +GGP F +++       ++   G +PV     TG   +  F  + +   + LL    + F  +R  GI  I  Y IY +  IL    +I
Sbjct:  316 GLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAVIICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMYSLPITVPIAVFMF-IQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMGATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLFG-LPVSEANQTGNYGLNAFIFLNLGVFSTLLWSTTLGFFARRSVGIFSIVFYCIYLLFAILIHRKVI 601          

HSP 2 Score: 81.6481 bits (200), Expect = 1.577e-15
Identity = 63/221 (28.51%), Postives = 114/221 (51.58%), Query Frame = 1
Query:    7 DYKRCMAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFG--NRWAPGILMFLWFLF---LLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFY-FVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKS 651
            D   C AA      ++F +   C ++ + K C+ ++ ++ Y +   C     N +   I + L+      +L  +    + + +P L  V++ + M+E++AGVTLLA GN +AD+FS+L++V    N NV + F   L A +FV+ ++ G+I   SPFK+     ++D+LF  F +++    +     +   S +V   +Y+ YILV V+   L  R  K+
Sbjct:   21 DTVSCYAA------NTFPFEERCAFVASAKDCNRSTNVLPYMRIMACDLNCVNEFEQVIFLALFMGLCYEILVLLIHVCNKYYSPALKAVSRFLCMNEHVAGVTLLAFGNSSADLFSNLASV----NANVPV-FANSLAAALFVSMVSGGLICYTSPFKMNAYESVRDILFLIFGSMLLQYFLASSAHVPETSFIVMFLVYIFYILVNVVDVYLIRRALKT 230          
BLAST of slc24a-7 vs. Ensembl Fly
Match: CG12376 (gene:FBgn0033323 transcript:FBtr0339335)

HSP 1 Score: 100.138 bits (248), Expect = 1.406e-21
Identity = 78/288 (27.08%), Postives = 131/288 (45.49%), Query Frame = 1
Query: 1738 GPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-----LVFWVLLPNVYNT----PFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQ---LTGTSIVLIFTIMLVTALN-LLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2562
            G +K   + + P++ E+WR+ +   +   + + P + I  + IP+VD      GW K+LNCI  +L+     +    LL +  N+      G      +Y   I   I   +    S+ D PP Y   F  + L  S+  I+  A EI  +L V G +  +    +G +V A   S G L++NV +A + YPR+ Y++ +GGP F +++       ++   G +PV     TG   +  F  + +   + LL    + F  +R  GI  I  Y IY +  IL    +I
Sbjct:  207 GLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAVIICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMYSLPITVPIAVFMF-IQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMGATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLFG-LPVSEANQTGNYGLNAFIFLNLGVFSTLLWSTTLGFFARRSVGIFSIVFYCIYLLFAILIHRKVI 492          

HSP 2 Score: 67.3958 bits (163), Expect = 3.673e-11
Identity = 44/126 (34.92%), Postives = 72/126 (57.14%), Query Frame = 1
Query:  277 MSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFY-FVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKS 651
            M+E++AGVTLLA GN +AD+FS+L++V +N        F   L A +FV+ ++ G+I   SPFK+     ++D+LF  F +++    +     +   S +V   +Y+ YILV V+   L  R  K+
Sbjct:    1 MNEHVAGVTLLAFGNSSADLFSNLASVNANVP-----VFANSLAAALFVSMVSGGLICYTSPFKMNAYESVRDILFLIFGSMLLQYFLASSAHVPETSFIVMFLVYIFYILVNVVDVYLIRRALKT 121          
BLAST of slc24a-7 vs. Ensembl Fly
Match: CG14743 (gene:FBgn0033326 transcript:FBtr0307023)

HSP 1 Score: 98.9821 bits (245), Expect = 4.758e-21
Identity = 87/365 (23.84%), Postives = 178/365 (48.77%), Query Frame = 1
Query: 1483 ERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKV------HPENENE-NKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWV---LLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSI-RTFSGPIPVQLTGTSIVLIFTIMLVTALNLL--CLPLMKFQPKRFYGIILITIYVIYFV 2532
            E +   P++++ +LI +  +  LN   L+ +       EIQ  +S +  +     G +        H E + E N+  + +  N  ++  F      F   I P+D E W      ++ L I+++P   +L L +P+VD      GW K+LNC+  +L+  ++F +   +L + Y   +    F +    +++   + +VV   S+ D PP Y   +  + + T I++ +  A E+  ++S+ GVVF+++   + ++  + + +T DL++   LAK+ Y ++ + A +GG +++L V +GI   + +  +    V L G   V I+  +++T    L  CL    F  +R  G+ + +++V++ V
Sbjct:  237 EVLRQSPSSREHDLILTEKIVRLNN--LQQD------DEIQILESKLYRKRTYNAGFFVTPKPLIHHKEVDVETNRRILHSKANPKNLFLF----SEFLQAINPIDSEGWYLSGTCARILQILKAPVTLMLHLVVPLVDYQLVKHGWSKMLNCLQIVLTPFVIFALVETMLVHKYAEWYYVPQFRMAIWSLLVTMPLAIVVFLHSRTDIPPFYHSSYCALTISTVIIFFWICAWEMDALISIIGVVFDLAPSYMSITFNSVSAATADLIAYAHLAKHGYGKMAFGAIIGGSVYSLAVNVGIELVLQKKLNSRGQVVLYGDDGVTIYIFLVITITTTLWWCLTF-NFVARRSAGLFMWSLFVLFLV 588          

HSP 2 Score: 72.7886 bits (177), Expect = 9.084e-13
Identity = 54/209 (25.84%), Postives = 96/209 (45.93%), Query Frame = 1
Query:   22 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAF--GNRWAPGILMFLW---FLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELW-SSLVFLAIYVIYILVTVISRLL 630
            M   + L    F+Y + C+  T    C   +   NYY   YC+F   N+    ++M L+   + F L  +    +S+ AP L + A  MR++E +AGV L+ + N   D+  +LS V        GL F   +   + +  ++ G +  + PF++    I +DLLF  + +           +  W    + L+IY IY+L+ ++  +L
Sbjct:   21 MQNVSCLAVMHFSYLHRCEMATKIDDCKYITNFFNYYVMMYCSFKIDNKITEIVVMLLFALIYCFFLCILYEGVNSYFAPTLKIAALKMRINEYMAGVVLVGVANSTPDLLVNLSPVRME-----GLTFNIAMANALTIICLSGGAVCFIRPFRMNGHSIFRDLLFLLLIIELVRFFMNDTALAPWIKGAILLSIYPIYLLINIVDLIL 224          
BLAST of slc24a-7 vs. Ensembl Fly
Match: CG14744 (gene:FBgn0033324 transcript:FBtr0307024)

HSP 1 Score: 98.9821 bits (245), Expect = 5.166e-21
Identity = 90/372 (24.19%), Postives = 165/372 (44.35%), Query Frame = 1
Query: 1504 TAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHP--ENENE------NKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL-----PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPF----SIRTFSGPIPVQLT-GTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIK 2565
            T   A + K +S    ++  +K   +Y   R+     S++T+        Y V P  E  +E      N+  +   EN  ++  F      F  ++ PVD E W+     ++   I + P +F+L L IP+VD      GW K+LNC   + +    + L      +VY T   T +F +      L   + +V+   S+ D PP Y   F  +   +S++ ++    E+  +  + G+VFN+S   + ++  A +N+T D+++N  LA   Y R+ ++A +GGP+F +LV + + F     +R       V    G +  L   I +VT   +       F  +R  G+ L  +Y+ + +  +    D++ 
Sbjct:  250 TEINAKIRKLISWEEQDDIGIKDTTKYRRSRDTGNHFSNMTS------SGYFVTPIPERRSEHVDYELNRTALHDSENPKNLQLF----TEFFQSLNPVDAEAWQLGGWSNRIYLIARCPLVFVLQLFIPVVDYEKIKHGWSKLLNCTQIVTNPFVVITLVHSGVSSVYKTWHITLDFSISMWSPCLTVPLAIVIFLHSRTDVPPSYHHLFIILTFFSSMVTLWLAVTELEVLSEIVGIVFNLSESFMAVTFEAVSNATPDIIANYQLALQGYGRMAFAAIIGGPVFAILVSMSLAFIFNHRVREVGANSWVYGDLGDNCYLFLVITIVT--TMWWSVTFDFHARRSAGVFLWLVYLQFLLYAVCVEWDVVH 609          

HSP 2 Score: 56.6102 bits (135), Expect = 8.881e-8
Identity = 50/205 (24.39%), Postives = 97/205 (47.32%), Query Frame = 1
Query:   61 YSNACDYITNFKGCSPNSGLINYYQWQYCAFG-NRWAPGILMFLWFLFLLTG----ITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKK-QIELWSSLVFLAIYVIYILVTVISRLL---YVRNEK 648
            Y+  C   T    C       NY++  YC+   +  A  +L  L F F+       ++ +  ++ +P L +++  + M+E LAGVT LA GN + ++ ++L  V +++       F   +G  + +  ++ G +  L PF++     L+DLLF  + +     + IK+  + L   +V   IYV+Y+ + +    L   Y+R  +
Sbjct:   36 YNYRCRMATQVSDCKRIINFFNYFRMMYCSIDIDDKATEVLFMLLFAFICVAFLWLMSFNIGTYFSPVLKIISLKLHMNEYLAGVTFLAFGNCSPEIIANLMPVRADAP-----IFTITVGNTLAIILLSGGTVCFLRPFRMNGHSTLRDLLFLLLGVEVLRFVMIKEGAVTLGEGIVLFLIYVVYVAINIADLALLRYYIRKLR 235          
BLAST of slc24a-7 vs. Ensembl Zebrafish
Match: slc8b1 (solute carrier family 8 member B1 [Source:ZFIN;Acc:ZDB-GENE-130530-900])

HSP 1 Score: 140.198 bits (352), Expect = 1.464e-36
Identity = 74/197 (37.56%), Postives = 113/197 (57.36%), Query Frame = 1
Query:   64 SNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMF-LWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNV-GLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNE 645
            S  C+Y+ N   C+ + G I Y    +C F     P  I ++ +W LFL   +   A  F  P L  +A T+R++ N+AGVT LALGNGA DVFS+++A    S+P   GLA GA+ GAG+FV  + AG + ++ PF +  RP L+D++FY  A+ W   +  K  I L  S+ +L +Y+ Y+   ++S  +Y R +
Sbjct:   64 SQRCEYVKNTPDCASDEGFIKYPFVTFCLFTPSLLPLAITIYVIWLLFLFLVLGLIASDFFCPNLSAIASTLRLTHNVAGVTFLALGNGAPDVFSAMAAF---SHPQTAGLAIGALFGAGIFVTTVVAGSVALVKPFTVASRPFLRDVIFYMAAVFWTFTVLYKGHISLGESVGYLGMYIAYVFTVILSSYIYNRQK 257          
BLAST of slc24a-7 vs. Ensembl Zebrafish
Match: CABZ01081780.1 (sodium/potassium/calcium exchanger 2-like [Source:NCBI gene;Acc:571043])

HSP 1 Score: 66.2402 bits (160), Expect = 5.757e-11
Identity = 41/146 (28.08%), Postives = 73/146 (50.00%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYIL 606
            +L     L++   +    D F  P L V+ + + +S+++AG T +A G  A ++F+S+  V   S+ NVG+  G I+G+ VF      G+  + S     +   P+ +D+ FY + LI  ++ F+   I    S+  L  Y  Y+L
Sbjct:  105 LLHMFGMLYMFIALAIVCDEFFVPALTVITEKLTISDDVAGATFMAAGGSAPELFTSVIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCALFSKEILNLTWWPLFRDVSFYIIGLIMLIVFFLDNIITYCESISLLLAYAAYVL 247          
BLAST of slc24a-7 vs. Ensembl Zebrafish
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 67.0106 bits (162), Expect = 7.912e-11
Identity = 40/139 (28.78%), Postives = 72/139 (51.80%), Query Frame = 1
Query:  193 FLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYI 603
             +++   +    D F  P L V+   + +S+++AG T +A G  A ++F+SL  V   S+ NVG+  G I+G+ VF      G+  + S     +   P+ +D+ FY + LI  +I F+   I  W S++ +  Y +Y+
Sbjct:  177 MVYMFVSLAIVCDEFFVPTLGVITDKLAISDDVAGATFMAAGGSAPELFTSLIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCALFSREMLHLTWWPLFRDVSFYILDLIMLIIFFLDNTIMWWESMMLVGGYALYV 312          

HSP 2 Score: 51.9878 bits (123), Expect = 3.689e-6
Identity = 42/165 (25.45%), Postives = 81/165 (49.09%), Query Frame = 1
Query: 2077 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTF---SGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2562
            P  + FF  I  + SI+WI   +  +V      G    IS  I+GL++LA   S  DL+++V +A+     +  S+ VG  +F++ +G+ +P+ + +F     P+PV   G     I  + L+    ++ +   K++  +  G  +  +Y ++ VL ++    II
Sbjct:  556 PASKKFFV-ITFLGSIVWIAIFSYLMVWWAHQVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITMGLPVPWLMFSFFHSFAPVPVSSNGL-FCAIVLLFLMLLFVIISIAACKWRMNKVLGFTMFILYFVFLVLSVMLEDRII 718          
BLAST of slc24a-7 vs. Ensembl Zebrafish
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 67.0106 bits (162), Expect = 7.912e-11
Identity = 40/139 (28.78%), Postives = 72/139 (51.80%), Query Frame = 1
Query:  193 FLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYI 603
             +++   +    D F  P L V+   + +S+++AG T +A G  A ++F+SL  V   S+ NVG+  G I+G+ VF      G+  + S     +   P+ +D+ FY + LI  +I F+   I  W S++ +  Y +Y+
Sbjct:  177 MVYMFVSLAIVCDEFFVPTLGVITDKLAISDDVAGATFMAAGGSAPELFTSLIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCALFSREMLHLTWWPLFRDVSFYILDLIMLIIFFLDNTIMWWESMMLVGGYALYV 312          

HSP 2 Score: 51.9878 bits (123), Expect = 3.689e-6
Identity = 42/165 (25.45%), Postives = 81/165 (49.09%), Query Frame = 1
Query: 2077 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTF---SGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2562
            P  + FF  I  + SI+WI   +  +V      G    IS  I+GL++LA   S  DL+++V +A+     +  S+ VG  +F++ +G+ +P+ + +F     P+PV   G     I  + L+    ++ +   K++  +  G  +  +Y ++ VL ++    II
Sbjct:  556 PASKKFFV-ITFLGSIVWIAIFSYLMVWWAHQVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITMGLPVPWLMFSFFHSFAPVPVSSNGL-FCAIVLLFLMLLFVIISIAACKWRMNKVLGFTMFILYFVFLVLSVMLEDRII 718          
BLAST of slc24a-7 vs. Ensembl Zebrafish
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 66.6254 bits (161), Expect = 9.406e-11
Identity = 40/138 (28.99%), Postives = 72/138 (52.17%), Query Frame = 1
Query:  196 LFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYI 603
            +++   +    D F  P L V+   + +S+++AG T +A G  A ++F+SL  V   S+ NVG+  G I+G+ VF      G+  + S     +   P+ +D+ FY + LI  +I F+   I  W S++ +  Y +Y+
Sbjct:  178 VYMFVSLAIVCDEFFVPTLGVITDKLAISDDVAGATFMAAGGSAPELFTSLIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCALFSREMLHLTWWPLFRDVSFYILDLIMLIIFFLDNTIMWWESMMLVGGYALYV 312          

HSP 2 Score: 51.6026 bits (122), Expect = 4.094e-6
Identity = 42/165 (25.45%), Postives = 81/165 (49.09%), Query Frame = 1
Query: 2077 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTF---SGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2562
            P  + FF  I  + SI+WI   +  +V      G    IS  I+GL++LA   S  DL+++V +A+     +  S+ VG  +F++ +G+ +P+ + +F     P+PV   G     I  + L+    ++ +   K++  +  G  +  +Y ++ VL ++    II
Sbjct:  528 PASKKFFV-ITFLGSIVWIAIFSYLMVWWAHQVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITMGLPVPWLMFSFFHSFAPVPVSSNGL-FCAIVLLFLMLLFVIISIAACKWRMNKVLGFTMFILYFVFLVLSVMLEDRII 690          
BLAST of slc24a-7 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 158.303 bits (399), Expect = 3.983e-40
Identity = 103/340 (30.29%), Postives = 177/340 (52.06%), Query Frame = 1
Query: 1582 YWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTF----PGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2574
            Y  MR+ Q+    IT E D+L        E+E++        E GD            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+   ++       +QL    +   +L   + +    +L+ +P   F  +R YG+ L  IY ++  + +L    II++ +
Sbjct:  241 YRRMRQ-QQLAVPITEEPDLLG-------ESEDDCVSTPHGSEYGDEYQPLLPLQRSTWQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVFLTVALLTEFGIIRLEM 572          

HSP 2 Score: 117.472 bits (293), Expect = 1.140e-26
Identity = 74/194 (38.14%), Postives = 112/194 (57.73%), Query Frame = 1
Query:   73 CDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMF-LWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            C++      CS   G INY    +C+F     P  I ++ LW L+L   +  +A+ F  P L  +++ +R+S N+AGVT LA GNGA DVFS+++A + +     GLA GA+ GAGVFV  + AG I I+ PF    RP L+D++FY  A+     I  +  + L  +LV+L +Y++Y+ V VIS  +Y R  +
Sbjct:   55 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAFSDSRT--AGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTWIYRRMRQ 246          
BLAST of slc24a-7 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 155.992 bits (393), Expect = 2.961e-39
Identity = 103/340 (30.29%), Postives = 177/340 (52.06%), Query Frame = 1
Query: 1582 YWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTF----PGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2574
            Y  MR+ Q+    IT E D+L        E+E++        E GD            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+   ++       +QL    +   +L   + +    +L+ +P   F  +R YG+ L  IY ++  + +L    II++ +
Sbjct:  244 YRRMRQ-QQLAVPITEEPDLLG-------ESEDDCVSTPHGSEYGDEYQPLLPLQRSTWQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVFLTVALLTEFGIIRLEM 575          

HSP 2 Score: 104.76 bits (260), Expect = 1.276e-22
Identity = 60/165 (36.36%), Postives = 88/165 (53.33%), Query Frame = 1
Query:   73 CDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMF-LWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIEL 561
            C++      CS   G INY    +C+F     P  I ++ LW L+L   +  +A+ F  P L  ++    ++  L GVT LA GNGA DVFS+++A + +     GLA GA+ GAGVFV  + AG I I+ PF    RP L+D++FY  A+     I  +  + L
Sbjct:   58 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAFSDSRT--AGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTL 220          
BLAST of slc24a-7 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 153.295 bits (386), Expect = 1.983e-38
Identity = 89/282 (31.56%), Postives = 157/282 (55.67%), Query Frame = 1
Query: 1744 WKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2574
            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+   ++       +QL    +   +L   + +    +L+ +P   F  +R YG+ L  IY ++  + +L    II++ +
Sbjct:  302 WQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVFLTVALLTEFGIIRLEM 583          

HSP 2 Score: 92.0485 bits (227), Expect = 1.367e-18
Identity = 59/169 (34.91%), Postives = 86/169 (50.89%), Query Frame = 1
Query:   73 CDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMF-LWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLA----GVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIEL 561
            C++      CS   G INY    +C+F     P  I ++ LW L+L   +  +A+           +T+ M  +L     GVT LA GNGA DVFS+++A + +     GLA GA+ GAGVFV  + AG I I+ PF    RP L+D++FY  A+     I  +  + L
Sbjct:   75 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEK---------NQTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAFSDSRT--AGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTL 232          
BLAST of slc24a-7 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 151.754 bits (382), Expect = 6.272e-38
Identity = 89/282 (31.56%), Postives = 157/282 (55.67%), Query Frame = 1
Query: 1744 WKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2574
            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+   ++       +QL    +   +L   + +    +L+ +P   F  +R YG+ L  IY ++  + +L    II++ +
Sbjct:  278 WQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVFLTVALLTEFGIIRLEM 559          

HSP 2 Score: 91.6633 bits (226), Expect = 1.551e-18
Identity = 63/185 (34.05%), Postives = 95/185 (51.35%), Query Frame = 1
Query:   73 CDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMF-LWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLA----GVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSL-VFLAIYVIYIL 606
            C++      CS   G INY    +C+F     P  I ++ LW L+L   +  +A+           +T+ M  +L     GVT LA GNGA DVFS+++A + +     GLA GA+ GAGVFV  + AG I I+ PF    RP L+D++FY  A+     I  +  + L  +L  + A ++ Y+L
Sbjct:   75 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEK---------NQTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAFSDSRT--AGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALGKYKAYFLAYLL 248          
BLAST of slc24a-7 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 118.242 bits (295), Expect = 3.497e-29
Identity = 63/165 (38.18%), Postives = 93/165 (56.36%), Query Frame = 1
Query:   73 CDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMF-LWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIEL 561
            C++      CS   G INY    +C+F     P  I ++ LW L+L   +  +A+ F  P L  +++ +R+S N+AGVT LA GNGA DVFS+++A + +     GLA GA+ GAGVFV  + AG I I+ PF    RP L+D++FY  A+     I  +  + L
Sbjct:   54 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAFSDSRT--AGLAIGALFGAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTL 216          
BLAST of slc24a-7 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 152.14 bits (383), Expect = 1.870e-38
Identity = 94/272 (34.56%), Postives = 153/272 (56.25%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFS---IRTFSGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2568
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+      IR     + ++  G  + VL   + L    +L+ +PL  FQ  + YG+ L+  Y+ + V+V+L    +I +
Sbjct:  255 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVLLTEFGVIHL 526          

HSP 2 Score: 77.0258 bits (188), Expect = 4.602e-14
Identity = 50/147 (34.01%), Postives = 77/147 (52.38%), Query Frame = 1
Query:   19 CMAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMFL-WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNP-NVGLAFGAILG-AGVFVNAITAGII 447
            C A C        N S+ CD++     C   +G ++Y +  +C F     P  I +++ W L+L   +  +A  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P   GLA GA+ G  G++V  +   II
Sbjct:   53 CRAVC------GLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGYLGLYVFYVVTVII 190          
BLAST of slc24a-7 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 150.599 bits (379), Expect = 1.017e-37
Identity = 95/273 (34.80%), Postives = 153/273 (56.04%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFS---IRTFSGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2568
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S +  VL     VY   +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+      IR     + ++  G  + VL   + L    +L+ +PL  FQ  + YG+ L+  Y+ + V+V+L    +I +
Sbjct:  294 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGI-YEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVLLTEFGVIHL 565          

HSP 2 Score: 102.834 bits (255), Expect = 3.434e-22
Identity = 70/215 (32.56%), Postives = 100/215 (46.51%), Query Frame = 1
Query:   19 CMAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGIL----MFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNP-NVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            C A C        N S+ CD++     C   +G ++Y +  +C F     P  +     +L +LFL+ G+T +                       GVT LA GNGA D+FS+L A    S+P   GLA GA+ GAGV V  + AG I IL PF    RP L+D+ FY VA+          +I L  +L +L +YV Y++  +I   +Y R   
Sbjct:   53 CRAVC------GLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFPH-------------------GVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRS 239          
BLAST of slc24a-7 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 150.599 bits (379), Expect = 1.254e-37
Identity = 94/272 (34.56%), Postives = 153/272 (56.25%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFS---IRTFSGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2568
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+      IR     + ++  G  + VL   + L    +L+ +PL  FQ  + YG+ L+  Y+ + V+V+L    +I +
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVLLTEFGVIHL 582          

HSP 2 Score: 125.946 bits (315), Expect = 1.553e-29
Identity = 75/213 (35.21%), Postives = 111/213 (52.11%), Query Frame = 1
Query:   19 CMAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMFL-WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNP-NVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            C A C        N S+ CD++     C   +G ++Y +  +C F     P  I +++ W L+L   +  +A  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P   GLA GA+ GAGV V  + AG I IL PF    RP L+D+ FY VA+          +I L  +L +L +YV Y++  +I   +Y R   
Sbjct:   53 CRAVC------GLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRS 256          
BLAST of slc24a-7 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 127.487 bits (319), Expect = 3.883e-30
Identity = 75/213 (35.21%), Postives = 111/213 (52.11%), Query Frame = 1
Query:   19 CMAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMFL-WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNP-NVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            C A C        N S+ CD++     C   +G ++Y +  +C F     P  I +++ W L+L   +  +A  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P   GLA GA+ GAGV V  + AG I IL PF    RP L+D+ FY VA+          +I L  +L +L +YV Y++  +I   +Y R   
Sbjct:   53 CRAVC------GLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRS 256          

HSP 2 Score: 98.2117 bits (243), Expect = 9.589e-21
Identity = 65/194 (33.51%), Postives = 102/194 (52.58%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGI 2343
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S +  VL     VY   +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS G     +T        +G   C  GP  +LL G+
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGI-YEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGAGARRIT-------GVGAGQC-PGPQLDLLPGL 495          
BLAST of slc24a-7 vs. Ensembl Mouse
Match: Slc24a2 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 2 [Source:MGI Symbol;Acc:MGI:1923626])

HSP 1 Score: 68.5514 bits (166), Expect = 2.396e-11
Identity = 42/146 (28.77%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYIL 606
            IL  +  +++   +    D F  P L V+ + + +S+++AG T +A G  A ++F+SL  V   ++ NVG+  G I+G+ VF      G+  + S     +   P+ +D+ FY V L+  +  F+   I  W SL+ L  Y  Y++
Sbjct:  137 ILHVIGMIYMFIALAIVCDEFFVPSLTVITEKLGISDDVAGATFMAAGGSAPELFTSLIGVFI-AHSNVGI--GTIVGSAVFNILFVIGMCALFSREILNLTWWPLFRDVSFYIVDLLMLITFFLDNVIMWWESLLLLTAYFAYVV 279          

HSP 2 Score: 60.4622 bits (145), Expect = 9.216e-9
Identity = 48/170 (28.24%), Postives = 87/170 (51.18%), Query Frame = 1
Query: 2071 KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRT----FSGPIPVQLTG--TSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2562
            + P  + FF  I    SI WI   +  +V      G    IS  I+GL++LA   S  DL+++V +A+     +  S+ VG  +F++ VG+ +P+ + T    FS P+ V   G   +IVL+F ++L     +L + L K++  +  G I+  +Y ++ V+ +L    ++
Sbjct:  541 RKPASRKFFP-ITFFGSITWIAVFSYLMVWWAHQVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPLPWLLYTIIHRFS-PVTVSSNGLFCAIVLLFIMLLFV---ILSIALCKWRMNKILGFIMFGLYFVFLVVSVLLEDKVL 705          
BLAST of slc24a-7 vs. UniProt/SwissProt
Match: sp|Q6AXS0|NCLX_RAT (Mitochondrial sodium/calcium exchanger protein OS=Rattus norvegicus OX=10116 GN=Slc8b1 PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.463e-38
Identity = 95/272 (34.93%), Postives = 154/272 (56.62%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFS---IRTFSGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2568
            P+D  +WR QS   K L + + P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F +  + +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+      +R+ +  + ++  G  + VL   + L    +L+ +PL  FQ  + YG+ L+  Y+ + V+V+L    +I +
Sbjct:  311 PLDYRKWRTQSISCKLLKVAKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNSEPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIVRSHASEVKLEPDGLLVWVLASALGLSLVFSLVSVPLQCFQLSKAYGLCLLLFYICFIVVVLLTEFGVIHL 582          

HSP 2 Score: 127.872 bits (320), Expect = 2.630e-29
Identity = 76/213 (35.68%), Postives = 112/213 (52.58%), Query Frame = 1
Query:   19 CMAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMFL-WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNP-NVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            C A C      S N S+ CD++     C    G ++Y +  +C F     P  I +++ W L+L   +  +A  F  P L  ++ ++++S N+AGVT LA GNGA D+FS+L A    S+P   GLA GA+ GAGV V  + AG I IL PF    RP L+D+ FY VA+          +I L  +L +L +YV Y++  +I   +Y R   
Sbjct:   53 CRAVC------SLNTSDRCDFVKRNPDCHSEGGYLDYLKGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTSLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGAGVLVTTVVAGGITILRPFMAASRPFLRDITFYMVAVFLTFTALYLGRITLVWALGYLGLYVFYVVTVIICTWVYQRQRS 256          
BLAST of slc24a-7 vs. UniProt/SwissProt
Match: sp|P34322|NCX7_CAEEL (Putative sodium/calcium exchanger 7 OS=Caenorhabditis elegans OX=6239 GN=ncx-7 PE=3 SV=3)

HSP 1 Score: 155.606 bits (392), Expect = 4.701e-38
Identity = 89/258 (34.50%), Postives = 150/258 (58.14%), Query Frame = 1
Query: 1777 DLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVY-NTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGP-IPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2544
            + E+W E + FSK ++ I      +  LTIP+ + +     W K L  +H      F +     +  TPF  S  L VY   +   +  +++ FT    +P  Y+  +++ G I SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++ K  YPR+  +A +GGPLFNLL+G G+PF+I    G  I + +  T  +LI  + +     L+ +P+ KF+ +R +  +LI+IY+ + V VIL
Sbjct:  411 EAEDWEEMNIFSKVMAYINVVPNLLFKLTIPLNEMS-----WSKPLTLLHAFTCPAFLLFSIQFFLETPFSGSPGLWVYGLAVSIVLAILIMVFTELSVQPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQGKYISMTINPTYRLLILFLAISLLATLIGIPVQKFRLQRPHAAVLISIYIAFIVFVIL 663          

HSP 2 Score: 121.324 bits (303), Expect = 5.338e-27
Identity = 63/203 (31.03%), Postives = 112/203 (55.17%), Query Frame = 1
Query:   52 SFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFG--NRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFI-KKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKS 651
            ++     CDY+          G + + Q+  CA    +R    I+  ++ L L   ++++AD F +P +  +   +R+SE++AGVT +A GNGA DVF S+++V S+  P   LA G + G G+FV  +    I++ SPF +     ++DLLFY VAL +    F+   ++ LW  L FL +Y++Y++  + ++ ++ R  K+
Sbjct:   49 TWTQEQVCDYVNCNDNACEGGGYLLWTQYVECASSTFSRVILIIVGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGELFGGGLFVTTMVVSTIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLWMPLTFLGLYLLYVITVIGAQAVHNRKRKA 251          
BLAST of slc24a-7 vs. UniProt/SwissProt
Match: sp|Q6J4K2|NCLX_HUMAN (Mitochondrial sodium/calcium exchanger protein OS=Homo sapiens OX=9606 GN=SLC8B1 PE=1 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 2.491e-37
Identity = 95/272 (34.93%), Postives = 151/272 (55.51%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2568
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y   +     + V++ +++       V F +  D +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+   ++       V+L    +   VL   + L    +L+ +PL  FQ  R YG  L+  Y+ + V+ +L    +I +
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGV-YEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHL 581          

HSP 2 Score: 134.035 bits (336), Expect = 2.410e-31
Identity = 71/206 (34.47%), Postives = 115/206 (55.83%), Query Frame = 1
Query:   43 KFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMFL-WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPN-VGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKS 651
            K    N S+ CD+I     C  + G ++Y +  +C F     P  + +++ W L+L   +  +A  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA GA+ GAGV V  + AG I IL PF    RP  +D++FY VA+    ++  + ++ L  +L +L +YV Y++  ++   +Y R  + 
Sbjct:   55 KVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQRRG 257          
BLAST of slc24a-7 vs. UniProt/SwissProt
Match: sp|Q925Q3|NCLX_MOUSE (Mitochondrial sodium/calcium exchanger protein OS=Mus musculus OX=10090 GN=Slc8b1 PE=2 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 8.770e-37
Identity = 94/272 (34.56%), Postives = 153/272 (56.25%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFS---IRTFSGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2568
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+      IR     + ++  G  + VL   + L    +L+ +PL  FQ  + YG+ L+  Y+ + V+V+L    +I +
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVLLTEFGVIHL 582          

HSP 2 Score: 125.946 bits (315), Expect = 1.086e-28
Identity = 75/213 (35.21%), Postives = 111/213 (52.11%), Query Frame = 1
Query:   19 CMAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP-GILMFL-WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNP-NVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            C A C        N S+ CD++     C   +G ++Y +  +C F     P  I +++ W L+L   +  +A  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P   GLA GA+ GAGV V  + AG I IL PF    RP L+D+ FY VA+          +I L  +L +L +YV Y++  +I   +Y R   
Sbjct:   53 CRAVC------GLNTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQRS 256          
BLAST of slc24a-7 vs. UniProt/SwissProt
Match: sp|P34315|NCX6_CAEEL (Putative sodium/calcium exchanger 6 OS=Caenorhabditis elegans OX=6239 GN=ncx-6 PE=3 SV=3)

HSP 1 Score: 145.976 bits (367), Expect = 3.817e-35
Identity = 96/309 (31.07%), Postives = 170/309 (55.02%), Query Frame = 1
Query: 1645 EGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPV-DLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN-TPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGP-IPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2562
             G++ +H     + +  IE  E   +  +F G    F   + P   ++EW E + F K ++++ +   F+  LTIP  ++      W K +  + CL+  VF +    V + +PF  S  L +Y  I+   +   V+ FT    +PP Y+   ++ G + SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++AK  YPR+  +A +GG LFNLL+G G+PF+I    G  I + +  T  +L+  + +     L+ +   K+  +R +   L+ IY+ +FV + L   DI+
Sbjct:  285 HGHHVLHAHEVMKMEAEIEAVEPLKTW-SFRGVVHDFKEHLKPWPSMDEWDEMNIFQKVIAVLNTIPNFLFKLTIPHSEQP-----WSKPITLLQCLICPVFLLFCIQVCSISPFPNSPGLWMYGLILSVLLTAAVLFFTELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTIAKIQGKSISMIINPTYRLLMLFLAISLIFTLIAMFAQKYFLRRIHSYSLVFIYISFFVFIGLSLDDIL 587          

HSP 2 Score: 117.087 bits (292), Expect = 7.992e-26
Identity = 61/207 (29.47%), Postives = 114/207 (55.07%), Query Frame = 1
Query:   49 SSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFL------WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFI-KKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            + +N +  C+Y+          G + + ++  CA     +P + + L      + L L   ++++AD F +P +  +   +R+SE++AGVT +A GNGA DVF ++++V S+  P   LA G + GAG+FV  +   + +   PFK      ++D+ FY VAL +    F+    +E+W  + FL +Y+IY+   ++S++L+ R++K
Sbjct:   57 AGWNSTQVCEYVKCNDDNCEGGGYVLWTRYVECAS----SPAVRIILIITGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSSPTPKADLALGELFGAGLFVTTMVLAVTIFTRPFKAEVFSSIRDIAFYLVALAFLAFCFVYYDHVEIWMPITFLGVYLIYVCTVILSQILHNRHKK 259          
BLAST of slc24a-7 vs. TrEMBL
Match: A0A0H3YFD7 (Slc24a-7 OS=Schmidtea mediterranea OX=79327 GN=slc24a-7 PE=2 SV=1)

HSP 1 Score: 1657.5 bits (4291), Expect = 0.000e+0
Identity = 851/851 (100.00%), Postives = 851/851 (100.00%), Query Frame = 1
Query:   22 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSXXXXXXXXXXXXXXXXXXXXVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2574
            MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSNKTIIQTNNISITITTPATNVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSNKTIIQTNNISITITTPATNVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 851          
BLAST of slc24a-7 vs. TrEMBL
Match: A0A0H3YKA1 (Slc24a-2 OS=Schmidtea mediterranea OX=79327 GN=slc24a-2 PE=2 SV=1)

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 656/895 (73.30%), Postives = 725/895 (81.01%), Query Frame = 1
Query:   22 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSXXXXXXXXXXXXXXXXXXXXVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDF----------------------------------------RSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNT----LPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2574
            M  CTPL FSS NYSN C YIT F  C PN G INY+QWQYC+F NRWAP ILM LWFLFLLTGI T+ADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS SNPNVGLAFG ILGAG+FVN+ITAGIIMI++PFK+MKRPI+KD LFYF ALIWCM IFI++QIELWSSLVFL +Y IYILVTVISRLLYVR+ KS  T I+TNN +ITI TP  NVENAEIQQ++  D  S  + + I +D RSK N+N+  N+I IT+   ND+ DQ+NDLN  M+KSS+ISDF                                        +SI    SD N  +  R S+ +    GSLR  N YSYDNPNY+ +N  D    AST  S+F++NF SIND PN +KE Y DK DHLNVP   YQ K  L+ SQ+SCP++SEC++ KR+   YLN  Q ER YN+    LPS R S   NH K+S SIK+K+ S R+S+ RS+SHRSI S+A+IIID EHEKERME HPT+KK    +S+SLT++NE  LK+ IR+ SM E +K+KSDITNEW I++GN+K+ PENENENKFN+ETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVT LNLLCLPLMKFQPKRFYGIILI IY+IYFVLVILFAVDIIKVTL
Sbjct:    1 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNVGLAFGGILGAGIFVNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHIKSKATTIKTNNSNITIRTPDLNVENAEIQQKDNRDS-STSNSVLIFKDNRSKANQNITVNNIEITVTASNDEDDQKNDLNIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENYLNELKSISSSISDFNCINIER-SNTRVSFGGSLR--NDYSYDNPNYVHENHKDHFSRASTTLSSFKSNFSSINDKPNFIKECYEDKLDHLNVPQTNYQGKSRLVTSQHSCPHESECNAKKRVYD-YLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTTLNLLCLPLMKFQPKRFYGIILIIIYIIYFVLVILFAVDIIKVTL 890          
BLAST of slc24a-7 vs. TrEMBL
Match: A0A0H3YF40 (Slc24a-5 OS=Schmidtea mediterranea OX=79327 GN=slc24a-5 PE=2 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 6.032e-105
Identity = 213/493 (43.20%), Postives = 301/493 (61.05%), Query Frame = 1
Query: 1195 IYQKKPNLIKSQNSCPNDSECHS---HKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKN---LSPRSSIER----SASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYW------SMREIQKAKSD----------------ITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS-GPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2574
            + QK+  L   +++     E  S   + R    Y+N ++     N+LPS   S   N L  S    ++N   L P  S       S  +R++ S+AKIII+NE+ KE +E     K  N  +SLSL +  E    +N + +      +++EI+K + +                I+ E  I + +        +E+  ++ET +     V FPG +KHF + I+P++ EEW+EQS FSK LS+IQSP MFILTLTIP+V+E  YLKGWCK+LNC+HC+LS + W+        P G+  F+L++L +I+G    +  A TSK + PP Y   FAF+G +TSI WIY IANEIVNIL  FGVV +I   ILGL++LAFANS GDLVSN+ LA+  +PRI Y+AC+GGPLFNLLVGIG+PFSI     G I V+L   +IVLI TI+L+T +NL+ LP+M+F+ +  YGII+I IYV++ + V+LFA ++IKVTL
Sbjct:  203 VKQKRGKLTTQEDTQHKKDESGSNIQYSRENRAYINDVEPCNSLNSLPSSLQSP--NSLTNSNQDSERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILE---AKKNMNRKRSLSLDLATEKPKFNNRKRFISLDQENLKEIKKTEKENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKD-----VQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKVTL 685          

HSP 2 Score: 286.574 bits (732), Expect = 2.555e-81
Identity = 135/209 (64.59%), Postives = 166/209 (79.43%), Query Frame = 1
Query:   22 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            M +C P K  +FN S  C+Y+ N   CS +SG INY+QWQ+C F NR  P ILMFLWFL LL  +  +ADSF APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSAV S S+PNV LA G+ILGAG+ VN +TAGIIMI+ PF +M+RPI+KDL+FY +AL+WCM I I++QIELWSS+VFL IYVIY+ VT +SR +YV+ ++
Sbjct:    1 MESCNP-KNKTFNES-FCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQKR 207          
BLAST of slc24a-7 vs. TrEMBL
Match: A0A1X7V375 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.416e-59
Identity = 220/843 (26.10%), Postives = 362/843 (42.94%), Query Frame = 1
Query:   31 CTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFL--WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSXXXXXXXXXXXXXXXXXXXXVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNL----SPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHP--TAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPG----PWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG---PIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITI 2514
            C   +  + +    C+++ N   C   +G I Y+++ YC    +  P  L+ L  W  +L T I T+A+ ++                                   L+A T        LAFGA+ GAG++V    AG +++L PF + KRP L+D +FY  A+ W + I    QI +  +L FLA Y  Y+ V V   L+Y +       +++    +   T  + NV +  ++  +I        + S + DER                 + +  +DQ++D     + +  +SD   + I  ++  Q+S P  + L  H   +  TN   S D+P+   D  I+ +                  D P +  E  A ++          QK     K + S  ND E     + LS  + P+         P  RP++ +  +  + +   ++L    +P  +     ++R          +  +EK R  +H   TA + +  +S + +                    + KSDI  +         VH   E   +  +    N  S ++F       + +      PV    + E    SK   II+ P  F+LTLTIP+VD T  L  W K LN IHC  S VF  ++  V     G S+   V LF   G I+ ++VA TS   KPPIY   +A+ G + S++WIY IANE+VN+L VFGVV  IS  ILG+++LA+ N   D V+N+T+A+  +PR+   ACVGGPL NLL+G+G+   +R          +  T   +V  F ++L  + +L+ +  +KF+  R   +  + +
Sbjct:   83 CECTEIHNIDTELQCEFVQNATSCGGEAGYIPYFEFAYCLLPIKLLPLSLIILAFWLCYLFTFIGTTAEDYV-----------------------------------LAAFTHPDEKKTSLAFGALFGAGMYVTTAVAGGVVLLRPFVLTKRPFLRDNIFYAFAVYWALFILWNNQINIGEALGFLAYYFFYVAVVVFGALIYQKWANRKLNLLKLGQENSEQTRRSGNVASETVRCSDIH-------YYSDHDDERR----------------IADTDIDQKDD-----EGTRLLSDDEKLTIRHTEHGQSS-PNTTPL--HNVRNKPTNKPLSDDDPSNKKDEEIEEI------------------DRPKTPAERSASRAS---------QKIYGTNKEEESDDNDLE-----KALS--IRPIT--------PQSRPTSRLEQVIDNVAYVAEDLFVGSNPNLAKVWGPAYRK---------EKANEKHRSSSHAFNTADEGSRYESFTTSETGSV---------------RVKSDIVQD---------VHVPKEQNERLPLIEKPNITSDMSFKQRQLMAFSNLLEAFFPVR-RNFIESGKLSKIFFIIKLPINFLLTLTIPVVDFTEPLNNWNKWLNVIHCFTSPVFASIVTEVGLYKLGNSDVPAVVLFAFAGLILAIIVAATSYSHKPPIYHCVYAWAGFVLSVIWIYVIANELVNLLQVFGVVVKISDGILGVTLLAWGNCIEDTVTNLTMARRGFPRMAIGACVGGPLLNLLIGVGLASVVRIIKDRTLEFNLYFTQVEMVAAFFLLLSLSSSLIAMSCLKFKISRVDAVAYVGV 783          

HSP 2 Score: 204.527 bits (519), Expect = 2.333e-50
Identity = 205/795 (25.79%), Postives = 325/795 (40.88%), Query Frame = 1
Query:   31 CTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFL--WFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSXXXXXXXXXXXXXXXXXXXXVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIA-------VPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNL------------SPRSSIERS-ASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLE-------EWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFN 2328
            C       F+    C+++ N   C    G I Y+++ YC    +  P  L+ L  W  +L T + T+A+ +    L V+ + +R+S                                          AG+FV  + AG +++L PF + KRP L+D +FY  A+ W + +  + QI +  ++ FL  Y  Y+ V V   L+Y                                 Q+     L++L  +S    E+++ +  +A+ +I  T +       + +  +DQE++    ++         S+ I  ++  Q+S P  + L  HI  S  T+   S D+ +   D  I+ +                  D P +  E  A ++          QK     K + S  ND E     + LS  + P+         P  RP++ +  +  + +   ++L             P    E++  +HRS  S A I  D   E  R E+  T++ A++                             KSDI  +           P  +NE    IE        +TF   +K   LT     LE       ++      SK   II+ P  F+LTLTIP+VD T  L  W K LN IHC  S +F  +   +     G S+   V LF   G I+ ++VA TS   KPPIY   +A+ G + SI+WIY IANEIVN+L VFGVV  +S  ILG+++LA+ NS  D V+N+T+A+  +PR+   AC GGPL +
Sbjct:  864 CECSDIHQFDTELQCEFVQNVTSCGGEDGFIPYFEFAYCLLPIKLLPLSLVILAFWLFYLFTFLGTTAEEYFCKALTVITRLLRLS------------------------------------------AGMFVTTLVAGGVVLLRPFVLTKRPFLRDNIFYLFAVYWALFVLWENQINIGEAIGFLVYYFFYVAVVVFGALIY---------------------------------QKWANRKLNLLK-LSQAYSEQTRRSGTVASGTIRYTESHFEDERRIADTDIDQEDEEETRLQTDD--EKLLSVTIRHTEHGQSS-PNATPL--HIVRSKPTHKPLSDDDASNKKDEGIEEI------------------DRPKTPAERSASRAS---------QKIYGTDKEEESDDNDLE-----KALS--IRPIT--------PQSRPTSRLEQVIDNVAYVAEDLFVGSNPNLAKVWGPAYRKEKANETHRS-SSHAFITAD---EGSRYESFTTSETASI---------------------------GVKSDIVPD-----------PRQQNERLPLIEKPN-----ITFDMSFKQRQLTAFSNLLEALFPVRRKFIHSGKLSKIFFIIKLPINFLLTLTIPVVDFTEPLNNWNKWLNVIHCFTSPIFASIATEIGLYKLGNSDVPAVVLFAFAGLILAIIVAATSYSHKPPIYHCVYAWAGFVLSIIWIYAIANEIVNLLQVFGVVVKLSDGILGVTLLAWGNSIQDSVTNLTMARRGFPRMAIGACFGGPLLS 1488          
BLAST of slc24a-7 vs. TrEMBL
Match: A0A2T7PD60 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06777 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.451e-55
Identity = 133/346 (38.44%), Postives = 197/346 (56.94%), Query Frame = 1
Query: 1582 YWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSV-----VTFPG------PWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIV-----DETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTF--SGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIK 2565
            Y  MRE    ++ + N  D  + +    P++E++     ET E   ++     +  P       P K F +++ P++ EEW +   F+K   I +SP + +L LT+P+V     DE     GW + LN IHCL   VF +   NV     G   F L  L +I+G ++   V FTS  D+ P Y   FA++G + +++WIY +ANEIVNIL  FG+V NIS+ I+GL++LA+ NS GD V+++TLA+  YPR+G SAC GGPLFNLL+GIGIPF+I      G   +Q+T   + L   + +    +L+ +PL  F   R YGI LI +YV++ VL +L   D+IK
Sbjct:  208 YQCMRE---PRTLVVNNEDTADESDSFAPDDESKPLLRPETDEENKAIEIELIMRRPKHHEPQQPLKMFLMSVNPINTEEWSKMRIFAKAYEIFKSPLLLVLKLTVPVVVYADDDEN---HGWNRYLNTIHCLTGPVFTIFAVNVGFKTIG-GVFPLYGLVLIIGAVLATAVFFTSTNDQKPRYHDLFAYLGFVVAVVWIYSMANEIVNILQTFGIVLNISNSIIGLTLLAWGNSIGDFVADLTLARQGYPRMGISACFGGPLFNLLLGIGIPFTIACINKGGVFKLQVTLEELFLAGGVAVSLVSSLIIVPLSGFHMSRGYGIYLIILYVVFLVLAVLIETDVIK 546          

HSP 2 Score: 155.606 bits (392), Expect = 4.490e-36
Identity = 80/203 (39.41%), Postives = 124/203 (61.08%), Query Frame = 1
Query:   31 CTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWA--PGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLY 633
            C    F   N ++ C ++++   C  + G INY  + YC   +       I++F W+LFL  G+  +AD F  P LVV++KT+R+S N+AGVT LA GNG+ D+FS+++A+ +    + GLA GA+ GAGVFV  +  G I  + PF  M+RP L+D++FY  A+ W   I  KK+I    ++ F+ +YV+Y++V V+ RL Y
Sbjct:    8 CRAFHFE--NITDLCTFVSSTSDCQTDDGFINYTNFVYCCLSSHLVVLSVIILFFWWLFLFCGLAVTADDFFCPSLVVISKTLRLSHNIAGVTFLAFGNGSPDIFSAIAAIGNAKAGDAGLAIGALFGAGVFVTTVIVGTISTVCPFDAMQRPFLRDVIFYLGAVFWAFYIMWKKEIHTLEAVGFILLYVVYVIVVVVGRLFY 208          
BLAST of slc24a-7 vs. Ensembl Cavefish
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:103022341])

HSP 1 Score: 141.354 bits (355), Expect = 1.072e-34
Identity = 74/206 (35.92%), Postives = 117/206 (56.80%), Query Frame = 1
Query:   43 KFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPG--ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPN-VGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKS 651
            K  + + ++ C+++ N   C+   G INY +  +C       P    L  +W L +   +   A  F  P L  ++ T+R++ N+AGVT LALGNGA DVFS+++A    S P   GLA GA+ GAG+FV  + AG + ++ PF +  RP L+D++FY  A+ W   I  K  I+L  +L +L +YV+Y++  V+S  +Y R  +S
Sbjct:   64 KVMNLSAADRCEFVLNTPDCAAEGGFINYPKITFCLLAPNLLPLAIFLYIVWLLVMFLVLGLIASQFFCPNLSAISSTLRLTHNVAGVTFLALGNGAPDVFSAMAAF---SRPQTAGLAIGALFGAGIFVTTVVAGSVTLVKPFTVASRPFLRDIIFYMAAVFWTFTILYKGWIDLKEALGYLGLYVLYVITVVVSTYIYRRRTRS 266          

HSP 2 Score: 133.65 bits (335), Expect = 4.437e-32
Identity = 94/272 (34.56%), Postives = 149/272 (54.78%), Query Frame = 1
Query: 1747 KHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPI----PVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2544
            K F  +I PVD   WR      + L IIQ PF  +L LT+P+VD       W + LNC+H +   +  VL      Y       +F +  L  ++G  +  +V  T+  ++PP Y   F+ +G + S LWI  +A+EIV++L + G+V ++S+ +LGL++LA+ NS GD  S++T+A+  YPR+  SAC GG +FN+L G+G+   ++ F   +    P  L G   VL   + L   L+ + +PL +F   R YGI L+  Y  + V+ +L
Sbjct:  313 KIFLKSISPVDTRIWRRSHWAWRALKIIQLPFEVVLLLTVPVVDTDKEDHNWKRPLNCLHIITGPLVCVLTFQSGHYGLYLIQGDFPVWLLTALIGVFLSGIVFCTTNNERPPPYHFLFSLLGFVVSALWISTVASEIVSVLHLLGIVLSLSNTVLGLTLLAWGNSIGDCFSDITIARQGYPRMAISACFGGIIFNMLFGVGLGCLLQMFHNGVVMLEPEGLLGW--VLSGALGLSLVLSFVLVPLQRFHLNRAYGIFLLIFYAAFLVVALL 582          
BLAST of slc24a-7 vs. Ensembl Cavefish
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:103026719])

HSP 1 Score: 70.8626 bits (172), Expect = 3.283e-12
Identity = 41/146 (28.08%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYIL 606
            +L  +  L++   +    D F  P L V+ + + +S+++AG T +A G  A ++F+S+  V   S+ NVG+  G I+G+ VF      G+  + S     +   P+ +D+ FY + LI  ++ F+   I  W S+  L  Y  Y++
Sbjct:  108 VLHMIGMLYMFIALAIVCDEFFVPALTVITEKLAISDDVAGATFMAAGGSAPELFTSVIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCAVFSKEILNLTWWPLFRDVSFYILGLIMLIVFFLDNYISYWESIALLTAYACYVI 250          
BLAST of slc24a-7 vs. Ensembl Cavefish
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:103026719])

HSP 1 Score: 70.8626 bits (172), Expect = 3.584e-12
Identity = 41/146 (28.08%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYIL 606
            +L  +  L++   +    D F  P L V+ + + +S+++AG T +A G  A ++F+S+  V   S+ NVG+  G I+G+ VF      G+  + S     +   P+ +D+ FY + LI  ++ F+   I  W S+  L  Y  Y++
Sbjct:  108 VLHMIGMLYMFIALAIVCDEFFVPALTVITEKLAISDDVAGATFMAAGGSAPELFTSVIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCAVFSKEILNLTWWPLFRDVSFYILGLIMLIVFFLDNYISYWESIALLTAYACYVI 250          
BLAST of slc24a-7 vs. Ensembl Cavefish
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:103026719])

HSP 1 Score: 70.4774 bits (171), Expect = 4.443e-12
Identity = 41/146 (28.08%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYIL 606
            +L  +  L++   +    D F  P L V+ + + +S+++AG T +A G  A ++F+S+  V   S+ NVG+  G I+G+ VF      G+  + S     +   P+ +D+ FY + LI  ++ F+   I  W S+  L  Y  Y++
Sbjct:  108 VLHMIGMLYMFIALAIVCDEFFVPALTVITEKLAISDDVAGATFMAAGGSAPELFTSVIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCAVFSKEILNLTWWPLFRDVSFYILGLIMLIVFFLDNYISYWESIALLTAYACYVI 250          
BLAST of slc24a-7 vs. Ensembl Cavefish
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:103026719])

HSP 1 Score: 70.0922 bits (170), Expect = 5.943e-12
Identity = 41/146 (28.08%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYIL 606
            +L  +  L++   +    D F  P L V+ + + +S+++AG T +A G  A ++F+S+  V   S+ NVG+  G I+G+ VF      G+  + S     +   P+ +D+ FY + LI  ++ F+   I  W S+  L  Y  Y++
Sbjct:  108 VLHMIGMLYMFIALAIVCDEFFVPALTVITEKLAISDDVAGATFMAAGGSAPELFTSVIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCAVFSKEILNLTWWPLFRDVSFYILGLIMLIVFFLDNYISYWESIALLTAYACYVI 250          
BLAST of slc24a-7 vs. Ensembl Sea Lamprey
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 136.732 bits (343), Expect = 3.083e-35
Identity = 95/287 (33.10%), Postives = 157/287 (54.70%), Query Frame = 1
Query: 1738 GPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCL---LSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI--------VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIK 2565
            G    F L++ P+D  EWR +    + L ++  P   +L LT+P+++     + W + LNC+  +   L+ ++ +     +  P G +  L ++  I+    +  VVAF +  ++PP +Q  FA +G + S LW+  IANE+VN+L  FGVVF ISS +LGL++LA+ NS  D V+++T+A+  YPR+  SAC GG +FN+LVGIG+       S P P  +    +        VL  ++ +   L+ + LPL  F   R YG+ L  +Y+ +  + +L    II+
Sbjct:   82 GKLYRFLLSLSPLDPAEWRRRGYIWRLLKVVVLPVELLLILTVPVMNVMHEDRKWNRPLNCLQLMTGPLAALYSLNGGLYFMLPVGGT--LPLWSLILAIGCLLAVVAFITTSEQPPAFQLAFAVLGFVVSALWMNAIANEVVNLLQTFGVVFGISSTVLGLTLLAWGNSVPDFVADITMARQGYPRMAISACFGGIVFNILVGIGLGC---LLSMP-PSHMQQAQLVPDVPLVWVLCASLGISLVLSFVALPLQGFYLTRKYGVCLFALYLAFLTVALLTEFKIIR 362          
BLAST of slc24a-7 vs. Ensembl Sea Lamprey
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 73.1738 bits (178), Expect = 1.193e-13
Identity = 44/146 (30.14%), Postives = 78/146 (53.42%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYIL 606
            +L  L  +++   +    D F  P L V+ + + +S+++AG T +A G  A ++F+SL  V   S+ NVG+  G I+G+ VF      G+  + S     +   P+ +D+ FY V L   +I F+   I+ W S++ L+ YV Y++
Sbjct:   35 VLHMLGMIYMFIALAIVCDEFFVPALGVITEKLAISDDVAGATFMAAGGSAPELFTSLIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCAVFSREILVLTWWPLFRDVSFYIVGLSMLIIFFLDNLIQWWESMLLLSCYVSYVV 177          
BLAST of slc24a-7 vs. Ensembl Sea Lamprey
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 57.7658 bits (138), Expect = 6.970e-9
Identity = 40/147 (27.21%), Postives = 79/147 (53.74%), Query Frame = 1
Query:  196 LFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVG-LAFGAILGAGVF-------VNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQI-ELWSSLVFLAIYVIYILV 609
            +++   +    D F  P L  +++ +++SE++AG T +A G+ A ++F+S+           G +  G I+G+ VF       V  + AG I+ L+ + +      +D +FY +++I  +I+FI  +I   W S++ + +Y +YILV
Sbjct:   32 MYMFYALALVCDDFFVPSLEKISERLQLSEDVAGATFMAAGSSAPELFTSVIVWCEGVFVTKGDVGVGTIVGSAVFNILCIIGVCGLFAGQIVRLTWWSL-----FRDSVFYTISII-ALILFICDEIVSWWESVILIMLYALYILV 172          

HSP 2 Score: 55.0694 bits (131), Expect = 5.048e-8
Identity = 35/152 (23.03%), Postives = 81/152 (53.29%), Query Frame = 1
Query: 2113 ITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTA---LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDI 2559
            + S +WI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T        +   S  LI++++L+ A   + +L + L  ++  R  G+  + +Y ++    I+   ++
Sbjct:  384 VISTIWIAVFSYVMVWMVTVIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWALQTLLVDYGSHVEINSRGLIYSVVLLLASVGITVLGIYLNNWKLDRKLGLACLFVYAVFLCFSIMIEFNV 535          
BLAST of slc24a-7 vs. Ensembl Yeast
Match: YDL206W_mRNA (Putative protein of unknown function; YDL206W is not an essential protein [Source:SGD;Acc:S000002365])

HSP 1 Score: 55.8398 bits (133), Expect = 2.151e-8
Identity = 28/55 (50.91%), Postives = 33/55 (60.00%), Query Frame = 1
Query: 2182 VFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIG 2346
            VFNIS  ILGL++  + NS GDLVSN+T  K     I   AC G PL   L G+G
Sbjct:  620 VFNISETILGLTIFTWGNSIGDLVSNITFVKIGVLEIAIGACFGSPLLYFLFGVG 674          
BLAST of slc24a-7 vs. Ensembl Yeast
Match: ECM27 (Protein involved in calcium homeostasis and exit from quiescence; required for proper trehalose levels during quiescence; may play a role in cell wall biosynthesis, mutants are hypersensitive to antifungal, Papulacandin B; null mutants have increased plasmid loss; interacts with Pdr5p [Source:SGD;Acc:S000003867])

HSP 1 Score: 52.373 bits (124), Expect = 2.384e-7
Identity = 27/103 (26.21%), Postives = 52/103 (50.49%), Query Frame = 1
Query: 2140 IANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAK---------------NNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGT 2403
            +AN ++ ++ ++  +  +S  ILGL++ A+ NS GDL+SN+++ +                 +  I  ++C+GG + N + GIG       FSG + +   G 
Sbjct:  545 LANSLIEMMEIYQKILGLSKAILGLTIFAWGNSVGDLISNISMCRLYKTQTHYQDRVRLATKFFMISCASCLGGVMLNSMGGIG-------FSGLVSMLFIGA 640          
BLAST of slc24a-7 vs. Ensembl Nematostella
Match: EDO31950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWG6])

HSP 1 Score: 112.849 bits (281), Expect = 2.102e-26
Identity = 70/225 (31.11%), Postives = 116/225 (51.56%), Query Frame = 1
Query: 1690 FNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVL--------LPNVYNTPFGTSNFLLVYXX-XXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLV 2337
            F++ T    +     P P +     +LP    ++     F+K   I+++P   +L +TIP++D     + W K LN +H +   +F VL        L  +Y  P    +++++Y               F S++ K    Q  F ++  I S++WIY  ANEIVNIL  FG+V  +S+ ILGL+ LA+ NS GDLV++ T+A+  +P +   AC GGP+ ++L+
Sbjct:  212 FSLNTHRACNRSANLP-PMQKLVRGVLPFTSADFELSGIFNKVFLILKAPAAVVLNVTIPVIDYDEPYQNWNKWLNVLHLITGPMFCVLATRAAKVSLGRLYKPP--RCHWVVLYKPPRCHWVGFTSRQGFCSQIHKNCFLQ-MFGYLAFIVSVVWIYVTANEIVNILQSFGIVLGLSNAILGLTFLAWGNSIGDLVADTTMARQGFPNMATGACFGGPMLSILL 432          

HSP 2 Score: 106.301 bits (264), Expect = 2.778e-24
Identity = 65/195 (33.33%), Postives = 112/195 (57.44%), Query Frame = 1
Query:   73 CDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPG-ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNS-NPNVGLAFGAILGAGVFVNAITAGIIMILS-PFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEK 648
            C ++     C  + G I Y  + YC          +++F+  LFL   +  +AD +  P L V++KT+R+S+N+AGVT LA GNGA D+FS+++AV+++S NPN      A LGAG+FV  +  G + + +  F +  RP  +D+LFY  A+ W  I   +++I +  ++ F+  Y  Y++V ++ R +  R ++
Sbjct:    1 CAFVQANSDCDLSDGFIQYIHFIYCKLPKAIPLALVILFVLMLFLFIVLGITADDYFCPSLTVISKTLRLSQNVAGVTFLAYGNGAPDIFSAIAAVSAHSKNPN-----AAQLGAGIFVTTVVVGSVTLCTGGFHLNNRPFTRDVLFYLGAVSWMFITMYRQRITMLEAIGFIIFYFAYVVVVIVGRYVNQRWKR 190          
BLAST of slc24a-7 vs. Ensembl Nematostella
Match: EDO41421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I7])

HSP 1 Score: 72.0182 bits (175), Expect = 6.721e-13
Identity = 41/139 (29.50%), Postives = 71/139 (51.08%), Query Frame = 1
Query:  199 FLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQ-IELWSSLVFLAIYVIYIL 606
            ++   +  + D F  P L V+ + + + E++AG T +A G  A ++F+S      +   NVG+  G I+G+ VF      G+  + S    ++   P+ +D +FY +ALI  +I F+    I  W SLV L  Y  Y++
Sbjct:  117 YMFLALAIACDEFFVPSLTVIIEKLELKEDVAGATFMAAGGSAPELFTSFIGTFIDPKSNVGI--GTIVGSAVFNVLFVIGMCAMFSKGVLELTWWPLFRDCIFYSLALIILIIFFLSGDVIVWWESLVLLLCYFAYVI 253          
BLAST of slc24a-7 vs. Ensembl Nematostella
Match: EDO48006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKL3])

HSP 1 Score: 70.0922 bits (170), Expect = 2.269e-12
Identity = 97/438 (22.15%), Postives = 174/438 (39.73%), Query Frame = 1
Query:  127 YYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKR--PILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSXXXXXXXXXXXXXXXXXXXXVENAEIQQQNIEDPLSILDFISINR-----DERSK-------GNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSI------HIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLK-----ELYADKSD---------HLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSER 1338
            +Y+  +     R    I+     L+    +    D++    L  + K +R+  ++AG T +A G+    +F ++++V      ++GL  G I+G+ +F       I  + S   I     PI++D   Y V L+  +I+     I  + +L+F  +Y  YIL+ V +  L    E + +T                   N  ++   +EDPL + D I + R     D+R +       G+  + A+S  IT+   ++ +   + LN   ++     D   I      + G ++ N+         ++    S + N +   D   +   N  D++   + N  N + N H   D+ N  K     E    K D         H N P +I+  KP       SCP        KRI+  ++ P+ L  FY T+P  R
Sbjct:   35 HYETIFTLQERRHGAVIIHTFICLYCFVALAILCDNYFCASLEKLCKRLRIPTDVAGATFMAAGSSMPTLFIAIASVFMGEG-DIGL--GTIIGSSMFNILFITAICGLFSGMVISLHTWPIVRDSCVYVVNLVGLLIVIHDNVIHFYEALIFPVLYTGYILIMVFNTRLENAFESAFETCCDI---------------NKGMEMVEMEDPLEVFD-IDVERDTSQGDDRGEQVSKDITGDGGVKADSESITLM--DEVLSDRSVLNESEREGKIEPDNEQIDRNDITNRGHNEGNKRKGHNERRKETEPKESEKRNKLTELDGATHNKQNE-DKIDEKNENEHN-KLNEHCEGDSHNEGKMDKENERIEQKEDATKSGASGSHQNTPSHIHGFKP-------SCPFTPPSTFSKRIVWIFMLPVHLA-FYVTMPDCR 441          

HSP 2 Score: 55.8398 bits (133), Expect = 6.994e-8
Identity = 42/149 (28.19%), Postives = 82/149 (55.03%), Query Frame = 1
Query: 2119 SILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS-GPIPVQLTGTS-IVLIFTIMLVTALNLL-CLPLMKFQPKRFYGIILITIYVIYFV-LVILFAV 2553
            SI+W+  ++  +V  +S+ G  F+I   I+GL++LA  +S  D++S++ +AK+    +  + C+G  +F++L  +G+P+ + T +  P  V L  +  IV +   +  T L ++  + L  ++  R  G+IL   Y  +    VIL A+
Sbjct:  456 SIIWMAALSYVLVWTVSIIGETFSIPEYIMGLTLLAAGSSVPDVMSSLIVAKHGMGDMALANCIGSNIFDVLC-LGLPWLLATTAVHPNSVVLIHSGHIVYVSMCLFGTVLTIVSAIHLNGWRLDRRLGVILFIAYAFFLTSAVILEAI 603          
BLAST of slc24a-7 vs. Ensembl Nematostella
Match: EDO35212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM57])

HSP 1 Score: 65.0846 bits (157), Expect = 6.538e-11
Identity = 38/145 (26.21%), Postives = 80/145 (55.17%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILV 609
            +L     L +   +    D F  P L  +++ + +SE++AG T +A G+ A ++F+S++ VT +S+  VG   G+ +   + + A+TA     +   ++  RP+L+D + Y +++ + +I     + E++ + V L +Y+ YI+V
Sbjct:    4 VLYIFAILVIFIALAIVCDDFFVPSLEAISEKLDLSEDVAGATFMAAGSSAPELFTSIAGVTVDSDVGVGTIVGSAIFNLLVIIALTAAFSGQV--LQLDWRPLLRDSVAYSLSIAFFIIFSWDGKFEMYEAAVLLILYIAYIVV 146          

HSP 2 Score: 51.9878 bits (123), Expect = 8.784e-7
Identity = 23/82 (28.05%), Postives = 49/82 (59.76%), Query Frame = 1
Query: 2119 SILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIR 2364
            SI+WI  ++  +V ++   G + N+    +GL ++A   S  D +S++ +A++ +  +  S  +G  +F++ +G+G+PF IR
Sbjct:  364 SIVWIAILSFGLVTVVGRSGCILNVDKFTMGLVIIAIGTSVPDALSSIIVARDGFGDMAVSNAIGSNVFDINLGLGLPFVIR 445          
BLAST of slc24a-7 vs. Ensembl Nematostella
Match: EDO32048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW69])

HSP 1 Score: 60.4622 bits (145), Expect = 2.089e-9
Identity = 37/152 (24.34%), Postives = 80/152 (52.63%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVF-------VNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILV 609
            +L F+  L++   +    D +  PCL ++   + +  ++AG T +ALG+ A ++F+S+  V      ++G+  G ILG+ VF       V  + AG ++ L+ +     P+++D +FY  +L+  M++ +   +    +   ++ Y +Y+L+
Sbjct:   26 VLNFIISLYMFWAVAIVCDDYFVPCLEIICDRLGLQTDVAGATFMALGSSAPELFASVIGVFITKG-DIGV--GTILGSAVFNVLFVIGVCGVGAGTVLYLAWW-----PMVRDSVFYLFSLVGLMLVLMDNVVVWSEATAMVSFYSVYLLI 169          

HSP 2 Score: 51.2174 bits (121), Expect = 1.636e-6
Identity = 42/159 (26.42%), Postives = 80/159 (50.31%), Query Frame = 1
Query: 2062 KVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRT----FSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIY 2526
             V KP   +  +  +  I  I+WI   +  +V +++V G  F I   ++GLS++AF +S  D +S++ +A+     +  S  VG  +F++L+ +GIP+ I+T    +   + +   G  I   F I+   A+ L+ +   K+   +  G I +  Y I+
Sbjct:  311 DVKKPSCEK--WVVLSFIICIVWIGVTSYVLVWMVTVIGYTFLIPDSVMGLSLVAFGSSVPDCLSSLFVARKGDGDMAVSHTVGSNVFDILLCLGIPWLIKTTVWEYDSSVVINSHGLFISCFF-ILGSIAVTLIIIWYYKWTLNKKVGCIYLVFYFIF 466          
BLAST of slc24a-7 vs. Ensembl Medaka
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:101159512])

HSP 1 Score: 140.584 bits (353), Expect = 1.133e-34
Identity = 73/199 (36.68%), Postives = 116/199 (58.29%), Query Frame = 1
Query:   64 SNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGIL----MFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPN-VGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNE 645
            +  C ++ N   C    G INY    +C       P  +    M+L+FLF++ G+T  A  F  P L  ++ ++ ++ N+AGVT LALGNGA D+FS+++A    S+P+  GLA GA+ GAGVFV  + AG + +  PF +  RP L+D++FY VA+ W  ++  +    L  +L +L++YV+Y+L  +IS  +Y R  
Sbjct:    6 AERCTFVKNTPDCDMEDGFINYLNVVFCLLPPNLTPFTITLCCMWLFFLFMILGLT--ASKFFCPNLSAISSSLHLTHNVAGVTFLALGNGAPDIFSAMAAF---SHPHTAGLAVGALFGAGVFVTTVVAGSVSLFKPFAVASRPFLRDVIFYMVAVFWTFLMLYRGTTTLGETLGYLSLYVLYVLTVIISTYIYKRQR 199          

HSP 2 Score: 126.716 bits (317), Expect = 4.540e-30
Identity = 88/263 (33.46%), Postives = 149/263 (56.65%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2544
            PVD  +WR +S   + L ++++P   +L L +P+VD     K W + LNC+H +++ V  VL      Y        F L  L ++LGF +  +V  T+  D PP Y   FA +G + S + I   A+E+V++L + GVV ++S+ +LGL++LA+ NS GD  S++T+A+  YPR+  SAC GG +FN+++G+G+   ++       VQ     +   +L  ++ L   L+ + +PL +F   R YGI L+  YVI+ ++ + 
Sbjct:  261 PVDSRKWRRKSWRWRVLKVLKTPLEVLLLLCVPVVDPDKEDKNWRRPLNCLHLVIAPVVCVLAFQSGKYGNYMIQEQFPLWVLILLLGFFLAAIVFCTTTNDHPPKYHAVFALLGFVVSAVLISAAASEVVSLLHMLGVVLSLSNTVLGLTLLAWGNSIGDCFSDITIAQQGYPRMAISACFGGIIFNMVIGVGLGCLVQMVKTNSDVQFESEGLLTWILAGSLGLSLVLSFIIVPLSQFHLGRTYGIFLLAFYVIFLIIALF 523          
BLAST of slc24a-7 vs. Ensembl Medaka
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:101159512])

HSP 1 Score: 139.428 bits (350), Expect = 1.681e-34
Identity = 73/199 (36.68%), Postives = 116/199 (58.29%), Query Frame = 1
Query:   64 SNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGIL----MFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPN-VGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNE 645
            +  C ++ N   C    G INY    +C       P  +    M+L+FLF++ G+T  A  F  P L  ++ ++ ++ N+AGVT LALGNGA D+FS+++A    S+P+  GLA GA+ GAGVFV  + AG + +  PF +  RP L+D++FY VA+ W  ++  +    L  +L +L++YV+Y+L  +IS  +Y R  
Sbjct:    6 AERCTFVKNTPDCDMEDGFINYLNVVFCLLPPNLTPFTITLCCMWLFFLFMILGLT--ASKFFCPNLSAISSSLHLTHNVAGVTFLALGNGAPDIFSAMAAF---SHPHTAGLAVGALFGAGVFVTTVVAGSVSLFKPFAVASRPFLRDVIFYMVAVFWTFLMLYRGTTTLGETLGYLSLYVLYVLTVIISTYIYKRQR 199          

HSP 2 Score: 125.946 bits (315), Expect = 6.008e-30
Identity = 88/262 (33.59%), Postives = 149/262 (56.87%), Query Frame = 1
Query: 1771 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVI 2541
            PVD  +WR +S   + L ++++P   +L L +P+VD     K W + LNC+H +++ V  VL      Y        F L  L ++LGF +  +V  T+  D PP Y   FA +G + S + I   A+E+V++L + GVV ++S+ +LGL++LA+ NS GD  S++T+A+  YPR+  SAC GG +FN+++G+G+   ++       VQ     +   +L  ++ L   L+ + +PL +F   R YGI L+  YVI+ ++ +
Sbjct:  231 PVDSRKWRRKSWRWRVLKVLKTPLEVLLLLCVPVVDPDKEDKNWRRPLNCLHLVIAPVVCVLAFQSGKYGNYMIQEQFPLWVLILLLGFFLAAIVFCTTTNDHPPKYHAVFALLGFVVSAVLISAAASEVVSLLHMLGVVLSLSNTVLGLTLLAWGNSIGDCFSDITIAQQGYPRMAISACFGGIIFNMVIGVGLGCLVQMVKTNSDVQFESEGLLTWILAGSLGLSLVLSFIIVPLSQFHLGRTYGIFLLAFYVIFLIIAL 492          
BLAST of slc24a-7 vs. Ensembl Medaka
Match: SLC24A1 (sodium/potassium/calcium exchanger 1-like [Source:NCBI gene;Acc:101160040])

HSP 1 Score: 71.2478 bits (173), Expect = 2.911e-12
Identity = 45/145 (31.03%), Postives = 77/145 (53.10%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYI 603
            +L  L  +++   +    D F  P L V+A  + +S+++AG T +A G  A ++F+SL  V   S+ NVG+  G I+G+ VF      G+  I S    ++   P+ +D+ FY + LI  +I F+   I  W S++ +  YV Y+
Sbjct:  137 VLHILGMVYIFVALAIVCDEFFVPALEVIAIKLDISDDVAGATFMAAGGSAPELFTSLIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCAIFSREMLRLTWWPLFRDVTFYILDLIMLIIFFLDNVILWWESVLLVLGYVSYV 278          
BLAST of slc24a-7 vs. Ensembl Medaka
Match: SLC24A1 (sodium/potassium/calcium exchanger 1-like [Source:NCBI gene;Acc:101160040])

HSP 1 Score: 70.8626 bits (172), Expect = 4.080e-12
Identity = 45/145 (31.03%), Postives = 77/145 (53.10%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYI 603
            +L  L  +++   +    D F  P L V+A  + +S+++AG T +A G  A ++F+SL  V   S+ NVG+  G I+G+ VF      G+  I S    ++   P+ +D+ FY + LI  +I F+   I  W S++ +  YV Y+
Sbjct:  137 VLHILGMVYIFVALAIVCDEFFVPALEVIAIKLDISDDVAGATFMAAGGSAPELFTSLIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCAIFSREMLRLTWWPLFRDVTFYILDLIMLIIFFLDNVILWWESVLLVLGYVSYV 278          
BLAST of slc24a-7 vs. Ensembl Medaka
Match: SLC24A2 (solute carrier family 24 member 2 [Source:NCBI gene;Acc:101167489])

HSP 1 Score: 69.707 bits (169), Expect = 7.668e-12
Identity = 42/146 (28.77%), Postives = 76/146 (52.05%), Query Frame = 1
Query:  175 ILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSP--FKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYIL 606
            +L     +++   +    D F  P L V+ + + +S+++AG T +A G  A ++F+S+  V   S+ NVG+  G I+G+ VF      G+  I S     +   P+ +D+ FY + LI  +I F+   I +W S+  L+ Y  Y++
Sbjct:  131 VLHMFGMIYMFIALAIVCDEFFVPALTVITEKLNISDDVAGATFMAAGGSAPELFTSIIGVFI-SHSNVGI--GTIVGSAVFNILFVIGMCAIFSKEILNLTWWPLFRDVSFYILDLIMLIIFFLDNIILVWESVTLLSAYAAYVI 273          
BLAST of slc24a-7 vs. Planmine SMEST
Match: SMESG000022803.1 (SMESG000022803.1)

HSP 1 Score: 1288.86 bits (3334), Expect = 0.000e+0
Identity = 648/648 (100.00%), Postives = 648/648 (100.00%), Query Frame = 1
Query:   22 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSXXXXXXXXXXXXXXXXXXXXVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 1965
            MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSNKTIIQTNNISITITTPATNVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSNKTIIQTNNISITITTPATNVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 648          
BLAST of slc24a-7 vs. Planmine SMEST
Match: SMESG000022803.1 (SMESG000022803.1)

HSP 1 Score: 1277.69 bits (3305), Expect = 0.000e+0
Identity = 645/648 (99.54%), Postives = 645/648 (99.54%), Query Frame = 1
Query:   22 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSXXXXXXXXXXXXXXXXXXXXVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 1965
            MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSL   AIYVIYILVTVISRLLYVRNEKSNKTIIQTNNISITITTPATNVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSL---AIYVIYILVTVISRLLYVRNEKSNKTIIQTNNISITITTPATNVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 645          
BLAST of slc24a-7 vs. Planmine SMEST
Match: SMESG000022802.1 (SMESG000022802.1)

HSP 1 Score: 856.67 bits (2212), Expect = 0.000e+0
Identity = 451/601 (75.04%), Postives = 503/601 (83.69%), Query Frame = 1
Query:  778 INRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPS--TEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2574
            I +D +SK N N   N+I IT+  P D + QENDLN     SS+ISDF  I++ RS+T  +           + GSLR  N YSYDNPNY+ DN  D    AST  S+F++NF SIN+NP  +KE + DK DHLNVP   YQ K  L+ +Q+SCP++SEC++ KR+   Y N  Q ER YN++ S   S  + + H K+S SIK+K+ S R+ + RS+SHRSI S+A+IIID EHEKER+E HP +KK N  +S+SLT++NE   K+ IR+WSM E +K+KSDITNEW I++GN+K+ PENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL
Sbjct:  352 IYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENDLNELKSDSSSISDFNCINVERSNTGVS-----------LGGSLR--NDYSYDNPNYVHDNHKDHFSRASTTLSSFKSNFSSINENPKFIKECFEDKLDHLNVPQINYQGKSRLVTTQHSCPHESECNAKKRVYD-YSNSYQFERSYNSIESTLSSLRSSIIHQKHSYSIKRKHHSARNFMTRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHFRSISLTIINESPPKTKIRFWSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 938          

HSP 2 Score: 400.593 bits (1028), Expect = 5.852e-125
Identity = 224/312 (71.79%), Postives = 255/312 (81.73%), Query Frame = 1
Query:   22 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSXXXXXXXXXXXXXXXXXXXXVENAEIQQQNIEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIG-RSDTN 954
            M  CTPL FSS NYSN C YIT F  C PNSG INY+QWQYC+F NRWAP ILM LWFLFLLTGI T+AD FLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS SNPNVGLAFG ILGAG+FVN+ITAGIIMI++PFK+MKRP++KD LFYF  LIWCM IFI++QIELWSSLVFL +Y IYILVTVISRLLYVRN KS  T I+TNN +ITI TP  NVENAEIQQ++  D  S  + + I +D RSK N+N+  N+I IT+  PND+ DQ+NDL+  M+KSS+ISDF  I+   +S TN
Sbjct:    1 MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGILGAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRNIKSKTTTIETNNSNITIRTPDLNVENAEIQQKDNRDS-STSNSVLIFKDNRSKANKNITVNNIEITVTAPNDEDDQKNDLDIAMRKSSSISDFIPIYKDIKSKTN 311          
BLAST of slc24a-7 vs. Planmine SMEST
Match: SMESG000022808.1 (SMESG000022808.1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.278e-125
Identity = 224/438 (51.14%), Postives = 298/438 (68.04%), Query Frame = 1
Query: 1300 QLERFYN--TLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKAN--LIKSLSLTVLNEYAL-KSNIRYWSM------REIQKAKSDITNEWDILEGNYKVHPENENENKFNI-ETGENGDS-VVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2574
            QL R  N  T  +E    ++    + CS K    S   +  RS SHRS+ S AKIII NEHE+E M+ +   K +   L +S+SL+ LN+ ++ K  IR++S       R I++ K +I  E    +    V  +    N   I ++  N DS  +TFPG +KHF LTILPVDL++W   S F K L+I+QSP MFILTLTI +V+E  +LKGWCKILNC+HC+LS + W+   +V   P GT  F++ YL +I+G + G+ VA TSK + PPIYQPFFAF+G ITSI WIYEI NEIVN+L   GVVF+I   ILGLS+LAFANS GDLVSN+TLAK NYPRI Y+AC+GGPLFNLLVGIG+PFSI+T   PI + L   ++VL+FTI LVT +NL+ LP++KF+  + YGIIL+TIY+++F+L+I FA ++I VT+
Sbjct:  277 QLNRNLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKCLKRSVSLSALNDCSVPKLKIRFYSADTNMAARRIEEFK-NIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 713          

HSP 2 Score: 294.664 bits (753), Expect = 1.289e-87
Identity = 156/334 (46.71%), Postives = 211/334 (63.17%), Query Frame = 1
Query:   22 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSXXXXXXXXXXXXXXXXXXXXVENAEIQQQNIEDPLSILDFISINRDER-----SKGNRNLAANSIG---ITIAVPND------KVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSH 981
            M +C P   +  NYSN C Y+ N   C  +SG +NY++WQYC F +R  P ILM LWFL LL  + T+ADSF APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSA+ S++NPNVGLA G+ILGAG+ VN ITAGIIMI+ PF+IM+RPI+KD++FY +AL+WC II ++++IE WSS+VFL+IY++Y+ VT ISR LY++ +K                      +  E   +NIE  +S+ + +  N D R      K N+N + + +    I  +  N+      KV Q N LNR +   +  ++   + I      +TSF R S 
Sbjct:    1 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKC---------------------QKQERPIENIE--VSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRNLNNPTRSAEASVVDI------RTSFHRCSR 305          
BLAST of slc24a-7 vs. Planmine SMEST
Match: SMESG000022808.1 (SMESG000022808.1)

HSP 1 Score: 355.14 bits (910), Expect = 2.102e-110
Identity = 211/438 (48.17%), Postives = 283/438 (64.61%), Query Frame = 1
Query: 1300 QLERFYN--TLPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKAN--LIKSLSLTVLNEYAL-KSNIRYWSM------REIQKAKSDITNEWDILEGNYKVHPENENENKFNI-ETGENGDS-VVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2574
            QL R  N  T  +E    ++    + CS K    S   +  RS SHRS+ S AKIII NEHE+E M+ +   K +   L +S+SL+ LN+ ++ K  IR++S       R I++ K +I  E    +    V  +    N   I ++  N DS  +TFPG +KHF LTILPVDL++W   S F K L+I+QSP MFILTLTI +V+E  +LKGWCKILNC+HC+LS + W+   +V   P GT  F++ YL +I+G + G+ VA TSK + PPIYQPFFAF+G ITSI WIYEI NEIVN+L             LGL V        DLVSN+TLAK NYPRI Y+AC+GGPLFNLLVGIG+PFSI+T   PI + L   ++VL+FTI LVT +NL+ LP++KF+  + YGIIL+TIY+++F+L+I FA ++I VT+
Sbjct:  277 QLNRNLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKCLKRSVSLSALNDCSVPKLKIRFYSADTNMAARRIEEFK-NIAVEKLKKKSISDVQNQRTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGT-----------LGLEVCEI-----DLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 697          

HSP 2 Score: 295.049 bits (754), Expect = 7.495e-88
Identity = 156/334 (46.71%), Postives = 211/334 (63.17%), Query Frame = 1
Query:   22 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRNEKSXXXXXXXXXXXXXXXXXXXXVENAEIQQQNIEDPLSILDFISINRDER-----SKGNRNLAANSIG---ITIAVPND------KVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSH 981
            M +C P   +  NYSN C Y+ N   C  +SG +NY++WQYC F +R  P ILM LWFL LL  + T+ADSF APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSA+ S++NPNVGLA G+ILGAG+ VN ITAGIIMI+ PF+IM+RPI+KD++FY +AL+WC II ++++IE WSS+VFL+IY++Y+ VT ISR LY++ +K                      +  E   +NIE  +S+ + +  N D R      K N+N + + +    I  +  N+      KV Q N LNR +   +  ++   + I      +TSF R S 
Sbjct:    1 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLKLKKC---------------------QKQERPIENIE--VSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRNLNNPTRSAEASVVDI------RTSFHRCSR 305          
The following BLAST results are available for this feature:
BLAST of slc24a-7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC8B15.642e-3935.06solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B15.187e-3834.93solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B15.187e-3834.93solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B14.890e-3539.29solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B12.098e-2936.31solute carrier family 8 member B1 [Source:HGNC Sym... [more]
back to top
BLAST of slc24a-7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncx-73.696e-3934.50Putative sodium/calcium exchanger 7 [Source:UniPr... [more]
ncx-63.001e-3631.07Putative sodium/calcium exchanger 6 [Source:UniPr... [more]
ncx-92.434e-3130.23Mitochondrial sodium/calcium exchanger protein [S... [more]
ncx-104.436e-2928.10Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q96... [more]
ncx-85.198e-2933.49Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:O16... [more]
back to top
BLAST of slc24a-7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG53481.179e-2123.37gene:FBgn0034156 transcript:FBtr0305318[more]
CG123761.209e-2127.08gene:FBgn0033323 transcript:FBtr0088706[more]
CG123761.406e-2127.08gene:FBgn0033323 transcript:FBtr0339335[more]
CG147434.758e-2123.84gene:FBgn0033326 transcript:FBtr0307023[more]
CG147445.166e-2124.19gene:FBgn0033324 transcript:FBtr0307024[more]
back to top
BLAST of slc24a-7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b11.464e-3637.56solute carrier family 8 member B1 [Source:ZFIN;Acc... [more]
CABZ01081780.15.757e-1128.08sodium/potassium/calcium exchanger 2-like [Source:... [more]
slc24a17.912e-1128.78solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
slc24a17.912e-1128.78solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
slc24a19.406e-1128.99solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc24a-7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b13.983e-4030.29solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b12.961e-3930.29solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b11.983e-3831.56solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b16.272e-3831.56solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b13.497e-2938.18solute carrier family 8 (sodium/lithium/calcium ex... [more]
back to top
BLAST of slc24a-7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc8b11.870e-3834.56solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b11.017e-3734.80solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b11.254e-3734.56solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b13.883e-3035.21solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc24a22.396e-1128.77solute carrier family 24 (sodium/potassium/calcium... [more]
back to top
BLAST of slc24a-7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AXS0|NCLX_RAT3.463e-3834.93Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|P34322|NCX7_CAEEL4.701e-3834.50Putative sodium/calcium exchanger 7 OS=Caenorhabdi... [more]
sp|Q6J4K2|NCLX_HUMAN2.491e-3734.93Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|Q925Q3|NCLX_MOUSE8.770e-3734.56Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|P34315|NCX6_CAEEL3.817e-3531.07Putative sodium/calcium exchanger 6 OS=Caenorhabdi... [more]
back to top
BLAST of slc24a-7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFD70.000e+0100.00Slc24a-7 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKA10.000e+073.30Slc24a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YF406.032e-10543.20Slc24a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1X7V3752.416e-5926.10Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A2T7PD601.451e-5538.44Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of slc24a-7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b11.072e-3435.92solute carrier family 8 member B1 [Source:NCBI gen... [more]
SLC24A23.283e-1228.08solute carrier family 24 member 2 [Source:NCBI gen... [more]
SLC24A23.584e-1228.08solute carrier family 24 member 2 [Source:NCBI gen... [more]
SLC24A24.443e-1228.08solute carrier family 24 member 2 [Source:NCBI gen... [more]
SLC24A25.943e-1228.08solute carrier family 24 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc24a-7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC8B13.083e-3533.10solute carrier family 8 member B1 [Source:HGNC Sym... [more]
slc24a11.193e-1330.14solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
slc24a4b6.970e-927.21solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
back to top
BLAST of slc24a-7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YDL206W_mRNA2.151e-850.91Putative protein of unknown function; YDL206W is n... [more]
ECM272.384e-726.21Protein involved in calcium homeostasis and exit f... [more]
back to top
BLAST of slc24a-7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO319502.102e-2631.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414216.721e-1329.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480062.269e-1222.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352126.538e-1126.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320482.089e-924.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc24a-7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b11.133e-3436.68solute carrier family 8 member B1 [Source:NCBI gen... [more]
slc8b11.681e-3436.68solute carrier family 8 member B1 [Source:NCBI gen... [more]
SLC24A12.911e-1231.03sodium/potassium/calcium exchanger 1-like [Source:... [more]
SLC24A14.080e-1231.03sodium/potassium/calcium exchanger 1-like [Source:... [more]
SLC24A27.668e-1228.77solute carrier family 24 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc24a-7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022803.10.000e+0100.00SMESG000022803.1[more]
SMESG000022803.10.000e+099.54SMESG000022803.1[more]
SMESG000022802.15.852e-12575.04SMESG000022802.1[more]
SMESG000022808.11.278e-12551.14SMESG000022808.1[more]
SMESG000022808.12.102e-11048.17SMESG000022808.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027012
GenBankAKN21567.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027012 ID=SMED30027012|Name=slc24a-7|organism=Schmidtea mediterranea sexual|type=transcript|length=2659bp
TAATTTGATTATAAGCGTTGTATGGCCGCCTGTACACCTTTAAAGTTCAG
TAGCTTTAACTACTCGAATGCATGTGATTATATCACCAACTTCAAAGGAT
GTTCACCGAATTCGGGACTCATTAATTACTACCAATGGCAGTATTGCGCA
TTTGGTAATCGTTGGGCCCCAGGAATACTTATGTTTCTTTGGTTTTTATT
TTTGCTTACCGGAATAACAACATCAGCTGACAGTTTTTTGGCACCGTGCC
TTGTTGTAGTTGCAAAAACAATGAGAATGAGTGAAAACTTAGCAGGAGTT
ACTTTATTAGCGCTGGGAAATGGTGCTGCTGATGTATTTAGTTCCCTCTC
AGCAGTTACATCAAACAGCAATCCAAATGTTGGTTTAGCTTTTGGAGCAA
TTTTAGGAGCTGGAGTATTCGTGAATGCAATTACTGCTGGTATAATTATG
ATCCTTTCTCCTTTCAAAATTATGAAGAGGCCAATTTTAAAGGACTTGTT
GTTTTATTTTGTTGCTTTAATTTGGTGCATGATTATTTTTATCAAAAAAC
AGATTGAGTTGTGGTCTTCGTTAGTGTTTTTAGCAATCTACGTCATCTAT
ATTTTGGTCACAGTAATTTCAAGATTACTTTATGTTCGCAATGAAAAATC
AAATAAAACAATCATTCAAACAAATAATATAAGCATAACAATCACAACAC
CTGCTACGAATGTAGAAAATGCTGAGATTCAACAACAAAACATCGAGGAC
CCTCTGTCAATTTTAGATTTCATTTCCATTAATAGAGATGAAAGATCTAA
AGGAAATAGAAATTTAGCAGCAAACAGTATTGGGATCACAATTGCTGTAC
CAAATGATAAAGTTGATCAAGAAAATGATTTGAATAGACCAATGAAGAAA
TCATCTACGATTTCAGATTTCAGGAGCATTCATATAGGAAGATCAGATAC
AAATCAGACAAGCTTTCCAAGATTTTCTCATTTAAAAAGTCATATTGCAG
GAAGTTTGAGAACTAATAATGTCTATTCATATGACAATCCAAATTATATT
TCCGACAACTCAATTGACCGTGTTTATATAGCGTCAACCAATCGGTCGAA
TTTTGAAAATAATTTCCATTCCATTAATGACAACCCGAATTCTCTGAAGG
AACTTTATGCAGACAAATCAGATCATTTAAATGTTCCTGGAAACATTTAT
CAAAAAAAGCCTAATTTAATTAAATCTCAAAATTCTTGTCCGAATGACTC
AGAATGTCATTCACATAAAAGAATCTTAAGTGGTTATTTAAATCCACTTC
AACTCGAGAGATTTTACAACACTTTGCCCTCAGAAAGACCTTCAACGGAA
GTTAATCATCTAAAATACTCTTGTTCCATAAAACAAAAGAATCTTTCTCC
TCGAAGTTCCATAGAGAGATCCGCAAGTCATCGATCAATCAGGTCTATGG
CAAAAATAATAATAGATAATGAACACGAGAAAGAAAGAATGGAAAATCAT
CCAACAGCAAAAAAGGCAAATCTTATTAAATCCCTTTCATTGACAGTATT
AAACGAGTATGCACTTAAATCTAATATAAGATATTGGTCAATGAGAGAAA
TTCAAAAAGCAAAATCAGATATTACAAATGAATGGGACATTTTAGAAGGA
AATTATAAAGTCCATCCAGAAAATGAAAATGAAAATAAATTTAACATTGA
AACGGGTGAAAATGGAGATTCCGTCGTTACTTTTCCAGGCCCGTGGAAAC
ATTTTGCATTGACGATTTTACCTGTAGACTTGGAAGAATGGCGAGAGCAG
TCGGGTTTCTCAAAGTTTCTCTCAATTATTCAATCTCCTTTTATGTTTAT
TTTAACATTAACAATTCCAATAGTTGATGAAACTGCTTATCTCAAAGGCT
GGTGTAAAATCCTGAACTGTATTCACTGTTTATTATCCCTTGTTTTTTGG
GTCTTACTGCCTAATGTATACAATACCCCTTTTGGAACGAGTAACTTCTT
GTTGGTATATTTATTCATAATTTTGGGATTTATTGTCGGTGTTGTTGTCG
CATTTACCTCAAAAGTCGACAAACCTCCAATATATCAGCCATTCTTTGCT
TTTATTGGCCTCATCACTTCAATATTGTGGATATATGAAATTGCAAATGA
AATAGTCAACATTCTTTCAGTTTTTGGAGTAGTTTTCAATATATCTTCCG
TGATTTTAGGGCTGAGTGTATTGGCCTTTGCTAATTCAACCGGAGATTTG
GTTTCCAATGTCACTCTTGCGAAAAATAATTATCCACGGATTGGTTATTC
AGCTTGTGTTGGAGGTCCACTCTTTAATCTTTTAGTTGGAATTGGAATTC
CATTTTCAATTAGGACTTTCAGTGGTCCTATACCAGTTCAGCTAACAGGA
ACTTCAATTGTTTTAATATTCACAATCATGCTAGTTACCGCCTTGAACTT
GTTATGCTTACCCTTGATGAAGTTTCAACCAAAAAGATTTTACGGAATAA
TTCTGATAACCATATATGTCATATATTTTGTTTTGGTCATTCTTTTTGCT
GTTGATATTATCAAAGTTACGTTATAAAGATAGATTAGATTATATATATT
AGGTTAATTACTTATTTTTTATGATGGATGTATTTTCAGATTTTATTAAA
ACAAAGGCC
back to top

protein sequence of SMED30027012-orf-1

>SMED30027012-orf-1 ID=SMED30027012-orf-1|Name=SMED30027012-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=852bp
MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAP
GILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGN
GAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKI
MKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVIS
RLLYVRNEKSNKTIIQTNNISITITTPATNVENAEIQQQNIEDPLSILDF
ISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDF
RSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDR
VYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLI
KSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVNHLKYS
CSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKAN
LIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPE
NENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFL
SIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVY
NTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITS
ILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLA
KNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIF
TIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVT
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000047collecting duct
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR004837NaCa_Exmemb
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport