Non-specific serine/threonine protein kinase

Overview
NameNon-specific serine/threonine protein kinase
Smed IDSMED30027002
Length (bp)2600
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Non-specific serine/threonine protein kinase (SMED30027002) t-SNE clustered cells

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30027002) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Non-specific serine/threonine protein kinase (SMED30027002) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30027002) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027002

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027002h1SMcG0003530 dd_Smed_v4_7408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027002h1SMcG0003530 dd_Smed_v4_7408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 352.058 bits (902), Expect = 4.902e-112
Identity = 169/278 (60.79%), Postives = 205/278 (73.74%), Query Frame = 2
Query:  839 SPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +P  +V T  +  T ++ TP D                  R+ + ++     S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  114 TPTRDVATSPISPTENNTTPPDA---------------LTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALY 376          

HSP 2 Score: 65.4698 bits (158), Expect = 2.388e-10
Identity = 29/48 (60.42%), Postives = 38/48 (79.17%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLK 1799
            L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+
Sbjct:  372 LRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQ 419          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 352.443 bits (903), Expect = 2.595e-111
Identity = 169/278 (60.79%), Postives = 205/278 (73.74%), Query Frame = 2
Query:  839 SPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +P  +V T  +  T ++ TP D                  R+ + ++     S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  212 TPTRDVATSPISPTENNTTPPDA---------------LTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALY 474          

HSP 2 Score: 68.9366 bits (167), Expect = 1.961e-11
Identity = 30/55 (54.55%), Postives = 42/55 (76.36%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKH 1802
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+H
Sbjct:  464 YLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQH 518          

HSP 3 Score: 59.3066 bits (142), Expect = 2.584e-8
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   73 PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 352.829 bits (904), Expect = 4.033e-111
Identity = 169/278 (60.79%), Postives = 205/278 (73.74%), Query Frame = 2
Query:  839 SPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +P  +V T  +  T ++ TP D                  R+ + ++     S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  212 TPTRDVATSPISPTENNTTPPDA---------------LTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALY 474          

HSP 2 Score: 82.8037 bits (203), Expect = 9.133e-16
Identity = 40/80 (50.00%), Postives = 59/80 (73.75%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+H+F+   +KP+S L PLI  A+E ++
Sbjct:  464 YLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLK-IAKPLSSLTPLIAAAKEATK 542          

HSP 3 Score: 58.9214 bits (141), Expect = 2.766e-8
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   73 PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 351.673 bits (901), Expect = 1.279e-110
Identity = 169/278 (60.79%), Postives = 205/278 (73.74%), Query Frame = 2
Query:  839 SPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +P  +V T  +  T ++ TP D                  R+ + ++     S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  212 TPTRDVATSPISPTENNTTPPDA---------------LTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALY 474          

HSP 2 Score: 65.4698 bits (158), Expect = 2.967e-10
Identity = 29/54 (53.70%), Postives = 41/54 (75.93%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLK 1799
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+
Sbjct:  464 YLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQ 517          

HSP 3 Score: 58.9214 bits (141), Expect = 2.725e-8
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   73 PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 350.903 bits (899), Expect = 1.910e-110
Identity = 163/246 (66.26%), Postives = 195/246 (79.27%), Query Frame = 2
Query:  935 NQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            N + +   R+   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  227 NANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 472          

HSP 2 Score: 82.8037 bits (203), Expect = 1.075e-15
Identity = 40/77 (51.95%), Postives = 57/77 (74.03%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLI+ A+E
Sbjct:  462 YLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK-LAKPLSSLTPLIIAAKE 537          

HSP 3 Score: 58.151 bits (139), Expect = 5.319e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   68 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 117          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 334.724 bits (857), Expect = 6.456e-105
Identity = 156/233 (66.95%), Postives = 190/233 (81.55%), Query Frame = 2
Query:  974 RRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            ++A +  +    ++KL+ +VS  +P  KY  +D+IG GASG V    ++ T+ +VAIKQMNLK QPKK+LI+NEILV++ NKH NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE  M++  IA +CREV  AL FLHS HVIHRDIKSDNILLG+DGSVK+ DFGFCAQL   +  R+TMVGTPYWMAPEVVTRKQYGPKVD+WSLGIM IEM+EGEPPYLNENPLRA++
Sbjct:  218 QKAKKKMTDAEVLTKLRTIVSIGNPDRKYRKVDKIGSGASGSVYTAIEISTEAEVAIKQMNLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVTECQMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSPEQRKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIY 450          

HSP 2 Score: 57.7658 bits (138), Expect = 2.296e-8
Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L A+YLIATNGKP      +++ LF DF+D  LEV ++ R SAS LL H F+   +KP++ L  LI+ A++
Sbjct:  446 LRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFLR-CAKPLASLYYLIVAAKK 515          

HSP 3 Score: 56.225 bits (134), Expect = 7.817e-8
Identity = 24/50 (48.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P IS P+   H  HV +DP TG+F G+P +W   L  S ISK EQ+ NP+
Sbjct:   19 PVISRPSNFEHTIHVGYDPKTGEFTGMPEAWARLLTDSQISKQEQQQNPQ 68          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 335.88 bits (860), Expect = 7.231e-105
Identity = 156/233 (66.95%), Postives = 190/233 (81.55%), Query Frame = 2
Query:  974 RRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            ++A +  +    ++KL+ +VS  +P  KY  +D+IG GASG V    ++ T+ +VAIKQMNLK QPKK+LI+NEILV++ NKH NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE  M++  IA +CREV  AL FLHS HVIHRDIKSDNILLG+DGSVK+ DFGFCAQL   +  R+TMVGTPYWMAPEVVTRKQYGPKVD+WSLGIM IEM+EGEPPYLNENPLRA++
Sbjct:  264 QKAKKKMTDAEVLTKLRTIVSIGNPDRKYRKVDKIGSGASGSVYTAIEISTEAEVAIKQMNLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVTECQMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSPEQRKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIY 496          

HSP 2 Score: 59.3066 bits (142), Expect = 9.388e-9
Identity = 43/107 (40.19%), Postives = 56/107 (52.34%), Query Frame = 2
Query:   77 ELPPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXFNYND------PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            E PPAPPIR SS+  R+++  V         +  KKKKT      K N +       P IS P+   H  HV +DP TG+F G+P +W   L  S ISK EQ+ NP+
Sbjct:    9 EKPPAPPIRFSSSATRENQV-VGLKPLPKEPEATKKKKTMPNPFMKKNKDKKEASEKPVISRPSNFEHTIHVGYDPKTGEFTGMPEAWARLLTDSQISKQEQQQNPQ 114          

HSP 3 Score: 57.3806 bits (137), Expect = 3.241e-8
Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L A+YLIATNGKP      +++ LF DF+D  LEV ++ R SAS LL H F+   +KP++ L  LI+ A++
Sbjct:  492 LRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFLR-CAKPLASLYYLIVAAKK 561          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 335.495 bits (859), Expect = 1.186e-104
Identity = 156/233 (66.95%), Postives = 190/233 (81.55%), Query Frame = 2
Query:  974 RRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            ++A +  +    ++KL+ +VS  +P  KY  +D+IG GASG V    ++ T+ +VAIKQMNLK QPKK+LI+NEILV++ NKH NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE  M++  IA +CREV  AL FLHS HVIHRDIKSDNILLG+DGSVK+ DFGFCAQL   +  R+TMVGTPYWMAPEVVTRKQYGPKVD+WSLGIM IEM+EGEPPYLNENPLRA++
Sbjct:  267 QKAKKKMTDAEVLTKLRTIVSIGNPDRKYRKVDKIGSGASGSVYTAIEISTEAEVAIKQMNLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVTECQMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSPEQRKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIY 499          

HSP 2 Score: 59.3066 bits (142), Expect = 9.837e-9
Identity = 43/107 (40.19%), Postives = 56/107 (52.34%), Query Frame = 2
Query:   77 ELPPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXFNYND------PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            E PPAPPIR SS+  R+++  V         +  KKKKT      K N +       P IS P+   H  HV +DP TG+F G+P +W   L  S ISK EQ+ NP+
Sbjct:    9 EKPPAPPIRFSSSATRENQV-VGLKPLPKEPEATKKKKTMPNPFMKKNKDKKEASEKPVISRPSNFEHTIHVGYDPKTGEFTGMPEAWARLLTDSQISKQEQQQNPQ 114          

HSP 3 Score: 57.3806 bits (137), Expect = 3.253e-8
Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L A+YLIATNGKP      +++ LF DF+D  LEV ++ R SAS LL H F+   +KP++ L  LI+ A++
Sbjct:  495 LRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFLR-CAKPLASLYYLIVAAKK 564          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 254.603 bits (649), Expect = 7.422e-82
Identity = 115/222 (51.80%), Postives = 169/222 (76.13%), Query Frame = 2
Query: 1010 ISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMN-NELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +++L+ +V+ S+P  KYE+  +IG GASG V       +   VA+K+M  K QPKK+++L EI V+K  +H N+VNY++S++++ ++LWVVM+YL+GG+LTDVV +  +DE QIA + +E   AL FLH + ++HRDIKSDN+LLG++G VK+ D GFCAQ+  G + R T+VGTPYWM+PE++ +KQY  KVD+WSLGIM +EM++GEPPYL E PL+A++
Sbjct:  363 LNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPG-SKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIY 583          

HSP 2 Score: 70.4774 bits (171), Expect = 7.422e-82
Identity = 37/72 (51.39%), Postives = 48/72 (66.67%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQ 1871
            L A+YLIA NGKP +K    +S  F +FLD+CL VD D+RA  + LL H F+  K+KP+S LIP I   RE+
Sbjct:  579 LKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLK-KAKPLSSLIPYIRAVREK 649          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 254.603 bits (649), Expect = 7.426e-82
Identity = 115/222 (51.80%), Postives = 169/222 (76.13%), Query Frame = 2
Query: 1010 ISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMN-NELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +++L+ +V+ S+P  KYE+  +IG GASG V       +   VA+K+M  K QPKK+++L EI V+K  +H N+VNY++S++++ ++LWVVM+YL+GG+LTDVV +  +DE QIA + +E   AL FLH + ++HRDIKSDN+LLG++G VK+ D GFCAQ+  G + R T+VGTPYWM+PE++ +KQY  KVD+WSLGIM +EM++GEPPYL E PL+A++
Sbjct:  312 LNQLREIVNPSNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPG-SKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIY 532          

HSP 2 Score: 70.4774 bits (171), Expect = 7.426e-82
Identity = 37/72 (51.39%), Postives = 48/72 (66.67%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQ 1871
            L A+YLIA NGKP +K    +S  F +FLD+CL VD D+RA  + LL H F+  K+KP+S LIP I   RE+
Sbjct:  528 LKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLK-KAKPLSSLIPYIRAVREK 598          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334540)

HSP 1 Score: 349.747 bits (896), Expect = 5.306e-113
Identity = 161/229 (70.31%), Postives = 189/229 (82.53%), Query Frame = 2
Query:  986 RHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +  S E  + KL+ +VS  DP  KY  +++IGQGASG V    +  T  +VAIKQMNL QQPKK+LI+NEILV++ NKH N+VNYLDS++++ ELWVVMEYL GGSLTDVVTE CMDE QIA +CREV  AL FLH+N VIHRDIKSDNILLGLDGSVK+ DFGFCAQ+   ++ R+TMVGTPYWMAPEVVTRKQYGPKVDLWSLGIM IEM+EGEPPYLNENPL+AL+
Sbjct:  542 KKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALY 770          

HSP 2 Score: 79.337 bits (194), Expect = 5.306e-113
Identity = 40/74 (54.05%), Postives = 56/74 (75.68%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            L ALYLIATNGKP +K+   +S  F DFLD+CLEV++D+RASA  LLKH F+   ++P++ L PLI+ A+E ++
Sbjct:  766 LKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL-KLARPLASLTPLIMAAKEATK 838          

HSP 3 Score: 59.3066 bits (142), Expect = 1.499e-8
Identity = 27/50 (54.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P IS PT   H  HV FD  TG+F G+P +W   L  SNISK EQK NP+
Sbjct:   81 PNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQ 130          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334542)

HSP 1 Score: 349.747 bits (896), Expect = 5.306e-113
Identity = 161/229 (70.31%), Postives = 189/229 (82.53%), Query Frame = 2
Query:  986 RHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +  S E  + KL+ +VS  DP  KY  +++IGQGASG V    +  T  +VAIKQMNL QQPKK+LI+NEILV++ NKH N+VNYLDS++++ ELWVVMEYL GGSLTDVVTE CMDE QIA +CREV  AL FLH+N VIHRDIKSDNILLGLDGSVK+ DFGFCAQ+   ++ R+TMVGTPYWMAPEVVTRKQYGPKVDLWSLGIM IEM+EGEPPYLNENPL+AL+
Sbjct:  542 KKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALY 770          

HSP 2 Score: 79.337 bits (194), Expect = 5.306e-113
Identity = 40/74 (54.05%), Postives = 56/74 (75.68%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            L ALYLIATNGKP +K+   +S  F DFLD+CLEV++D+RASA  LLKH F+   ++P++ L PLI+ A+E ++
Sbjct:  766 LKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL-KLARPLASLTPLIMAAKEATK 838          

HSP 3 Score: 59.3066 bits (142), Expect = 1.499e-8
Identity = 27/50 (54.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P IS PT   H  HV FD  TG+F G+P +W   L  SNISK EQK NP+
Sbjct:   81 PNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQ 130          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334543)

HSP 1 Score: 349.747 bits (896), Expect = 5.306e-113
Identity = 161/229 (70.31%), Postives = 189/229 (82.53%), Query Frame = 2
Query:  986 RHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +  S E  + KL+ +VS  DP  KY  +++IGQGASG V    +  T  +VAIKQMNL QQPKK+LI+NEILV++ NKH N+VNYLDS++++ ELWVVMEYL GGSLTDVVTE CMDE QIA +CREV  AL FLH+N VIHRDIKSDNILLGLDGSVK+ DFGFCAQ+   ++ R+TMVGTPYWMAPEVVTRKQYGPKVDLWSLGIM IEM+EGEPPYLNENPL+AL+
Sbjct:  542 KKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALY 770          

HSP 2 Score: 79.337 bits (194), Expect = 5.306e-113
Identity = 40/74 (54.05%), Postives = 56/74 (75.68%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            L ALYLIATNGKP +K+   +S  F DFLD+CLEV++D+RASA  LLKH F+   ++P++ L PLI+ A+E ++
Sbjct:  766 LKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL-KLARPLASLTPLIMAAKEATK 838          

HSP 3 Score: 59.3066 bits (142), Expect = 1.499e-8
Identity = 27/50 (54.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P IS PT   H  HV FD  TG+F G+P +W   L  SNISK EQK NP+
Sbjct:   81 PNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQ 130          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334541)

HSP 1 Score: 349.747 bits (896), Expect = 5.306e-113
Identity = 161/229 (70.31%), Postives = 189/229 (82.53%), Query Frame = 2
Query:  986 RHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +  S E  + KL+ +VS  DP  KY  +++IGQGASG V    +  T  +VAIKQMNL QQPKK+LI+NEILV++ NKH N+VNYLDS++++ ELWVVMEYL GGSLTDVVTE CMDE QIA +CREV  AL FLH+N VIHRDIKSDNILLGLDGSVK+ DFGFCAQ+   ++ R+TMVGTPYWMAPEVVTRKQYGPKVDLWSLGIM IEM+EGEPPYLNENPL+AL+
Sbjct:  542 KKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALY 770          

HSP 2 Score: 79.337 bits (194), Expect = 5.306e-113
Identity = 40/74 (54.05%), Postives = 56/74 (75.68%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            L ALYLIATNGKP +K+   +S  F DFLD+CLEV++D+RASA  LLKH F+   ++P++ L PLI+ A+E ++
Sbjct:  766 LKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL-KLARPLASLTPLIMAAKEATK 838          

HSP 3 Score: 59.3066 bits (142), Expect = 1.499e-8
Identity = 27/50 (54.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P IS PT   H  HV FD  TG+F G+P +W   L  SNISK EQK NP+
Sbjct:   81 PNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQ 130          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 347.821 bits (891), Expect = 1.261e-112
Identity = 161/229 (70.31%), Postives = 189/229 (82.53%), Query Frame = 2
Query:  986 RHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +  S E  + KL+ +VS  DP  KY  +++IGQGASG V    +  T  +VAIKQMNL QQPKK+LI+NEILV++ NKH N+VNYLDS++++ ELWVVMEYL GGSLTDVVTE CMDE QIA +CREV  AL FLH+N VIHRDIKSDNILLGLDGSVK+ DFGFCAQ+   ++ R+TMVGTPYWMAPEVVTRKQYGPKVDLWSLGIM IEM+EGEPPYLNENPL+AL+
Sbjct:  406 KKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALY 634          

HSP 2 Score: 80.1073 bits (196), Expect = 1.261e-112
Identity = 40/74 (54.05%), Postives = 56/74 (75.68%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            L ALYLIATNGKP +K+   +S  F DFLD+CLEV++D+RASA  LLKH F+   ++P++ L PLI+ A+E ++
Sbjct:  630 LKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLK-LARPLASLTPLIMAAKEATK 702          

HSP 3 Score: 59.6918 bits (143), Expect = 9.515e-9
Identity = 27/50 (54.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P IS PT   H  HV FD  TG+F G+P +W   L  SNISK EQK NP+
Sbjct:   81 PNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQ 130          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 335.109 bits (858), Expect = 1.052e-109
Identity = 158/239 (66.11%), Postives = 191/239 (79.92%), Query Frame = 2
Query:  974 RRADRHCSG------EFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            + AD+   G      E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQ+NL++QPKK+LI+NEILV+K  K+ NIVN+LDSF++ +EL+VVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLH+N VIHRDIKSDN+LLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  209 KAADKQKKGKGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 447          

HSP 2 Score: 83.5741 bits (205), Expect = 1.052e-109
Identity = 40/71 (56.34%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +SP+F DFL+RCLE+D++KR     LL+H F+   +KP+S L PLIL A+E
Sbjct:  443 LRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLK-LAKPLSSLTPLILAAKE 512          

HSP 3 Score: 61.2326 bits (147), Expect = 3.601e-9
Identity = 39/112 (34.82%), Postives = 56/112 (50.00%), Query Frame = 2
Query:   83 PPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXF-------------NYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            PPAPP+R SST     + S+S    S P+    ++K    +                 +   P+IS+P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   11 PPAPPVRMSSTFSTGIKDSMSTNPSSKPLPSVPEEKRDKPRNKIISIFSAEKGRKKDKDKERPEISNPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 335.109 bits (858), Expect = 1.172e-109
Identity = 158/239 (66.11%), Postives = 191/239 (79.92%), Query Frame = 2
Query:  974 RRADRHCSG------EFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            + AD+   G      E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQ+NL++QPKK+LI+NEILV+K  K+ NIVN+LDSF++ +EL+VVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLH+N VIHRDIKSDN+LLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  208 KAADKQKKGKGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 446          

HSP 2 Score: 83.5741 bits (205), Expect = 1.172e-109
Identity = 40/71 (56.34%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +SP+F DFL+RCLE+D++KR     LL+H F+   +KP+S L PLIL A+E
Sbjct:  442 LRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLK-LAKPLSSLTPLILAAKE 511          

HSP 3 Score: 61.2326 bits (147), Expect = 3.657e-9
Identity = 39/112 (34.82%), Postives = 56/112 (50.00%), Query Frame = 2
Query:   83 PPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXF-------------NYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            PPAPP+R SST     + S+S    S P+    ++K    +                 +   P+IS+P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   11 PPAPPVRMSSTFSTGIKDSMSTNPSSKPLPSVPEEKRDKPRNKIISIFSAEKGRKKDKDKERPEISNPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 335.109 bits (858), Expect = 1.172e-109
Identity = 158/239 (66.11%), Postives = 191/239 (79.92%), Query Frame = 2
Query:  974 RRADRHCSG------EFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            + AD+   G      E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQ+NL++QPKK+LI+NEILV+K  K+ NIVN+LDSF++ +EL+VVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLH+N VIHRDIKSDN+LLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  208 KAADKQKKGKGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 446          

HSP 2 Score: 83.5741 bits (205), Expect = 1.172e-109
Identity = 40/71 (56.34%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +SP+F DFL+RCLE+D++KR     LL+H F+   +KP+S L PLIL A+E
Sbjct:  442 LRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLK-LAKPLSSLTPLILAAKE 511          

HSP 3 Score: 61.2326 bits (147), Expect = 3.657e-9
Identity = 39/112 (34.82%), Postives = 56/112 (50.00%), Query Frame = 2
Query:   83 PPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXF-------------NYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            PPAPP+R SST     + S+S    S P+    ++K    +                 +   P+IS+P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   11 PPAPPVRMSSTFSTGIKDSMSTNPSSKPLPSVPEEKRDKPRNKIISIFSAEKGRKKDKDKERPEISNPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 335.109 bits (858), Expect = 1.172e-109
Identity = 158/239 (66.11%), Postives = 191/239 (79.92%), Query Frame = 2
Query:  974 RRADRHCSG------EFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            + AD+   G      E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQ+NL++QPKK+LI+NEILV+K  K+ NIVN+LDSF++ +EL+VVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLH+N VIHRDIKSDN+LLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  208 KAADKQKKGKGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 446          

HSP 2 Score: 83.5741 bits (205), Expect = 1.172e-109
Identity = 40/71 (56.34%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +SP+F DFL+RCLE+D++KR     LL+H F+   +KP+S L PLIL A+E
Sbjct:  442 LRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLK-LAKPLSSLTPLILAAKE 511          

HSP 3 Score: 61.2326 bits (147), Expect = 3.657e-9
Identity = 39/112 (34.82%), Postives = 56/112 (50.00%), Query Frame = 2
Query:   83 PPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXF-------------NYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            PPAPP+R SST     + S+S    S P+    ++K    +                 +   P+IS+P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   11 PPAPPVRMSSTFSTGIKDSMSTNPSSKPLPSVPEEKRDKPRNKIISIFSAEKGRKKDKDKERPEISNPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 348.206 bits (892), Expect = 4.396e-109
Identity = 160/229 (69.87%), Postives = 188/229 (82.10%), Query Frame = 2
Query:  986 RHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +  S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLH N VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  280 KKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHCNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALY 508          

HSP 2 Score: 83.9593 bits (206), Expect = 3.537e-16
Identity = 40/80 (50.00%), Postives = 60/80 (75.00%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+H+F+   +KP+S L PLI+ A+E ++
Sbjct:  498 YLNENPLRALYLIATNGTPELQNPEKLSAVFRDFLNRCLEMDVEKRGSAKELLQHQFLK-VAKPLSSLTPLIIAAKEAAK 576          

HSP 3 Score: 58.5362 bits (140), Expect = 3.026e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   72 PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQ 121          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 352.058 bits (902), Expect = 2.132e-114
Identity = 164/246 (66.67%), Postives = 195/246 (79.27%), Query Frame = 2
Query:  935 NQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            N S +   R+   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  232 NSSTSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 477          

HSP 2 Score: 82.8037 bits (203), Expect = 2.132e-114
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLI+ A+E
Sbjct:  473 LRALYLIATNGTPELQNPERLSAIFRDFLNRCLEMDVDRRGSAKELLQHPFLK-LAKPLSSLTPLIIAAKE 542          

HSP 3 Score: 58.5362 bits (140), Expect = 4.085e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   68 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 117          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 351.288 bits (900), Expect = 3.662e-114
Identity = 164/246 (66.67%), Postives = 195/246 (79.27%), Query Frame = 2
Query:  935 NQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            N S +   R+   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  180 NSSTSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 425          

HSP 2 Score: 83.1889 bits (204), Expect = 3.662e-114
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLI+ A+E
Sbjct:  421 LRALYLIATNGTPELQNPERLSAIFRDFLNRCLEMDVDRRGSAKELLQHPFL-KLAKPLSSLTPLIIAAKE 490          

HSP 3 Score: 58.5362 bits (140), Expect = 3.842e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   16 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 65          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 343.199 bits (879), Expect = 5.199e-111
Identity = 159/224 (70.98%), Postives = 185/224 (82.59%), Query Frame = 2
Query: 1001 EFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NKH NIVNYLDS+++  ELWVVMEYL GGSLTDVVTE CM E +IA +CRE   AL FLHSN VIHRDIKSDNILLG+DG+VK+ DFGFCAQ+   +N RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  146 EEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYIAVDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKHPNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQISPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALY 369          

HSP 2 Score: 80.4925 bits (197), Expect = 5.199e-111
Identity = 38/71 (53.52%), Postives = 50/71 (70.42%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P   SP F DFL RCLE+D++KR SA  LL+H F+   +KP+S L P I+  ++
Sbjct:  365 LRALYLIATNGTPQLQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLLQHPFL-KVAKPMSSLTPYIITGKQ 434          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 351.288 bits (900), Expect = 2.169e-110
Identity = 164/246 (66.67%), Postives = 195/246 (79.27%), Query Frame = 2
Query:  935 NQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            N S +   R+   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  247 NSSTSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 492          

HSP 2 Score: 82.8037 bits (203), Expect = 8.983e-16
Identity = 40/77 (51.95%), Postives = 57/77 (74.03%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLI+ A+E
Sbjct:  482 YLNENPLRALYLIATNGTPELQNPERLSAIFRDFLNRCLEMDVDRRGSAKELLQHPFLK-LAKPLSSLTPLIIAAKE 557          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: taf3 (TATA-box binding protein associated factor 3 [Source:Xenbase;Acc:XB-GENE-940280])

HSP 1 Score: 336.65 bits (862), Expect = 1.596e-109
Identity = 156/226 (69.03%), Postives = 188/226 (83.19%), Query Frame = 2
Query:  995 SGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQ+NL++QPKK+LI+NEILV+K  K+ NIVN+LDSF++++EL+VVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLH+N VIHRDIKSDN+LLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  222 SDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVSDELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 447          

HSP 2 Score: 82.0333 bits (201), Expect = 1.596e-109
Identity = 41/71 (57.75%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L+ P  +SP+F DFL+R LE+D++KR SA  LL+H F+   +KP+S L PLIL A+E
Sbjct:  443 LRALYLIATNGTPELQKPEKLSPIFRDFLNRSLEMDVEKRGSARELLQHPFLK-LAKPLSSLTPLILAAKE 512          

HSP 3 Score: 58.9214 bits (141), Expect = 2.389e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   66 PEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQ 115          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 350.903 bits (899), Expect = 3.163e-114
Identity = 162/238 (68.07%), Postives = 192/238 (80.67%), Query Frame = 2
Query:  959 RHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            R+   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  235 RNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 472          

HSP 2 Score: 82.8037 bits (203), Expect = 3.163e-114
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLI+ A+E
Sbjct:  468 LRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK-LAKPLSSLTPLIIAAKE 537          

HSP 3 Score: 58.5362 bits (140), Expect = 3.127e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   68 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 117          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 350.903 bits (899), Expect = 3.163e-114
Identity = 162/238 (68.07%), Postives = 192/238 (80.67%), Query Frame = 2
Query:  959 RHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            R+   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  235 RNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 472          

HSP 2 Score: 82.8037 bits (203), Expect = 3.163e-114
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLI+ A+E
Sbjct:  468 LRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK-LAKPLSSLTPLIIAAKE 537          

HSP 3 Score: 58.5362 bits (140), Expect = 3.127e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   68 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 117          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 350.903 bits (899), Expect = 3.163e-114
Identity = 162/238 (68.07%), Postives = 192/238 (80.67%), Query Frame = 2
Query:  959 RHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            R+   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  235 RNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 472          

HSP 2 Score: 82.8037 bits (203), Expect = 3.163e-114
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLI+ A+E
Sbjct:  468 LRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK-LAKPLSSLTPLIIAAKE 537          

HSP 3 Score: 58.5362 bits (140), Expect = 3.127e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   68 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 117          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 350.903 bits (899), Expect = 3.163e-114
Identity = 162/238 (68.07%), Postives = 192/238 (80.67%), Query Frame = 2
Query:  959 RHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            R+   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  235 RNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 472          

HSP 2 Score: 82.8037 bits (203), Expect = 3.163e-114
Identity = 40/71 (56.34%), Postives = 54/71 (76.06%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLI+ A+E
Sbjct:  468 LRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK-LAKPLSSLTPLIIAAKE 537          

HSP 3 Score: 58.5362 bits (140), Expect = 3.127e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   68 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 117          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 353.214 bits (905), Expect = 2.064e-111
Identity = 169/278 (60.79%), Postives = 205/278 (73.74%), Query Frame = 2
Query:  839 SPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +P  +V T  +  T ++ TP D                  R+ + ++     S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  211 TPTRDVATSPISPTENNTTPPDA---------------LTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALY 473          

HSP 2 Score: 83.1889 bits (204), Expect = 5.932e-16
Identity = 40/80 (50.00%), Postives = 59/80 (73.75%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+H+F+   +KP+S L PLI  A+E ++
Sbjct:  463 YLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL-KIAKPLSSLTPLIAAAKEATK 541          

HSP 3 Score: 58.9214 bits (141), Expect = 1.930e-8
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   73 PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|P35465|PAK1_RAT (Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus OX=10116 GN=Pak1 PE=1 SV=3)

HSP 1 Score: 352.829 bits (904), Expect = 1.861e-110
Identity = 169/278 (60.79%), Postives = 205/278 (73.74%), Query Frame = 2
Query:  839 SPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +P  +V T  +  T ++ TP D                  R+ + ++     S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  211 TPTRDVATSPISPTENNTTPPDA---------------LTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALY 473          

HSP 2 Score: 83.1889 bits (204), Expect = 4.259e-15
Identity = 40/80 (50.00%), Postives = 59/80 (73.75%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+H+F+   +KP+S L PLI  A+E ++
Sbjct:  463 YLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL-KIAKPLSSLTPLIAAAKEATK 541          

HSP 3 Score: 59.3066 bits (142), Expect = 9.811e-8
Identity = 40/124 (32.26%), Postives = 59/124 (47.58%), Query Frame = 2
Query:   83 PPAPPIRSSSTL-------------------------RRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXFNYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            PPAPP+R++ST+                         ++KDR+  S        KK++K++             P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   12 PPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILAGDKTNKKKEKER-------------PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q13153|PAK1_HUMAN (Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2)

HSP 1 Score: 352.829 bits (904), Expect = 1.937e-110
Identity = 169/278 (60.79%), Postives = 205/278 (73.74%), Query Frame = 2
Query:  839 SPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +P  +V T  +  T ++ TP D                  R+ + ++     S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  212 TPTRDVATSPISPTENNTTPPDA---------------LTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALY 474          

HSP 2 Score: 82.8037 bits (203), Expect = 4.386e-15
Identity = 40/80 (50.00%), Postives = 59/80 (73.75%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+H+F+   +KP+S L PLI  A+E ++
Sbjct:  464 YLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLK-IAKPLSSLTPLIAAAKEATK 542          

HSP 3 Score: 58.9214 bits (141), Expect = 1.328e-7
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   73 PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|O88643|PAK1_MOUSE (Serine/threonine-protein kinase PAK 1 OS=Mus musculus OX=10090 GN=Pak1 PE=1 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 2.470e-110
Identity = 169/278 (60.79%), Postives = 205/278 (73.74%), Query Frame = 2
Query:  839 SPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +P  +V T  +  T ++ TP D                  R+ + ++     S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  212 TPTRDVATSPISPTENNTTPPDA---------------LTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTPFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALY 474          

HSP 2 Score: 75.8702 bits (185), Expect = 7.414e-13
Identity = 38/80 (47.50%), Postives = 57/80 (71.25%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            +++   L ALYLIATNG P L++P  +S +F DFL  CLE+D++KR SA  LL+H+F+   +KP+S L PL+  A+E ++
Sbjct:  464 YLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLQCCLEMDVEKRGSAKELLQHQFL-KIAKPLSSLTPLMHAAKEATK 542          

HSP 3 Score: 58.9214 bits (141), Expect = 1.461e-7
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   73 PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q08E52|PAK1_BOVIN (Serine/threonine-protein kinase PAK 1 OS=Bos taurus OX=9913 GN=PAK1 PE=1 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 3.362e-110
Identity = 169/278 (60.79%), Postives = 205/278 (73.74%), Query Frame = 2
Query:  839 SPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +P  +V T  +  T ++ TP D                  R+ + ++     S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  211 TPTRDVATSPISPTENNTTPPDA---------------LTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALY 473          

HSP 2 Score: 83.1889 bits (204), Expect = 4.222e-15
Identity = 40/80 (50.00%), Postives = 59/80 (73.75%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+H+F+   +KP+S L PLI  A+E ++
Sbjct:  463 YLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLK-IAKPLSSLTPLIAAAKEATK 541          

HSP 3 Score: 58.9214 bits (141), Expect = 1.338e-7
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:   73 PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q62829|PAK3_RAT (Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus OX=10116 GN=Pak3 PE=1 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 7.426e-110
Identity = 163/246 (66.26%), Postives = 195/246 (79.27%), Query Frame = 2
Query:  935 NQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            N + +   R+   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  227 NANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 472          

HSP 2 Score: 83.9593 bits (206), Expect = 2.414e-15
Identity = 41/77 (53.25%), Postives = 57/77 (74.03%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLIL A+E
Sbjct:  462 YLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK-LAKPLSSLTPLILAAKE 537          

HSP 3 Score: 58.5362 bits (140), Expect = 2.187e-7
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   68 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 117          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: G7YL78 (p21-activated kinase 1 OS=Clonorchis sinensis OX=79923 GN=CLF_110869 PE=4 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 1.045e-115
Identity = 170/280 (60.71%), Postives = 200/280 (71.43%), Query Frame = 2
Query:  896 PCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNN---------------------ELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            P D     V+ +   S  R  RH   R  D          +LK VVS  DPY KY +++++GQGASGVV  G ++ TKK VAIKQMNL QQPKK+LI+NEILV+K+N+  NIVNYLDS++++                      ELWVVMEYLDGGSLTDVV E CM+E  IA IC+E+ +AL FLH+N VIHRDIKSDNILLG+DGSVK+ DFGFCAQL      RSTMVGTPYWMAPEVV+RKQYGPKVD+WSLGIM IEML+GEPPYLNENPLRAL+
Sbjct:  553 PLDHHYPKVNPKAPTSATR-RRHGSQRITDTQV-----YERLKAVVSKGDPYQKYRLVEKVGQGASGVVYSGYEIGTKKLVAIKQMNLAQQPKKELIVNEILVMKSNRQANIVNYLDSYLVSTAVNRQPSTNGDNPSSASATGEELWVVMEYLDGGSLTDVVMETCMEEGHIAAICKEILLALEFLHANRVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSADATKRSTMVGTPYWMAPEVVSRKQYGPKVDIWSLGIMAIEMLDGEPPYLNENPLRALY 826          

HSP 2 Score: 100.908 bits (250), Expect = 1.045e-115
Identity = 48/72 (66.67%), Postives = 60/72 (83.33%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQ 1871
            L ALYLIATNGKP +K+   +SP+FLDFLDRCLEVD+++RA+AS LLKH FI   ++P+S L+PLI LAREQ
Sbjct:  822 LRALYLIATNGKPEIKERDRLSPVFLDFLDRCLEVDVEQRATASELLKHPFIAHCAEPLSSLVPLIQLAREQ 893          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A4S2MCH0 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002010 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 1.363e-115
Identity = 161/240 (67.08%), Postives = 189/240 (78.75%), Query Frame = 2
Query: 1016 KLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNN---------------------ELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +LK VVS  DPY KY +++++GQGASGVV  G ++ TKK VAIKQMNL QQPKK+LI+NEILV+K+N+  NIVNYLDS++++                      ELWVVMEYLDGGSLTDVV E CM+E  IA IC+E+ +AL FLH+N VIHRDIKSDNILLG+DGSVK+ DFGFCAQL      RSTMVGTPYWMAPEVV+RKQYGPKVD+WSLGIM IEML+GEPPYLNENPLRAL+
Sbjct:  585 RLKAVVSKGDPYQKYRLVEKVGQGASGVVYSGYEIGTKKLVAIKQMNLAQQPKKELIVNEILVMKSNRQANIVNYLDSYLVSTTVNRQPSTNGDNPSSASGTGEELWVVMEYLDGGSLTDVVMETCMEEGHIAAICKEILLALEFLHANRVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSADATKRSTMVGTPYWMAPEVVSRKQYGPKVDIWSLGIMAIEMLDGEPPYLNENPLRALY 824          

HSP 2 Score: 100.908 bits (250), Expect = 1.363e-115
Identity = 48/72 (66.67%), Postives = 60/72 (83.33%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQ 1871
            L ALYLIATNGKP +K+   +SP+FLDFLDRCLEVD+++RA+AS LLKH FI   ++P+S L+PLI LAREQ
Sbjct:  820 LRALYLIATNGKPEIKERDRLSPVFLDFLDRCLEVDVEQRATASELLKHPFIAHCAEPLSSLVPLIQLAREQ 891          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A419PPJ4 (Serine/threonine-protein kinase PAK 1 OS=Clonorchis sinensis OX=79923 GN=Pak1 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 1.981e-115
Identity = 161/240 (67.08%), Postives = 189/240 (78.75%), Query Frame = 2
Query: 1016 KLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNN---------------------ELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +LK VVS  DPY KY +++++GQGASGVV  G ++ TKK VAIKQMNL QQPKK+LI+NEILV+K+N+  NIVNYLDS++++                      ELWVVMEYLDGGSLTDVV E CM+E  IA IC+E+ +AL FLH+N VIHRDIKSDNILLG+DGSVK+ DFGFCAQL      RSTMVGTPYWMAPEVV+RKQYGPKVD+WSLGIM IEML+GEPPYLNENPLRAL+
Sbjct:  745 RLKAVVSKGDPYQKYRLVEKVGQGASGVVYSGYEIGTKKLVAIKQMNLAQQPKKELIVNEILVMKSNRQANIVNYLDSYLVSTAVNRQPSTNGDNPSSASATGEELWVVMEYLDGGSLTDVVMETCMEEGHIAAICKEILLALEFLHANRVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSADATKRSTMVGTPYWMAPEVVSRKQYGPKVDIWSLGIMAIEMLDGEPPYLNENPLRALY 984          

HSP 2 Score: 100.523 bits (249), Expect = 1.981e-115
Identity = 48/72 (66.67%), Postives = 60/72 (83.33%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQ 1871
            L ALYLIATNGKP +K+   +SP+FLDFLDRCLEVD+++RA+AS LLKH FI   ++P+S L+PLI LAREQ
Sbjct:  980 LRALYLIATNGKPEIKERDRLSPVFLDFLDRCLEVDVEQRATASELLKHPFIAHCAEPLSSLVPLIQLAREQ 1051          

HSP 3 Score: 70.0922 bits (170), Expect = 2.256e-8
Identity = 57/134 (42.54%), Postives = 83/134 (61.94%), Query Frame = 2
Query:   11 ILYGVFMDN---KSNSIEINETLDSELPPAPPIRSSSTLRRKDRYSV--SXXXXXXXXXXXXXXXXXXXXXXXFNY------NDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            ++ G  ++N    S +  +N++  SE  PAPP+RSSSTLR+KD   +  SKPLP+ P K+EKKKK +        +      ++P+IS PT V+H+ HVVFD  T   +GLP +W+  L +SNIS+ EQ+ N E
Sbjct:   40 LMAGTNVNNLSPPSATFLLNDSNISEFAPAPPVRSSSTLRKKDGLVLPPSKPLPTLPGKEEKKKKKRGNLSRLLKFSRPEKKHEPQISGPTGVTHDLHVVFDRDTRQIKGLPEAWRLLLMSSNISEKEQQQNSE 173          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A4S2M814 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002010 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 2.340e-115
Identity = 161/240 (67.08%), Postives = 189/240 (78.75%), Query Frame = 2
Query: 1016 KLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNN---------------------ELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +LK VVS  DPY KY +++++GQGASGVV  G ++ TKK VAIKQMNL QQPKK+LI+NEILV+K+N+  NIVNYLDS++++                      ELWVVMEYLDGGSLTDVV E CM+E  IA IC+E+ +AL FLH+N VIHRDIKSDNILLG+DGSVK+ DFGFCAQL      RSTMVGTPYWMAPEVV+RKQYGPKVD+WSLGIM IEML+GEPPYLNENPLRAL+
Sbjct:  690 RLKAVVSKGDPYQKYRLVEKVGQGASGVVYSGYEIGTKKLVAIKQMNLAQQPKKELIVNEILVMKSNRQANIVNYLDSYLVSTTVNRQPSTNGDNPSSASGTGEELWVVMEYLDGGSLTDVVMETCMEEGHIAAICKEILLALEFLHANRVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSADATKRSTMVGTPYWMAPEVVSRKQYGPKVDIWSLGIMAIEMLDGEPPYLNENPLRALY 929          

HSP 2 Score: 100.908 bits (250), Expect = 2.340e-115
Identity = 48/72 (66.67%), Postives = 60/72 (83.33%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQ 1871
            L ALYLIATNGKP +K+   +SP+FLDFLDRCLEVD+++RA+AS LLKH FI   ++P+S L+PLI LAREQ
Sbjct:  925 LRALYLIATNGKPEIKERDRLSPVFLDFLDRCLEVDVEQRATASELLKHPFIAHCAEPLSSLVPLIQLAREQ 996          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A4E0RI63 (p21-activated kinase 1 OS=Fasciola hepatica OX=6192 GN=D915_001478 PE=4 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 4.986e-115
Identity = 161/219 (73.52%), Postives = 186/219 (84.93%), Query Frame = 2
Query: 1016 KLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            KL+ +VS  DP  KY+  + IGQGASGVV GG ++ T ++VAIK+MNLKQQPKK+LI+NEI V+KA KH N+VNYLDS+++ +ELWVVMEYLDGGSLTDVVTE  M+E QIA +CRE   AL FLH N VIHRDIKSDNILLGLDGSVK+ DFGFCAQL   +  RSTMVGTPYWMAPEVVTRKQYGPKVD+WSLGIM IEML+GEPPYLNENP+RAL+
Sbjct:  685 KLRMIVSIGDPKRKYKRQEVIGQGASGVVYGGLEVATGRRVAIKEMNLKQQPKKELIVNEIYVMKAKKHPNVVNYLDSYLVGDELWVVMEYLDGGSLTDVVTETYMEEGQIAAVCRECLQALDFLHKNQVIHRDIKSDNILLGLDGSVKLTDFGFCAQLSSEQTKRSTMVGTPYWMAPEVVTRKQYGPKVDIWSLGIMAIEMLDGEPPYLNENPVRALY 903          

HSP 2 Score: 97.8265 bits (242), Expect = 4.986e-115
Identity = 45/72 (62.50%), Postives = 58/72 (80.56%), Query Frame = 3
Query: 1662 ALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            ALYLI TNGKP +K+   +SP F DFLDRCLEV +D+RASA  LL+H FI  ++KP+S L+PLIL+AREQ++
Sbjct:  901 ALYLIGTNGKPEIKEREKLSPEFQDFLDRCLEVKVDQRASAQELLQHPFIVKRAKPLSSLMPLILVAREQAK 972          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 351.288 bits (900), Expect = 2.359e-111
Identity = 162/238 (68.07%), Postives = 190/238 (79.83%), Query Frame = 2
Query:  959 RHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            RH   +R     + E  + +L+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   +N RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLR  F
Sbjct:  243 RHTDRQRKKSKMTDEEILERLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRHSF 480          

HSP 2 Score: 53.9138 bits (128), Expect = 5.565e-7
Identity = 43/119 (36.13%), Postives = 60/119 (50.42%), Query Frame = 2
Query:   41 SNSIEINETLDSELPPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXFNYND------PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            S+S++I E      PPAPP+R SS+ R    +S      +P  K +K  + +         N       P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:    2 SDSVDIEEK-----PPAPPLRMSSSSRDSSLHSSKPLPMAPEEKNKKSARLRSIFPGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 115          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 350.903 bits (899), Expect = 6.491e-111
Identity = 162/238 (68.07%), Postives = 190/238 (79.83%), Query Frame = 2
Query:  959 RHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            RH   +R     + E  + +L+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   +N RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLR  F
Sbjct:  264 RHTDRQRKKSKMTDEEILERLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRHSF 501          

HSP 2 Score: 53.9138 bits (128), Expect = 6.183e-7
Identity = 43/119 (36.13%), Postives = 60/119 (50.42%), Query Frame = 2
Query:   41 SNSIEINETLDSELPPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXFNYND------PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            S+S++I E      PPAPP+R SS+ R    +S      +P  K +K  + +         N       P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:    2 SDSVDIEEK-----PPAPPLRMSSSSRDSSLHSSKPLPMAPEEKNKKSARLRSIFPGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 115          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 350.903 bits (899), Expect = 6.491e-111
Identity = 162/238 (68.07%), Postives = 190/238 (79.83%), Query Frame = 2
Query:  959 RHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            RH   +R     + E  + +L+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   +N RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLR  F
Sbjct:  264 RHTDRQRKKSKMTDEEILERLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRHSF 501          

HSP 2 Score: 53.9138 bits (128), Expect = 6.183e-7
Identity = 43/119 (36.13%), Postives = 60/119 (50.42%), Query Frame = 2
Query:   41 SNSIEINETLDSELPPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXFNYND------PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            S+S++I E      PPAPP+R SS+ R    +S      +P  K +K  + +         N       P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:    2 SDSVDIEEK-----PPAPPLRMSSSSRDSSLHSSKPLPMAPEEKNKKSARLRSIFPGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 115          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 334.724 bits (857), Expect = 1.124e-103
Identity = 159/240 (66.25%), Postives = 190/240 (79.17%), Query Frame = 2
Query:  974 RRADRH-------CSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            R ADR         + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQ+NL++QPKK+LI+NEILV+K  K+ NIVN+LDSF++  EL+VVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLH+N VIHRDIKSDN+LLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  302 RAADRQKKNPKGKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 541          

HSP 2 Score: 81.6481 bits (200), Expect = 1.463e-15
Identity = 39/77 (50.65%), Postives = 56/77 (72.73%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            +++   L ALYLIATNG P L++P  +SP+F DFL+RCLE+D++KR     LL+H F+   +KP+S L PLIL A++
Sbjct:  531 YLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFL-KLAKPLSSLTPLILAAKD 606          

HSP 3 Score: 59.3066 bits (142), Expect = 1.205e-8
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K+EQK NP+
Sbjct:  163 PEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQ 212          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-3759])

HSP 1 Score: 330.487 bits (846), Expect = 1.402e-103
Identity = 155/224 (69.20%), Postives = 185/224 (82.59%), Query Frame = 2
Query: 1001 EFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQ+NL++QPKK+LI+NEILV+K  K+ NIVN+LDSF++  EL+VVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLH+N VIHRDIKSDN+LLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  195 EEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 418          

HSP 2 Score: 81.2629 bits (199), Expect = 1.579e-15
Identity = 40/77 (51.95%), Postives = 56/77 (72.73%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            +++   L ALYLIATNG P L+ P  +SP+F DFL RCLE+D++KR S+  LL+H F+   +KP+S L PLIL A++
Sbjct:  408 YLNENPLRALYLIATNGTPELQSPEKLSPIFRDFLARCLEMDVEKRGSSKELLQHPFLK-LAKPLSSLTPLILAAKD 483          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 260.381 bits (664), Expect = 5.310e-76
Identity = 116/225 (51.56%), Postives = 168/225 (74.67%), Query Frame = 2
Query:  995 SGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRAL 1669
            S E F + L+ VV   DP    E   +IG+G++GVV    D  + ++VA+K+M+L++Q +++L+ NE+++++   H+N+V+  +S+++ +ELWVVME+L+GG+LTD+VT   M+E QIAT+C  V  AL +LH   VIHRDIKSD+ILL  DG +K+ DFGFCAQ+      R ++VGTPYWMAPEV++R  YGP+VD+WSLGIMVIEM++GEPPY NE PL+A+
Sbjct:  398 SHEQFRAALQQVVDPGDPSEYLENFIKIGEGSTGVVCLAVDRRSGRQVAVKKMHLRKQQRRELLFNEVVIMREYHHENVVDMYNSYLVADELWVVMEFLEGGALTDIVTHTRMNEEQIATVCVSVLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGFCAQVSKEVTRRKSLVGTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAM 622          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 178.333 bits (451), Expect = 7.504e-52
Identity = 92/216 (42.59%), Postives = 131/216 (60.65%), Query Frame = 2
Query: 1034 SSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILN-EILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIK--SDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            S +DP   +   +RIG+G+ G V  G D  TK+ VAIK ++L++   +   +  EI V+       + +Y  S++   +LW++MEYL GGS  D++    ++E QIATI RE+   L +LHS   IHRDIK  + N+LL   G VK+ DFG   QL   +  R+T VGTP+WMAPEV+ +  Y  K D+WSLGI  IE+ +GEPP    +P+R LF
Sbjct:   18 SCADPEELFTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLIKPGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLF 233          

HSP 2 Score: 44.669 bits (104), Expect = 7.504e-52
Identity = 26/63 (41.27%), Postives = 34/63 (53.97%), Query Frame = 3
Query: 1665 LYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLI 1853
            L+LI  N  P+L+     S  F +F+D CL  D   R +A  LLKH+FI   +K  S L  LI
Sbjct:  232 LFLIPKNNPPTLE--GNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQRSAKKTSYLTELI 292          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 174.481 bits (441), Expect = 1.864e-48
Identity = 91/213 (42.72%), Postives = 131/213 (61.50%), Query Frame = 2
Query: 1058 YEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVV-TEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEV--VTRK-QYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALFNSNK 1684
            +E+ +R+G G  G V   R+++T + VAIK + L+      +I  EI+++K  KH NIV Y  S++ +++LW+ ME+  GGSL D+      + E QIA + RE    L +LHS   +HRDIK  NILL  DG VK+ DFG  AQ+      R + +GTPYWMAPEV  V RK  Y  + D+W++GI  IE+ E +PP  + +P+RALF  +K
Sbjct:   14 FELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPGDDFSVIQQEIVMMKECKHTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHVTGPLTERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSK 226          

HSP 2 Score: 37.3502 bits (85), Expect = 1.864e-48
Identity = 23/70 (32.86%), Postives = 38/70 (54.29%), Query Frame = 3
Query: 1662 ALYLIATNG--KPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAR 1865
            AL+L++ +G   P L+D    SP+F +F+   L  +  KR +A  +L H ++    +P+S    L LL R
Sbjct:  220 ALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKMLTHSYV---QQPLSRAQALELLER 286          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 155.992 bits (393), Expect = 6.230e-45
Identity = 80/217 (36.87%), Postives = 126/217 (58.06%), Query Frame = 2
Query: 1043 DPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTE--ACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVV---TRKQ--YGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            DP   + ++  +G GA G V   ++ E+    A K +  K + + +  + EI ++    H NIV  L++F   N+LW+ +E+  GG++  ++ E    + E QI  +C+++  AL +LH++ +IHRD+K+ NILL  +G VK+ DFG  A+       R + +GTPYWMAPEVV   T K   Y  K D+WSLGI +IE+ + EPP    NP+R + 
Sbjct:   28 DPAELWSVIGELGDGAFGKVYKAQNKESGVLAAAKVIETKSEEELEDYMVEIEILALCDHPNIVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTLQRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVML 244          

HSP 2 Score: 43.5134 bits (101), Expect = 6.230e-45
Identity = 26/59 (44.07%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1674 IATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFIT--DKSKPVSILI 1844
            IA N  PSL  P+  S  F DFL +CL+ + + R +A  LL+H FI+  D +KP+  LI
Sbjct:  246 IAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFISGVDSNKPLRELI 304          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: myo3a (myosin IIIA [Source:ZFIN;Acc:ZDB-GENE-041026-4])

HSP 1 Score: 154.836 bits (390), Expect = 1.423e-44
Identity = 85/232 (36.64%), Postives = 132/232 (56.90%), Query Frame = 2
Query: 1043 DPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQM----NLK---QQPKKDLILNEILVIKANKHQNIVNYLDSF-----IMNNELWVVMEYLDGGSLTDVVTEAC-----MDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQ-----YGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            DP   +E+++ IG+G  G V      +   K A+K +    NL+   Q   +++     ++    +H NIV +   +     +  ++LW+V+E  +GGS+TD+V         MD   IA I R   + L  LHS+++IHRDIK +NILL  DG ++++DFG  AQ+   R  R+T VGTP+WMAPEV+  +Q     Y  + D+WS+GI  IE+ +G+PP    +P+RALF
Sbjct:   19 DPSDTWELVETIGKGTYGKVYKATSRKDGSKAAVKTLDPVNNLETSNQDIDEEIEAEYSILTSLPEHPNIVRFFGMYYQKDGVNGDQLWIVLELCNGGSVTDLVKGQLKRGERMDVMLIAYILRGALLGLNHLHSHNIIHRDIKGNNILLTTDGGIRLVDFGVSAQVSKTRVERNTAVGTPFWMAPEVIACEQQLDYMYDRRCDVWSMGITAIELGDGDPPLYELHPMRALF 250          

HSP 2 Score: 43.5134 bits (101), Expect = 1.423e-44
Identity = 22/52 (42.31%), Postives = 32/52 (61.54%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFI 1811
            + AL+ I  N  P+LK P    PLF +F+ +CL  D ++RA+ S LL+  FI
Sbjct:  246 MRALFKIPRNPPPTLKQPELWPPLFNEFIAQCLVKDFERRATVSQLLEDPFI 297          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 310.071 bits (793), Expect = 1.436e-97
Identity = 138/222 (62.16%), Postives = 174/222 (78.38%), Query Frame = 2
Query: 1007 FISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
              +KL  + S  DP +KY  L +IGQGASG V    ++ T   VAIKQMNL++QPKK+LI+NEILV+K +KH NIVN++DS+++  +LWV+MEY++GGSLTDVVT   + E QI  +CRE    L FLHS  V+HRDIKSDNILL ++G +K+ DFGFCAQ+      R+TMVGTPYWMAPEVV+RK+YGPKVD+WSLGIM+IEM+EGEPPYLNE PLRAL+
Sbjct:  603 LYAKLNEICSDGDPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALY 824          

HSP 2 Score: 65.0846 bits (157), Expect = 1.436e-97
Identity = 37/70 (52.86%), Postives = 47/70 (67.14%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAR 1865
            L ALYLIATNG P LK+P  +S     FLD CL V+ + RASA+ LL  E+IT+ ++  S L PL+ LAR
Sbjct:  820 LRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAEANSSLAPLVKLAR 889          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 260.766 bits (665), Expect = 3.114e-78
Identity = 127/250 (50.80%), Postives = 176/250 (70.40%), Query Frame = 2
Query: 1007 FISKLKGVVSSSDPYSKYEILDRIGQGASGVV----------------MGGRDLE---TKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFI-MNNELWVVMEYLDGGSLTDVV--------TEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
             +SKLK V  ++DP   ++++++ GQGASG V                +   D++      KVAIKQM L +QP+K+LI+NEILV+K ++H+NIVN+L++++  +++LWVVME+++GGSLTD++        + + + E QIA I RE    L FLH  H+IHRDIKSDN+LL     VKI DFGFCA+L   R+ R+TMVGTPYWMAPEVV +++Y  K+D+WSLGIM IEMLEGEPPYLNE+PL+AL+
Sbjct:  529 IMSKLKKVTVNADPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALY 778          

HSP 2 Score: 49.6766 bits (117), Expect = 3.114e-78
Identity = 28/53 (52.83%), Postives = 31/53 (58.49%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFIT 1814
            L ALYLIATNG P LK P ++S     FL  CL VD+  RAS   LL H F  
Sbjct:  774 LKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFFN 826          

HSP 3 Score: 49.2914 bits (116), Expect = 2.353e-6
Identity = 21/46 (45.65%), Postives = 30/46 (65.22%), Query Frame = 2
Query:  236 ISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDN 373
            +SSPT  +H  HV FDP TG F G+P +W++ LK S I+  +  +N
Sbjct:  184 VSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITGEDWNNN 229          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 245.743 bits (626), Expect = 6.066e-76
Identity = 119/250 (47.60%), Postives = 169/250 (67.60%), Query Frame = 2
Query: 1007 FISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLE-----------------TKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNE-LWVVMEYLDGGSLTDVVTEAC----------MDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
             I K+K V    +P   ++++++ GQGASG V   + ++                   ++VAIKQ+ L +QPKK LI+NE+LV+  ++ +NIVN+L+++I+++E LWV+MEY++GG LTD++              ++E Q+A I +E    L FLH+  +IHRDIKSDNILL   G VKI DFGFC +L   R+ R+TMVGTPYWMAPE+V +K Y  KVD+WSLGIM+IEM+EGEPPYLNE+PL+AL+
Sbjct:  343 IIMKMKTVAIDVNPRPYFQLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALY 592          

HSP 2 Score: 57.3806 bits (137), Expect = 6.066e-76
Identity = 29/65 (44.62%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPL 1850
            L ALYLIA NG P L+ P +VS     FLD CL+V+++ RAS   LL  EF++    P  + + L
Sbjct:  588 LKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFLSMACSPEQLKVSL 652          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 159.458 bits (402), Expect = 1.810e-40
Identity = 86/212 (40.57%), Postives = 126/212 (59.43%), Query Frame = 2
Query: 1043 DPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKK-DLILNEILVIKANKH-QNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRK-QYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRAL 1669
            D  S ++  + IG+G  GVV  G +++T +  AIK +NL     + + +  EI  + + K   NI  Y  S++ +  LW++ME+  GGSL  ++    +DE  I  I RE+ +AL  +H ++VIHRDIK+ N+L+  +G+VK+ DFG  AQ+      R TM GTPYWMAPEV+     Y  KVD+WSLGI   E+  G PPY +   LRA+
Sbjct:   18 DVSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAM 229          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 151.754 bits (382), Expect = 1.347e-39
Identity = 93/239 (38.91%), Postives = 134/239 (56.07%), Query Frame = 2
Query: 1013 SKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKK-DLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMD---EFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRK--QYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALFNSNKWK-AFIEGP 1708
            SK   + S + P   Y I   IG+G  G V    D  T++ VAIK +NL+   +  +L+  EI  +   K   I NY+ + + +  +W+VMEY  GGS +D++  + ++   E +++ I  EVT+ L +LH    IHRDIK+ NILL  +G VK+ DFG     I     R T VGTPYWMAPEVV  +   Y  K D+WSLGI   E+L+G PP    +P++ + N  K K   ++GP
Sbjct:    3 SKEISIRSRTPPSKLYSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGH-IRSTLKRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP 240          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 344.354 bits (882), Expect = 6.837e-112
Identity = 161/240 (67.08%), Postives = 191/240 (79.58%), Query Frame = 2
Query:  962 HQQLRRADRH---CSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            H Q++  D+     S E  +++L+ +VS  DP  KY   ++IGQGASG V    ++ T  +VAIKQMNL QQPKK+LI+NEILV++ NKH NIVNY+DS+++  ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DG VK+ DFGFCA +   +N RSTMVGTPYWMAPEVVTRKQYGP+VD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  191 HGQVQARDKRKKKMSDEEILARLRTIVSIGDPKKKYTKFEKIGQGASGTVYTAIEVATGHEVAIKQMNLSQQPKKELIINEILVMRENKHPNIVNYVDSYLVGEELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDFGFCATITPEQNKRSTMVGTPYWMAPEVVTRKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALY 430          

HSP 2 Score: 79.7221 bits (195), Expect = 6.837e-112
Identity = 39/71 (54.93%), Postives = 54/71 (76.06%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L  P  +SP+F DFL + LE+D++KR+SA  LL+H F+  ++KP++ L+PLIL A+E
Sbjct:  426 LRALYLIATNGTPELAHPEKLSPVFKDFLAQSLEMDVEKRSSARELLQHPFL-KQAKPLASLVPLILAAKE 495          

HSP 3 Score: 67.0106 bits (162), Expect = 1.834e-11
Identity = 46/110 (41.82%), Postives = 57/110 (51.82%), Query Frame = 2
Query:   71 DSELPPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXF-------NYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            D E PPAPPIR +S    KD  S S      P    ++KK K      F         N P+IS PT   H  HV FDP TG+F G+P +W   L+ SNI++ EQK NP+
Sbjct:    3 DEERPPAPPIRLTS----KDA-SNSLGSKPLPNAPVEEKKKKTATFRLFPNKTEYNKKNKPEISYPTQFEHTIHVGFDPVTGEFTGMPEAWARLLQVSNITQAEQKKNPQ 107          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 246.128 bits (627), Expect = 8.988e-75
Identity = 115/230 (50.00%), Postives = 165/230 (71.74%), Query Frame = 2
Query:  980 ADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRAL 1669
            +D   + E F   L+ VV S+          +IG+G++G+V    D  T ++VA+K+M+LK+Q +++L+ NE+++++   H NIV    S ++ +ELWVVME+L+GG+LTD+VT   + E Q+A +CR V  AL FLHS  VIHRDIKSD+ILL  +G+VK+ DFGFCAQ+      R ++VGTPYWMAPEV++RK YG +VD+WSLGIMV+EM++GEPPY NE PL+A+
Sbjct:    3 SDTPVTHEQFRRHLEVVVQSTRQPENLGNFMKIGEGSTGIVCLATDKRTGRQVAVKKMDLKKQQRRELLFNEVVIMRDYPHPNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTEDMPRRKSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAM 232          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 179.874 bits (455), Expect = 1.074e-49
Identity = 90/212 (42.45%), Postives = 130/212 (61.32%), Query Frame = 2
Query: 1040 SDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILN-EILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            +DP   +  L+RIG+G+ G V  G D  T + VAIK ++L++   +   +  EI V+       +  Y  S++   +LW++MEYL GGS  D++    ++EF IATI REV   L +LH+   +HRDIK+ N+L+   G VK+ DFG   QL    N R+T VGTP+WMAPEV+ +  Y  K D+WSLGI  IE+ +GEPP  + +P+R LF
Sbjct:    5 ADPEKLFSKLERIGKGSFGEVFKGIDNRTNEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSLYVTKYHGSYLKGTKLWIIMEYLGGGSALDLMKAGNIEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDTLNKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPNSDLHPMRVLF 216          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 160.229 bits (404), Expect = 6.397e-48
Identity = 79/211 (37.44%), Postives = 125/211 (59.24%), Query Frame = 2
Query: 1046 PYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDV--VTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            P   +++L+++G+G+ G V      E+ + VAIKQ+ +    ++  I+ EI +++      +V Y  S+  N +LW+VMEY   GS++D+  +    + E +I  + +     L +LH    IHRDIK+ NILL  +G  K+ DFG   QL      R+T++GTP+WMAPEV+    Y    D+WSLGI  +EM EG+PPY + +P+RA+F
Sbjct:   20 PEEVFDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQE--IIKEISMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIF 228          

HSP 2 Score: 50.0618 bits (118), Expect = 6.397e-48
Identity = 26/67 (38.81%), Postives = 42/67 (62.69%), Query Frame = 3
Query: 1662 ALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLA 1862
            A+++I T   P+ +DP   S  F DF+ +CL  + ++RA+A+ LL+H FI   +K +SIL  +I  A
Sbjct:  226 AIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQG-AKQISILSSMIQEA 291          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO40961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T6])

HSP 1 Score: 169.474 bits (428), Expect = 7.864e-47
Identity = 90/229 (39.30%), Postives = 135/229 (58.95%), Query Frame = 2
Query: 1028 VVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFI------MNNELWVVMEYLDGGSLTDVVTEA---CMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQ-----YGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            + +  DP   +++++ +G G  G V  GR   T +  AIK M++ +  ++++ L   ++ K + H+NI  Y  +FI       +++LW+VME+   GS+TD+V  A    + E  I+ ICREV   +  LH NHVIHRDIK  N+LL     VK++DFG  AQL      R+T +GTPYWMAPEV+   +     Y  + D+WS+GI  IEM E +PP  + +P+RALF
Sbjct:   10 LAALKDPAGIFDLVEVVGNGTYGQVHKGRHKRTGQLTAIKIMDVTEDEEEEIKLEINVLRKFSNHRNIATYYGAFIKKSLQGQDDQLWLVMEFCGAGSVTDLVKTARNKALKEEWISYICREVLNGVSHLHMNHVIHRDIKGQNVLLTESAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDEQPDATYDNRCDMWSIGITAIEMAESQPPLCDMHPMRALF 238          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: PAK3 (serine/threonine-protein kinase PAK 3 [Source:NCBI gene;Acc:101162700])

HSP 1 Score: 356.295 bits (913), Expect = 4.447e-116
Identity = 165/249 (66.27%), Postives = 196/249 (78.71%), Query Frame = 2
Query:  926 IEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            ++   + N   RH   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   +N RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  235 VQPENTSNTMYRHTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNSNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 483          

HSP 2 Score: 83.5741 bits (205), Expect = 4.447e-116
Identity = 41/71 (57.75%), Postives = 54/71 (76.06%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLIL A+E
Sbjct:  479 LRALYLIATNGTPELQNPERLSSVFRDFLNRCLEMDVDRRGSAKDLLQHSFLK-LAKPLSSLTPLILAAKE 548          

HSP 3 Score: 58.151 bits (139), Expect = 2.841e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   67 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 116          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: pak1 (p21 (RAC1) activated kinase 1 [Source:NCBI gene;Acc:101164663])

HSP 1 Score: 347.436 bits (890), Expect = 7.768e-114
Identity = 162/237 (68.35%), Postives = 191/237 (80.59%), Query Frame = 2
Query:  962 HQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            H Q +   +  S E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK Y PKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  256 HSQDKTRKKKMSDEEILEKLRTIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYCPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 492          

HSP 2 Score: 85.1149 bits (209), Expect = 7.768e-114
Identity = 41/74 (55.41%), Postives = 57/74 (77.03%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+H+F+   +KP+S L PLIL A+E ++
Sbjct:  488 LRALYLIATNGTPELQNPEKLSTIFRDFLNRCLEMDVEKRGSAKELLQHQFLK-MAKPLSSLTPLILAAKEAAK 560          

HSP 3 Score: 58.5362 bits (140), Expect = 2.142e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   73 PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: PAK3 (serine/threonine-protein kinase PAK 3 [Source:NCBI gene;Acc:101162700])

HSP 1 Score: 356.295 bits (913), Expect = 2.578e-112
Identity = 165/249 (66.27%), Postives = 196/249 (78.71%), Query Frame = 2
Query:  926 IEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            ++   + N   RH   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   +N RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  256 VQPENTSNTMYRHTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNSNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 504          

HSP 2 Score: 83.5741 bits (205), Expect = 3.674e-16
Identity = 41/77 (53.25%), Postives = 57/77 (74.03%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLIL A+E
Sbjct:  494 YLNENPLRALYLIATNGTPELQNPERLSSVFRDFLNRCLEMDVDRRGSAKDLLQHSFLK-LAKPLSSLTPLILAAKE 569          

HSP 3 Score: 58.151 bits (139), Expect = 2.865e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   67 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 116          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: PAK3 (serine/threonine-protein kinase PAK 3 [Source:NCBI gene;Acc:101162700])

HSP 1 Score: 356.295 bits (913), Expect = 2.578e-112
Identity = 165/249 (66.27%), Postives = 196/249 (78.71%), Query Frame = 2
Query:  926 IEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            ++   + N   RH   +R     + E  + KL+ +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   +N RSTMVGTPYWMAPEVVTRK YGPKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  256 VQPENTSNTMYRHTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNSNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 504          

HSP 2 Score: 83.5741 bits (205), Expect = 3.674e-16
Identity = 41/77 (53.25%), Postives = 57/77 (74.03%), Query Frame = 3
Query: 1638 HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLARE 1868
            +++   L ALYLIATNG P L++P  +S +F DFL+RCLE+D+D+R SA  LL+H F+   +KP+S L PLIL A+E
Sbjct:  494 YLNENPLRALYLIATNGTPELQNPERLSSVFRDFLNRCLEMDVDRRGSAKDLLQHSFLK-LAKPLSSLTPLILAAKE 569          

HSP 3 Score: 58.151 bits (139), Expect = 2.865e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   67 PEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQ 116          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: pak1 (p21 (RAC1) activated kinase 1 [Source:NCBI gene;Acc:101164663])

HSP 1 Score: 342.043 bits (876), Expect = 2.637e-112
Identity = 163/245 (66.53%), Postives = 191/245 (77.96%), Query Frame = 2
Query:  962 HQQLRRADRHCSGEFFISKLKG--------VVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            H Q +   +  S E  + KL G        +VS  DP  KY   ++IGQGASG V    D+ T ++VAIKQMNL+QQPKK+LI+NEILV++ NK+ NIVNYLDS+++ +ELWVVMEYL GGSLTDVVTE CMDE QIA +CRE   AL FLHSN VIHRDIKSDNILLG+DGSVK+ DFGFCAQ+   ++ RSTMVGTPYWMAPEVVTRK Y PKVD+WSLGIM IEM+EGEPPYLNENPLRAL+
Sbjct:  256 HSQDKTRKKKMSDEEILEKLHGLRSPSAGTIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYCPKVDIWSLGIMAIEMVEGEPPYLNENPLRALY 500          

HSP 2 Score: 85.1149 bits (209), Expect = 2.637e-112
Identity = 41/74 (55.41%), Postives = 57/74 (77.03%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSE 1877
            L ALYLIATNG P L++P  +S +F DFL+RCLE+D++KR SA  LL+H+F+   +KP+S L PLIL A+E ++
Sbjct:  496 LRALYLIATNGTPELQNPEKLSTIFRDFLNRCLEMDVEKRGSAKELLQHQFLK-MAKPLSSLTPLILAAKEAAK 568          

HSP 3 Score: 58.5362 bits (140), Expect = 2.054e-8
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPE 379
            P+IS P+   H  HV FD  TG+F G+P  W   L+ SNI+K EQK NP+
Sbjct:   73 PEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQ 122          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000009652.1 (SMESG000009652.1)

HSP 1 Score: 956.822 bits (2472), Expect = 0.000e+0
Identity = 551/572 (96.33%), Postives = 555/572 (97.03%), Query Frame = 2
Query:   29 MDNKSNSIEINETLDSELPPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXFNYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPEXXXXXXXXXXXXXXXEPKYFQDREIFYQPPIVPPHLPINEKDLEIKPQLVNNVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCQYSEKVSTLTATSSIHPSQMPNSKRESSGIVADASSFECISCQKEGNNKPENIITDQFTELKSPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF-NSNKWKAFIEGPNNSFAFILRFF 1741
            MDNKSNSIEINETLDSELPPAPPIRSSSTLRRKDRYSVSKPLPSPPIKKEKKKKTKLFKLPKFNYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPELLLDVLQCLDLSQQSEPKYFQDREIFYQPPIVPPHLPINEKDLEIKPQLVNNVTSGSPSDRPASSSGSHSSRDSSNSSRSSSSNSPDCSQCQYSEKVSTLTATSSIHPSQMPNSKRESSGIVADASSFECISCQKEGNNKPENIITDQFTELKSPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRAL+  +   K  ++ P       L F 
Sbjct:    1 MDNKSNSIEINETLDSELPPAPPIRSSSTLRRKDRYSVSKPLPSPPIKKEKKKKTKLFKLPKFNYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPELLLDVLQCLDLSQQSEPKYFQDREIFYQPPIVPPHLPINEKDLEIKPQLVNNVTSGSPSDRPASSSGSHSSRDSSNSSRSSSSNSPDCSQCQYSEKVSTLTATSSIHPSQMPNSKRESSGIVADASSFECISCQKEGNNKPENIITDQFTELKSPLLEVETDELGETGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALYLIATNGKPSLKDPTTVSPLFLDFL 572          

HSP 2 Score: 154.451 bits (389), Expect = 6.041e-39
Identity = 90/145 (62.07%), Postives = 104/145 (71.72%), Query Frame = 3
Query: 1500 VEIIDQQWLEHLIGWHQKLL--------LENNMVLKWICGP-LELW-----LLKCWKGSL-HISMKILCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSEICEQ 1889
            V+IID  +   LIG              +   +V +   GP ++LW     +++  +G   +++   L ALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSEICEQ
Sbjct:  477 VKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSEICEQ 621          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000009652.1 (SMESG000009652.1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 292/292 (100.00%), Postives = 292/292 (100.00%), Query Frame = 2
Query:  878 TGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALFNSNKWKAFIEGPNNSFAFILRFFGPLP 1753
            TGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALFNSNKWKAFIEGPNNSFAFILRFFGPLP
Sbjct:    4 TGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALFNSNKWKAFIEGPNNSFAFILRFFGPLP 295          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000009652.1 (SMESG000009652.1)

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 264/265 (99.62%), Postives = 265/265 (100.00%), Query Frame = 2
Query:  878 TGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            TGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRAL+
Sbjct:    4 TGDSVTPCDKSKDSVSIEINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALY 268          

HSP 2 Score: 153.68 bits (387), Expect = 0.000e+0
Identity = 77/78 (98.72%), Postives = 77/78 (98.72%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSEICEQ 1889
            L ALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSEICEQ
Sbjct:  264 LRALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQSEICEQ 341          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000009652.1 (SMESG000009652.1)

HSP 1 Score: 407.912 bits (1047), Expect = 4.235e-136
Identity = 285/285 (100.00%), Postives = 285/285 (100.00%), Query Frame = 2
Query:   29 MDNKSNSIEINETLDSELPPAPPIRSSSTLRRKDRYSVSXXXXXXXXXXXXXXXXXXXXXXXFNYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPEXXXXXXXXXXXXXXXEPKYFQDREIFYQPPIVPPHLPINEKDLEIKPQLVNNVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCQYSEKVSTLTATSSIHPSQMPNSKRESSGIVADASSFECISCQKEGNNKPENIITDQFTELKSPLLEVETDELGETG 883
            MDNKSNSIEINETLDSELPPAPPIRSSSTLRRKDRYSVSKPLPSPPIKKEKKKKTKLFKLPKFNYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPELLLDVLQCLDLSQQSEPKYFQDREIFYQPPIVPPHLPINEKDLEIKPQLVNNVTSGSPSDRPASSSGSHSSRDSSNSSRSSSSNSPDCSQCQYSEKVSTLTATSSIHPSQMPNSKRESSGIVADASSFECISCQKEGNNKPENIITDQFTELKSPLLEVETDELGETG
Sbjct:    1 MDNKSNSIEINETLDSELPPAPPIRSSSTLRRKDRYSVSKPLPSPPIKKEKKKKTKLFKLPKFNYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPELLLDVLQCLDLSQQSEPKYFQDREIFYQPPIVPPHLPINEKDLEIKPQLVNNVTSGSPSDRPASSSGSHSSRDSSNSSRSSSSNSPDCSQCQYSEKVSTLTATSSIHPSQMPNSKRESSGIVADASSFECISCQKEGNNKPENIITDQFTELKSPLLEVETDELGETG 285          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000008326.1 (SMESG000008326.1)

HSP 1 Score: 340.117 bits (871), Expect = 2.656e-114
Identity = 161/230 (70.00%), Postives = 187/230 (81.30%), Query Frame = 2
Query: 1001 EFFISKLKGVVSSSDPYSKYEILDRIGQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQNIVNYLDSFIMN------NELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMALGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALF 1672
            E    KL+ +VS  DP  KY+  ++IGQGASGVV  G +  T KKVAIKQM LKQQPKK+LI+NEI V+KAN+H N+VNYLDS+++       +ELWVVMEYLDGGSLT+VVTE  MDE  IA +CRE   AL FLH+N+VIHRDIKSDNILLGLDGSVK+ DFGFCAQL   +  RSTMVGTPYWMAPEVVTRKQYGPKVD+WSLGIM +EM++GEPPYLNENPLRAL+
Sbjct:  331 EEICEKLRKIVSLGDPNRKYKKHEKIGQGASGVVYNGIETSTGKKVAIKQMQLKQQPKKELIINEICVMKANRHPNVVNYLDSYLVGGTGTVADELWVVMEYLDGGSLTEVVTETFMDEGHIAAVCRECLQALDFLHTNNVIHRDIKSDNILLGLDGSVKLTDFGFCAQLNNEQTKRSTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMALEMIDGEPPYLNENPLRALY 560          

HSP 2 Score: 93.2041 bits (230), Expect = 2.656e-114
Identity = 45/73 (61.64%), Postives = 59/73 (80.82%), Query Frame = 3
Query: 1656 LCALYLIATNGKPSLKDPTTVSPLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQS 1874
            L ALYLIATNGKP +K+ + +S +FLDFLD+CLEV ++KR SAS LL H FI  K+KP+S L PLI++A+EQ+
Sbjct:  556 LRALYLIATNGKPEIKEKSRLSVVFLDFLDKCLEVQVEKRISASELLTHPFIVRKAKPLSSLTPLIVVAKEQA 628          

HSP 3 Score: 51.9878 bits (123), Expect = 1.775e-6
Identity = 29/72 (40.28%), Postives = 43/72 (59.72%), Query Frame = 2
Query:  230 PKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKEWLKASNISKTEQKDNPEXXXXXXXXXXXXXXXEPKYFQD 445
            P IS+P  V H  H+ F   TG+F G+P+ W+  L+ +NISK EQ+ NP  +L+ L  L    +++ KY  D
Sbjct:   69 PNISAPISVMHKVHITFSQDTGEFAGVPLEWQVILE-NNISKIEQQQNPRAVLNALNILVDKNKNKEKYMMD 139          
The following BLAST results are available for this feature:
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK14.902e-11260.79p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK12.595e-11160.79p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK14.033e-11160.79p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK11.279e-11060.79p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK31.910e-11066.26p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak-16.456e-10566.95Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-17.231e-10566.95Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-11.186e-10466.95Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
max-27.422e-8251.80Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-27.426e-8251.80Serine/threonine-protein kinase max-2 [Source:Uni... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak5.306e-11370.31gene:FBgn0267698 transcript:FBtr0334540[more]
Pak5.306e-11370.31gene:FBgn0267698 transcript:FBtr0334542[more]
Pak5.306e-11370.31gene:FBgn0267698 transcript:FBtr0334543[more]
Pak5.306e-11370.31gene:FBgn0267698 transcript:FBtr0334541[more]
Pak1.261e-11270.31gene:FBgn0267698 transcript:FBtr0334539[more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2a1.052e-10966.11p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a1.172e-10966.11p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a1.172e-10966.11p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a1.172e-10966.11p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak14.396e-10969.87p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flii2.132e-11466.67FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
flii3.662e-11466.67FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
qsox25.199e-11170.98quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
flii2.169e-11066.67FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
taf31.596e-10969.03TATA-box binding protein associated factor 3 [Sour... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak33.163e-11468.07p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak33.163e-11468.07p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak33.163e-11468.07p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak33.163e-11468.07p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak12.064e-11160.79p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35465|PAK1_RAT1.861e-11060.79Serine/threonine-protein kinase PAK 1 OS=Rattus no... [more]
sp|Q13153|PAK1_HUMAN1.937e-11060.79Serine/threonine-protein kinase PAK 1 OS=Homo sapi... [more]
sp|O88643|PAK1_MOUSE2.470e-11060.79Serine/threonine-protein kinase PAK 1 OS=Mus muscu... [more]
sp|Q08E52|PAK1_BOVIN3.362e-11060.79Serine/threonine-protein kinase PAK 1 OS=Bos tauru... [more]
sp|Q62829|PAK3_RAT7.426e-11066.26Serine/threonine-protein kinase PAK 3 OS=Rattus no... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YL781.045e-11560.71p21-activated kinase 1 OS=Clonorchis sinensis OX=7... [more]
A0A4S2MCH01.363e-11567.08Protein kinase domain-containing protein OS=Opisth... [more]
A0A419PPJ41.981e-11567.08Serine/threonine-protein kinase PAK 1 OS=Clonorchi... [more]
A0A4S2M8142.340e-11567.08Protein kinase domain-containing protein OS=Opisth... [more]
A0A4E0RI634.986e-11573.52p21-activated kinase 1 OS=Fasciola hepatica OX=619... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK32.359e-11168.07p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK36.491e-11168.07p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK36.491e-11168.07p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
pak2a1.124e-10366.25p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2b1.402e-10369.20p21 protein (Cdc42/Rac)-activated kinase 2b [Sourc... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak45.310e-7651.56p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
stk25a7.504e-5242.59serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
MAP4K31.864e-4842.72mitogen-activated protein kinase kinase kinase kin... [more]
slka6.230e-4536.87STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
myo3a1.423e-4436.64myosin IIIA [Source:ZFIN;Acc:ZDB-GENE-041026-4][more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE201.436e-9762.16Cdc42p-activated signal transducing kinase; involv... [more]
CLA43.114e-7850.80Cdc42p-activated signal transducing kinase; member... [more]
SKM16.066e-7647.60Member of the PAK family of serine/threonine prote... [more]
KIC11.810e-4040.57Protein kinase of the PAK/Ste20 family, required f... [more]
SPS11.347e-3938.91Putative protein serine/threonine kinase; localize... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO336676.837e-11267.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458468.988e-7550.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319341.074e-4942.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428456.397e-4837.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409617.864e-4739.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK34.447e-11666.27serine/threonine-protein kinase PAK 3 [Source:NCBI... [more]
pak17.768e-11468.35p21 (RAC1) activated kinase 1 [Source:NCBI gene;Ac... [more]
PAK32.578e-11266.27serine/threonine-protein kinase PAK 3 [Source:NCBI... [more]
PAK32.578e-11266.27serine/threonine-protein kinase PAK 3 [Source:NCBI... [more]
pak12.637e-11266.53p21 (RAC1) activated kinase 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009652.16.041e-3996.33SMESG000009652.1[more]
SMESG000009652.10.000e+0100.00SMESG000009652.1[more]
SMESG000009652.10.000e+099.62SMESG000009652.1[more]
SMESG000009652.14.235e-136100.00SMESG000009652.1[more]
SMESG000008326.12.656e-11470.00SMESG000008326.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027002 ID=SMED30027002|Name=Non-specific serine/threonine protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2600bp
ATCTATATAAATCTTATATGGAGTATTTATGGACAATAAAAGTAATTCTA
TTGAAATAAATGAAACACTTGATTCTGAATTACCACCAGCTCCACCAATT
CGATCATCTAGTACATTACGACGCAAAGATAGATATTCGGTATCAAAACC
GCTTCCCAGTCCTCCAATTAAAAAGGAAAAGAAGAAAAAAACAAAATTGT
TCAAATTACCTAAATTTAATTACAATGATCCCAAAATTTCGAGTCCAACA
TACGTGAGCCACAATTTCCATGTTGTTTTCGATCCTACAACTGGGGATTT
TCAGGGCTTGCCAGTTTCATGGAAAGAGTGGTTGAAAGCATCGAATATAT
CTAAAACTGAACAAAAAGATAATCCTGAATTGTTGCTTGATGTGTTACAA
TGTCTTGACTTATCTCAGCAATCAGAGCCGAAATATTTTCAGGATCGTGA
AATATTTTATCAACCGCCAATTGTCCCGCCACATTTACCAATCAATGAAA
AAGATCTAGAGATTAAACCACAATTGGTTAACAATGTAACTTCTGGCTCT
CCATCCGATAGGCCTGCATCCTCATCAGGATCCCATTCCTCAAGAGATTC
ATCGAATTCTTCTCGGTCGTCATCATCGAACAGTCCTGATTGTTCCCAAT
GTCAATATAGTGAGAAAGTGTCGACATTGACTGCTACAAGTTCAATACAT
CCGTCACAAATGCCAAATTCTAAACGCGAAAGCAGTGGAATCGTTGCCGA
TGCCAGTAGTTTTGAATGCATTTCATGTCAAAAGGAAGGAAATAATAAAC
CTGAAAATATAATCACTGATCAATTTACTGAGTTGAAGTCTCCCTTATTG
GAAGTCGAAACAGATGAATTAGGAGAAACTGGTGATTCTGTTACTCCTTG
TGATAAAAGTAAAGATTCAGTTTCAATTGAAATTAATCAGTCTCAGAATC
GGTGTGATCGACATCAACAACTTCGAAGAGCCGACAGGCATTGCTCTGGA
GAGTTTTTTATTTCCAAACTTAAGGGTGTCGTTTCCTCTTCAGATCCTTA
TTCTAAATACGAAATTCTGGATCGAATAGGTCAGGGGGCTTCGGGTGTTG
TGATGGGCGGTCGAGATCTGGAAACCAAGAAAAAAGTAGCAATTAAACAA
ATGAATTTAAAACAGCAACCAAAGAAAGATCTTATCCTCAATGAAATTCT
CGTAATTAAAGCTAATAAGCATCAGAATATCGTTAATTATCTCGACAGTT
TCATTATGAACAACGAATTATGGGTAGTGATGGAATACCTAGACGGAGGG
TCACTTACTGATGTTGTCACTGAAGCTTGTATGGACGAATTTCAAATTGC
GACAATTTGTCGAGAAGTTACAATGGCATTAGGATTTTTACATTCTAATC
ATGTAATCCACCGTGACATAAAATCAGATAATATACTCCTTGGATTAGAC
GGATCTGTGAAAATAATCGATTTCGGATTTTGTGCTCAATTGATTGGAGG
TCGAAATAATCGATCAACAATGGTTGGAACACCTTATTGGATGGCACCAG
AAGTTGTTACTAGAAAACAATATGGTCCTAAAGTGGATTTGTGGTCCCTT
GGAATTATGGTTATTGAAATGTTGGAAGGGGAGCCTCCATATCTCAATGA
AAATCCTTTGCGCGCTTTATTTAATAGCAACAAATGGAAAGCCTTCATTG
AAGGACCCAACAACAGTTTCGCCTTTATTCTTAGATTTTTTGGACCGTTG
CCTTGAGGTTGATATTGATAAAAGAGCGTCTGCTTCTTCTTTATTGAAAC
ACGAGTTCATTACTGACAAAAGCAAGCCGGTGTCCATTCTCATTCCTTTG
ATATTGTTGGCAAGAGAACAGTCAGAAATCTGCGAGCAATGATCCATGAC
GTTCTGTCCAATATCTATAAATATTTATATTCATATTCATATTATTGTGA
TGAGGTCCTTATTATTTATTATTTTATTGATTTCTTCTTATTCGTTAATT
GATAATATTAATAATACATTTTATTGATATTTTTCAAATTTTCAGTGTTA
TATTGGTTTATTTTTTCACATTGTTTCCATTTCTTTCAATTGGATCGAAT
TTGAACTTTGTTCTTGTTGAGATTATTTGTAGTTTTGTGGTATTTTATTT
TTTATTTTTATATTTATACCAACTGACACAACTTCAATCTATTCTGTGAT
GCAAATTTTTAATTCTAGTCATTTATTTTTAGGTGGTTTTGTATTTACAG
TGTGTTGAGAATTCCTGGCTGAGTTGATATTAGTAAAATGTGTATATTTT
TTTTCCATTTTTCTGAACTTAGATAACATAATGTGATATGTGGCACACGG
ATAAGTGAATCAGTGCAAATTAATAAAATATTTTTAATATTCATCCCTTG
CTAAGGAAATAATTTCAAATCTTTGTATTTTTTTTGATATTTTTATTGGT
TAGTTAAATGCAAATATTTGCATCTATACTTTTTTCAAACTATGGGTTGC
GAACTTGGGGATTTTCATATGAGGCTACGAAATATTTTGAGCTTTTTAAT
GTAGCTCTTTTTTTTTTTAAATCCATACTTAAACAAAACTACGGTTCTAC
back to top

protein sequence of SMED30027002-orf-1

>SMED30027002-orf-1 ID=SMED30027002-orf-1|Name=SMED30027002-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MVLKWICGPLELWLLKCWKGSLHISMKILCALYLIATNGKPSLKDPTTVS
PLFLDFLDRCLEVDIDKRASASSLLKHEFITDKSKPVSILIPLILLAREQ
SEICEQ*
back to top

protein sequence of SMED30027002-orf-2

>SMED30027002-orf-2 ID=SMED30027002-orf-2|Name=SMED30027002-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
MDNKSNSIEINETLDSELPPAPPIRSSSTLRRKDRYSVSKPLPSPPIKKE
KKKKTKLFKLPKFNYNDPKISSPTYVSHNFHVVFDPTTGDFQGLPVSWKE
WLKASNISKTEQKDNPELLLDVLQCLDLSQQSEPKYFQDREIFYQPPIVP
PHLPINEKDLEIKPQLVNNVTSGSPSDRPASSSGSHSSRDSSNSSRSSSS
NSPDCSQCQYSEKVSTLTATSSIHPSQMPNSKRESSGIVADASSFECISC
QKEGNNKPENIITDQFTELKSPLLEVETDELGETGDSVTPCDKSKDSVSI
EINQSQNRCDRHQQLRRADRHCSGEFFISKLKGVVSSSDPYSKYEILDRI
GQGASGVVMGGRDLETKKKVAIKQMNLKQQPKKDLILNEILVIKANKHQN
IVNYLDSFIMNNELWVVMEYLDGGSLTDVVTEACMDEFQIATICREVTMA
LGFLHSNHVIHRDIKSDNILLGLDGSVKIIDFGFCAQLIGGRNNRSTMVG
TPYWMAPEVVTRKQYGPKVDLWSLGIMVIEMLEGEPPYLNENPLRALFNS
NKWKAFIEGPNNSFAFILRFFGPLP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036936CRIB_dom_sf
IPR033923PAK_BD
IPR000719Prot_kinase_dom
IPR000095CRIB_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003824catalytic activity
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0004708MAP kinase kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0017048Rho GTPase binding
GO:0017124SH3 domain binding
GO:0046872metal ion binding
GO:0051020GTPase binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000165MAPK cascade
GO:0000187activation of MAPK activity
GO:0007275multicellular organism development
GO:0007409axonogenesis
GO:0008152metabolic process
GO:0010763positive regulation of fibroblast migration
GO:0010975regulation of neuron projection development
GO:0016310phosphorylation
GO:0016358dendrite development
GO:0023014signal transduction by protein phosphorylation
GO:0030833regulation of actin filament polymerization
GO:0032956regulation of actin cytoskeleton organization
GO:0035556intracellular signal transduction
GO:0043525positive regulation of neuron apoptotic process
GO:0060996dendritic spine development
GO:0060997dendritic spine morphogenesis
GO:0061003positive regulation of dendritic spine morphogenesis
GO:0071407cellular response to organic cyclic compound
GO:2000573positive regulation of DNA biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005768endosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000095CRIB domainSMARTSM00285PBD_5coord: 73..108
e-value: 0.0025
score: 27.1
IPR000095CRIB domainPFAMPF00786PBDcoord: 72..127
e-value: 2.4E-14
score: 53.4
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 347..574
e-value: 1.2E-71
score: 254.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 347..545
e-value: 4.7E-62
score: 209.7
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 347..578
score: 44.089
IPR036936CRIB domain superfamilyGENE3DG3DSA:3.90.810.10coord: 69..144
e-value: 1.2E-22
score: 81.9
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 292..423
e-value: 5.6E-38
score: 132.7
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 424..569
e-value: 4.2E-53
score: 181.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 172..240
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 14..54
NoneNo IPR availablePANTHERPTHR45832FAMILY NOT NAMEDcoord: 65..551
NoneNo IPR availablePANTHERPTHR45832:SF7coord: 65..551
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 353..376
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 462..474
IPR033923p21 activated kinase binding domainCDDcd01093CRIB_PAK_likecoord: 71..116
e-value: 3.45327E-13
score: 61.9023
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 340..558