ATP-dependent rRNA helicase RRP3

Overview
NameATP-dependent rRNA helicase RRP3
Smed IDSMED30026996
Length (bp)1374
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent rRNA helicase RRP3 (SMED30026996) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent rRNA helicase RRP3 (SMED30026996) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent rRNA helicase RRP3 (SMED30026996) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent rRNA helicase RRP3 (SMED30026996) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026996

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026996h1SMcG0002853 SmedASXL_014023SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30026996h1SMcG0002853 dd_Smed_v4_3055_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026996h1SMcG0002853 dd_Smed_v4_3055_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30026996h1SMcG0002853 dd_Smed_v4_8047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30026996h1SMcG0002853 dd_Smed_v4_8047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Human
Match: DDX47 (DEAD-box helicase 47 [Source:HGNC Symbol;Acc:HGNC:18682])

HSP 1 Score: 285.804 bits (730), Expect = 2.711e-91
Identity = 155/354 (43.79%), Postives = 225/354 (63.56%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F+ LGV   L E  +++GW +PT+IQ + IPL L+  D++ LAETGSGKTGAFA+PI+  L + P+  FAL+LTPT ELA QI  +F  LG   G++   IVGG     Q+ L  + K H+++ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +KNP++  VS K+       QQ  +F     +  +LV+ L  L   S        ++F  T  +T+    LL  L  +   L   M++ +R  +L+ F +   ++L+ATDVASRGLDIP+V +V+NF +P  SKDY+HRVGRTARAGRSG AI+  T Y
Sbjct:   26 FKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQS-LALAKKPHIIIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKY-QTVEKLQQYYIFIPSKFKDTYLVYILNELAGNS-------FMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQY 370          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Human
Match: DDX47 (DEAD-box helicase 47 [Source:HGNC Symbol;Acc:HGNC:18682])

HSP 1 Score: 261.151 bits (666), Expect = 2.166e-82
Identity = 148/354 (41.81%), Postives = 209/354 (59.04%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F+ LGV   L E  +++GW +PT+IQ + IPL L+  D++ LAETGSGKTGAFA+PI+  L + P+  FAL+LTPT ELA QI  +F  LG   G++   IVGG     Q+ L  + K H+++ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +KNP++  VS K+QT                     V KLQ               +F  +K  +K                        R  +L+ F +   ++L+ATDVASRGLDIP+V +V+NF +P  SKDY+HRVGRTARAGRSG AI+  T Y
Sbjct:   26 FKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQS-LALAKKPHIIIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQT---------------------VEKLQ------------QYYIFIPSKFKSK------------------------RLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQY 321          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Human
Match: DDX49 (DEAD-box helicase 49 [Source:HGNC Symbol;Acc:HGNC:18684])

HSP 1 Score: 256.529 bits (654), Expect = 1.215e-79
Identity = 157/393 (39.95%), Postives = 219/393 (55.73%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGG-EFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSD---DFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPL--RAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNV 1211
            F +LG+   L E+  ++G  +PT +Q   IP +L+  D +  A+TGSGKT AF +PI+QKL + P   F L+LTPT ELA QI  +F  LG+  GLK   IVGG + V    +L  S K HVV+ TPGR+  H+ +    + K +RFLV+DEADR+L     DF  DL AI+ ++P  RQT LFSAT+T+ L +L+ +    P    A+               +  +  D  ++ L+ + Q      DE++  ++I+FT T K  +IL  +L +       L S M + ER  AL  F S    +L+ATDVASRGLDIP V +VIN   P   K Y+HRVGRTARAGR G AI+L T Y    +  IE+ +   ++   V   E  +I   V
Sbjct:    4 FAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALEL--SRKPHVVIATPGRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQ------DEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQV 388          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 210.69 bits (535), Expect = 7.959e-63
Identity = 116/349 (33.24%), Postives = 199/349 (57.02%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            F+ +G+  +L   I   G+ +P+ IQ++ I  ++K  DV+A +++G+GKT  F+I ++Q L  + +   ALIL PT ELAVQI+   + LG+   ++    +GG  V +  + L   + HVV GTPGRV   I ++ L  + ++ LVLDEAD ML+  F   +  +   LP   Q  L SAT+ +++ ++ +  + +P+R  V R   T++ + Q  +    ++       WK  +L +  D    +  ++F  TK+    L   + E + +V+ +  DM + ER++ +  F SG   VL++TDV +RGLD+P V L+IN+ +P + + Y+HR+GR+ R GR G+AI+ 
Sbjct:   40 FDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQ-HVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREE-------WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINF 380          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 210.69 bits (535), Expect = 7.959e-63
Identity = 116/349 (33.24%), Postives = 199/349 (57.02%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            F+ +G+  +L   I   G+ +P+ IQ++ I  ++K  DV+A +++G+GKT  F+I ++Q L  + +   ALIL PT ELAVQI+   + LG+   ++    +GG  V +  + L   + HVV GTPGRV   I ++ L  + ++ LVLDEAD ML+  F   +  +   LP   Q  L SAT+ +++ ++ +  + +P+R  V R   T++ + Q  +    ++       WK  +L +  D    +  ++F  TK+    L   + E + +V+ +  DM + ER++ +  F SG   VL++TDV +RGLD+P V L+IN+ +P + + Y+HR+GR+ R GR G+AI+ 
Sbjct:   40 FDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQ-HVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREE-------WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINF 380          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Celegans
Match: T26G10.1 (Putative ATP-dependent RNA helicase T26G10.1 [Source:UniProtKB/Swiss-Prot;Acc:P34580])

HSP 1 Score: 291.967 bits (746), Expect = 1.256e-93
Identity = 162/379 (42.74%), Postives = 234/379 (61.74%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNE 1187
            F +LGV   L +  +++GW +P++IQ+  +P  L+  DV+ LAETGSGKTGAFAIP++Q L D P+  F L+LTPT ELA QI  +F  LG   GL    IVGG  +  Q   L + + H++V TPGR++ H+ N K  N K L+FL++DEADR+L+ DF  +L  I++ +P+ R+T LFSATMT K+ KLE   +++P R  VS ++       +Q  +F  +  +  +LV+    LLN   E+  ++ IVF  T   T  +  +L +L +    L   M++ +R  +L+ F S    +LV TDVA+RGLDIP+V +VIN+ +P  SKDY+HRVGRTARAGRSG+AI++ T Y       IE +LG  +       NE
Sbjct:   46 FAELGVSQPLCDACQRLGWMKPSKIQQAALPHALQGKDVIGLAETGSGKTGAFAIPVLQSLLDHPQAFFCLVLTPTRELAFQIGQQFEALGSGIGLIAAVIVGGVDMAAQAMAL-ARRPHIIVATPGRLVDHLENTKGFNLKALKFLIMDEADRILNMDFEVELDKILKVIPRERRTYLFSATMTKKVSKLERASLRDPARVSVSSRY-KTVDNLKQHYIFVPNKYKETYLVY----LLN---EHAGNSAIVFCATCATTMQIAVMLRQLGMQAVPLHGQMSQEKRLGSLNKFKSKAREILVCTDVAARGLDIPHVDMVINYDMPSQSKDYVHRVGRTARAGRSGIAITVVTQYDVEAYQKIEANLGKKLDEYKCVENE 415          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4332507:1 gene:WBGene00019219.1 transcript:H20J04.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 246.514 bits (628), Expect = 4.414e-76
Identity = 150/387 (38.76%), Postives = 221/387 (57.11%), Query Frame = 3
Query:   51 KFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRV--LLHINKKLLN--FKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDE-RVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEE 1196
            KF +LGV   ++++++ +     T +Q   IP +L+ +D++  A TG+GKT AFAIPI+QKL   P   +ALILTPT ELA QI  +F  LG+   LK   IVGG  +  Q + L S + HVVV TPGR+  L+  +   +   FK ++F VLDEADRML   + + L  I ES+ + RQT L SAT+TN +  L  V  + P   E   K         ++    C    +  +LV+ ++   N S++N  S+V++F +T ++ + L  +   L   V  L S + + +R  AL +F S  + V++ TDVASRGLDIP+V LV+N  VP+  K Y+HRVGR+ARAGR G A+S  T Y    L  +E+ +G  +  + V    F +
Sbjct:   90 KFSQLGVCSWITQQLQTMQIKTATPVQAACIPKILEGSDILGCARTGTGKTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLIHQAREL-SERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPYFFEDKGKDDESTVDRLEQKYVVCPVAVKDAYLVYVVK---NYSEKNPKSSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAFRSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAVEQVIGKKLDELKVKIQTFRK 472          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4334091:1 gene:WBGene00019219.1 transcript:H20J04.4b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 245.743 bits (626), Expect = 5.091e-75
Identity = 149/380 (39.21%), Postives = 219/380 (57.63%), Query Frame = 3
Query:   51 KFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRV--LLHINKKLLN--FKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDE-RVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDV 1175
            KF +LGV   ++++++ +     T +Q   IP +L+ +D++  A TG+GKT AFAIPI+QKL   P   +ALILTPT ELA QI  +F  LG+   LK   IVGG  +  Q + L S + HVVV TPGR+  L+  +   +   FK ++F VLDEADRML   + + L  I ES+ + RQT L SAT+TN +  L  V  + P   E   K         ++    C    +  +LV+ ++   N S++N  S+V++F +T ++ + L  +   L   V  L S + + +R  AL +F S  + V++ TDVASRGLDIP+V LV+N  VP+  K Y+HRVGR+ARAGR G A+S  T Y    L  +E+ +G  +  + V
Sbjct:   90 KFSQLGVCSWITQQLQTMQIKTATPVQAACIPKILEGSDILGCARTGTGKTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLIHQAREL-SERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPYFFEDKGKDDESTVDRLEQKYVVCPVAVKDAYLVYVVK---NYSEKNPKSSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAFRSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAVEQVIGKKLDELKV 465          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4334484:1 gene:WBGene00019219.1 transcript:H20J04.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 245.743 bits (626), Expect = 5.091e-75
Identity = 149/380 (39.21%), Postives = 219/380 (57.63%), Query Frame = 3
Query:   51 KFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRV--LLHINKKLLN--FKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDE-RVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDV 1175
            KF +LGV   ++++++ +     T +Q   IP +L+ +D++  A TG+GKT AFAIPI+QKL   P   +ALILTPT ELA QI  +F  LG+   LK   IVGG  +  Q + L S + HVVV TPGR+  L+  +   +   FK ++F VLDEADRML   + + L  I ES+ + RQT L SAT+TN +  L  V  + P   E   K         ++    C    +  +LV+ ++   N S++N  S+V++F +T ++ + L  +   L   V  L S + + +R  AL +F S  + V++ TDVASRGLDIP+V LV+N  VP+  K Y+HRVGR+ARAGR G A+S  T Y    L  +E+ +G  +  + V
Sbjct:   90 KFSQLGVCSWITQQLQTMQIKTATPVQAACIPKILEGSDILGCARTGTGKTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLIHQAREL-SERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPYFFEDKGKDDESTVDRLEQKYVVCPVAVKDAYLVYVVK---NYSEKNPKSSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAFRSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAVEQVIGKKLDELKV 465          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Celegans
Match: ddx-27 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q95XM9])

HSP 1 Score: 225.713 bits (574), Expect = 5.263e-66
Identity = 138/355 (38.87%), Postives = 204/355 (57.46%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKH---NFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDE--RVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            FE++ +   + +     G+++PT IQ+  IP+ L   D+ A A TG+GKT AF +PI++++  +PK       L+L PT ELA+Q+   F KL     L+V    GG  ++ Q   L+S    VVV TPGR++ H+ N    N   +  LVLDEADRML + F + +  +I    + RQT LFSATMT ++++L S+ ++ P++  ++    T   L Q+ +  R   E  R   +   +     T       N IVF  TKKD + +  LLG L I V  +QS +T+ +R  +L  F   ++ VLV+TD+ASRGLDI  V  VIN  +P+S K Y+HRVGRTARAG++G +ISL
Sbjct:  150 FEQMNLSRQILKACSGAGYSDPTPIQQACIPVALTGKDICACAATGTGKTAAFVLPILERMIYRPKGASCTRVLVLVPTRELAIQVFQVFRKLSTFIQLEVCLCAGGLDLKAQEAALRSGP-DVVVATPGRLIDHLHNSPSFNLSNIEVLVLDEADRMLEEAFRDQMNELIRLCAQNRQTLLFSATMTEEIDELASMSLQKPVKIFINENTDTALKLRQEFIRIRAGRETDREAMVAALVTRTFQT-------NTIVFVRTKKDCQRMQILLGLLGIKVGQMQSSLTQGQRIESLSKFKKAEIDVLVSTDLASRGLDIEGVQTVINMNMPKSIKQYIHRVGRTARAGKAGRSISL 496          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Fly
Match: CG9253 (gene:FBgn0032919 transcript:FBtr0081468)

HSP 1 Score: 282.722 bits (722), Expect = 9.796e-90
Identity = 161/390 (41.28%), Postives = 245/390 (62.82%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGG-EFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQS--LLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNV 1211
            ++ LG++  L +  +++ W  P++IQR+ IP+ L+  DV+ LAETGSGKTGAFA+PI+  L + P+  FAL+LTPT ELA QI  +F  LG   G+K   +VGG + V    +L K  K H+++ TPGR++ H+ N K  N K +++LV+DEADR+L+ DF  +L  I++ LP+ R+T LFSATMT K++KL+   +K+P++ EVS K+QTV+ L           +  LF+  K +   L++  +E   ++ ++F  T  +T     +L  L ++   L   M++ +R  AL+ F +   ++L++TDVASRGLDIP+V +V+NF +P  SKDY+HRVGRTARAGRSG AI+L + Y       IE  LG  +       +E   +Q+ V
Sbjct:   63 WKDLGLNEALCQACDELKWKAPSKIQREAIPVALQGKDVIGLAETGSGKTGAFALPILHALLENPQRYFALVLTPTRELAFQIGEQFEALGSGIGIKCCVVVGGMDMVAQGLQLAK--KPHIIIATPGRLVDHLENMKGFNLKAIKYLVMDEADRILNMDFEVELDKILKVLPRERRTFLFSATMTKKVKKLQRASLKDPVKVEVSNKYQTVEQL----------QQSYLFIPVKYKDVYLVHILNELAGNSFMIFCSTCNNTVKTALMLRALGLAAIPLHGQMSQNKRLAALNKFKAKNRSILISTDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITLVSQYDIELYQRIEHLLGKQLTLYKCEEDEVMALQERV 440          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Fly
Match: Dbp45A (gene:FBgn0010220 transcript:FBtr0088564)

HSP 1 Score: 254.218 bits (648), Expect = 1.248e-78
Identity = 148/361 (41.00%), Postives = 221/361 (61.22%), Query Frame = 3
Query:   45 GNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGG--EFVEDQTKLLKSNKCHVVVGTPGRVLLHINK-KLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEK-----LESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDD-ERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
             N F+ LG+   L +++ K+G    T IQ+K IP +L   D +  A+TGSGKT AFA+PI+++L ++P  +FAL+LTPTHELA QI  +F+  G+  G++V  + GG  + VE Q KL++  + H+VV  PGR+  H+      +F  L++LV+DEADRML+ DF   L+ I   LPK RQ   FSATM + +++     + S C       E S+        T  +    C D +R + L+   ++L    +EN+++NV++FT TKK  ++L   L  ++I    L   M + ER  AL  F S ++  L+ATDVA+RGLDIP+V LV+N  +P + K+Y+HRVGRTARAGR G++IS+
Sbjct:    6 ANPFQILGLRPWLVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQMVESQ-KLMQ--RPHIVVAMPGRLADHLTGCDTFSFDNLKYLVVDEADRMLNGDFDESLSIIERCLPKTRQNLFFSATMKDFIKESSIFPIASDCF------EWSQDSDVATVETLDQRYLLCADYDRDMVLI---EALRKYREENENANVMIFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIATDVAARGLDIPSVELVMNHMLPRTPKEYIHRVGRTARAGRKGMSISI 354          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445187)

HSP 1 Score: 209.149 bits (531), Expect = 2.821e-60
Identity = 126/349 (36.10%), Postives = 189/349 (54.15%), Query Frame = 3
Query:   87 EKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFAL------ILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIE--SLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDD-ERVLFLVWKL--QSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            + + K G+  PT IQ+  IP++    D++A A+TGSGKT AF +PI+ KL + P H   L      I++PT ELA+QI NE  K   E  LK+  + GG     Q + + +  CHVV+ TPGR+L  +++  + F+  RF+VLDEADRML   F  D+  I+   ++    QT +FSAT   +++++    +KN +   +              +   C D ++ ++ V K   +S L      Q+   IVF ETK+    L   L E +     +  D  + +R+ AL  F +G + VL+AT VASRGLDI N+  VIN+ +P    DY+HR+GRT R G +G A S 
Sbjct:  258 DNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDP-HELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECI-TRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIG------------IVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSF 592          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445185)

HSP 1 Score: 209.149 bits (531), Expect = 2.821e-60
Identity = 126/349 (36.10%), Postives = 189/349 (54.15%), Query Frame = 3
Query:   87 EKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFAL------ILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIE--SLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDD-ERVLFLVWKL--QSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            + + K G+  PT IQ+  IP++    D++A A+TGSGKT AF +PI+ KL + P H   L      I++PT ELA+QI NE  K   E  LK+  + GG     Q + + +  CHVV+ TPGR+L  +++  + F+  RF+VLDEADRML   F  D+  I+   ++    QT +FSAT   +++++    +KN +   +              +   C D ++ ++ V K   +S L      Q+   IVF ETK+    L   L E +     +  D  + +R+ AL  F +G + VL+AT VASRGLDI N+  VIN+ +P    DY+HR+GRT R G +G A S 
Sbjct:  258 DNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDP-HELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECI-TRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIG------------IVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSF 592          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445186)

HSP 1 Score: 209.149 bits (531), Expect = 2.821e-60
Identity = 126/349 (36.10%), Postives = 189/349 (54.15%), Query Frame = 3
Query:   87 EKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFAL------ILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIE--SLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDD-ERVLFLVWKL--QSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            + + K G+  PT IQ+  IP++    D++A A+TGSGKT AF +PI+ KL + P H   L      I++PT ELA+QI NE  K   E  LK+  + GG     Q + + +  CHVV+ TPGR+L  +++  + F+  RF+VLDEADRML   F  D+  I+   ++    QT +FSAT   +++++    +KN +   +              +   C D ++ ++ V K   +S L      Q+   IVF ETK+    L   L E +     +  D  + +R+ AL  F +G + VL+AT VASRGLDI N+  VIN+ +P    DY+HR+GRT R G +G A S 
Sbjct:  258 DNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDP-HELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECI-TRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIG------------IVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSF 592          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Zebrafish
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 254.603 bits (649), Expect = 2.740e-79
Identity = 154/359 (42.90%), Postives = 215/359 (59.89%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSD---DFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERV--LFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            FE LG+   L ++ +++G + PT +Q K IP +L   D +  A+TGSGKT AF +P++QKL + P   F L+LTPT ELA QI  +F  LG+  GLK   IVGG  +  Q   L S K HVVV TPGR+  HI +   +N   ++FL++DEADR+L     DF  DL  I+ ++P  RQT LFSAT+T+ L++L+S+ +  P   E       VQT+ +    F    E+V   +LV  +Q+     DE+   ++I+FT T K  +IL  +L E +     L S M + +R   L  F S    +L+ATDVA+RGLDIP V +VIN   P   K Y+HRVGRTARAGR+G++I+L T Y
Sbjct:    4 FESLGLSEWLIQQCKQMGISRPTAVQEKCIPAILDGRDCMGCAKTGSGKTAAFVLPVLQKLSEDPYGVFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVTQGLEL-SKKPHVVVATPGRLADHIRSSDTINLNRIQFLIMDEADRLLEQGCTDFTKDLEVILSAVPVKRQTLLFSATLTDTLQQLQSIAMNRPFFWE---HKSDVQTVKELDQRFILTPEKVKDAYLVHLIQTF---QDEHDDWSIIIFTNTCKSCQILTMMLREFNFPTISLHSMMKQRQRFANLAKFKSNVFKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQY 355          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Zebrafish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:394053])

HSP 1 Score: 211.075 bits (536), Expect = 3.241e-63
Identity = 115/349 (32.95%), Postives = 198/349 (56.73%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            F+ +G+  +L   I   G+ +P+ IQ++ I  ++K  DV+A +++G+GKT  F + ++Q L  + +   ALIL PT ELA QI+   + LG+   ++    +GG  V +  + L   + HVV GTPGRV   I ++ L  + ++ LVLDEAD ML+  F   +  +   LP   Q CL SAT+ +++ ++ +  + +P+R  V R   T++ + Q  +    ++       WK  +L +  D    +  ++F  TK+    L   + E + +V+ +  DM + ER++ +  F SG   VL++TDV +RGLD+P V L+IN+ +P + + Y+HR+GR+ R GR G+AI+ 
Sbjct:   35 FDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQ-HVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREE-------WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINF 375          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Zebrafish
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 206.453 bits (524), Expect = 1.084e-58
Identity = 125/380 (32.89%), Postives = 201/380 (52.89%), Query Frame = 3
Query:   87 EKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPI---------IQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLP--------------------------KMRQTCLFSATMTNKLEKLESVCVKNP---LRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVW--KLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLAT 1106
            E IEK G+ +PT IQR+ IP+ L+  D++ +AETGSGKT AF IP+         I ++ D  +  +A+IL PT ELA QI+ E +K G+  G++ V ++GG   EDQ   L+   C +V+ TPGR++  +  + L      ++VLDEADRM+   F  D+  I+E +P                          K RQT +F+ATM   +E+L    ++ P         + H+ V             +++V+ +    K + LL          +I+F   KK   +L + L ++  +   L     + +R+ AL +  +G   +LVATDVA RG+DI +V +V+N+ + ++ +DY+HR+GRT RAG+SG+A++  T
Sbjct:  331 EVIEKCGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEDSDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMG-CEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEYIPVTNQKPDTDDAEDPEKMMQNFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERV-------------EQKVILMSEGEKRKKLLEVLASGFEPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVLNYDMAKNIEDYIHRIGRTGRAGKSGVAMTFLT 696          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Zebrafish
Match: ddx54 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [Source:ZFIN;Acc:ZDB-GENE-021220-2])

HSP 1 Score: 207.608 bits (527), Expect = 1.123e-58
Identity = 133/359 (37.05%), Postives = 198/359 (55.15%), Query Frame = 3
Query:   33 KMFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNF---ALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            K  GG  F+ +G+   + + I K G+  PT IQRK IP++L   DVVA+A TGSGKT AF +P+ +KL   P+      ALILTPT ELA+Q      +LG+  GL+   I+GG+ ++DQ   L  N   +++GTPGR++  I +  L  +++ ++V DEADR+    F   L  II  LP  RQT LFSAT+   + +     +  P+   +    +  + L       R DD+  L L   L++++   ++      +VF  TK   + L  LL    +  + + S + +  R+ ++  F   KV +L+ TDVA+RG+DIP +  VIN+  P   K +LHRVGR ARAGR G A SL
Sbjct:   75 KKSGG--FQSMGLSYPVYKGIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTAAFLVPLFEKL-KAPQAQTGARALILTPTRELALQTMKFTKELGKFTGLRTALILGGDSMDDQFAALHENP-DIIIGTPGRLMHVIQEMNLKLQSVEYVVFDEADRLFEMGFAEQLQEIIRRLPDARQTLLFSATLPKLIVEFARAGLTEPVLIRLDVDTKLSEQLKLSFFSLRLDDKPALLLHL-LRNVVKPQEQ-----TVVFVATKHHVEYLKELLSAEGVDCSCIYSALDQTARKISIGRFVHRKVMLLLVTDVAARGIDIPLLDNVINYNFPCKPKLFLHRVGRVARAGRGGTAYSL 423          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Zebrafish
Match: ddx27 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:ZFIN;Acc:ZDB-GENE-031001-8])

HSP 1 Score: 205.682 bits (522), Expect = 2.674e-58
Identity = 125/353 (35.41%), Postives = 202/353 (57.22%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHN---FALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            F+ + +   L + I  +G+ +PT IQ+  +P+ L   D+ A A TG+GKT AF +P++++L  KP+       L+L PT EL +Q+     +L +   +     VGG  ++ Q   L++    V++ TPGR++ H+ N        +  L+LDEADRML + F   +  II      RQT LFSATM+ +++ L SV +K P+R  V+        L Q+ +  R + E     +  + +LL  + ++   +V++FT+TKK    ++ LLG + + V  L  ++++ +R  +L  F   ++ +LVATDVA+RGLDI  V  VINF +P + K Y+HRVGRTARAG+ G ++SL
Sbjct:  203 FQDMNLSRPLLKAISTMGFKQPTPIQKACVPVGLLGKDICACAATGTGKTAAFMLPVLERLIYKPRETQVTRVLVLVPTRELGIQVHTVARQLAQFTTISTCLAVGGLDLKSQEAALRAG-PDVLIATPGRLIDHLHNTPSFELSQIEILILDEADRMLDEYFEEQMKEIIRMCAYQRQTMLFSATMSEEVKDLASVSLKQPVRIFVNSNTDVAPYLRQEFVRIRPNKEGDREAI--VAALLTRTFQD---HVMLFTQTKKQAHRMHILLGLMGLKVGELHGNLSQTQRLESLRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGKVGRSVSL 549          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 288.115 bits (736), Expect = 2.746e-92
Identity = 157/354 (44.35%), Postives = 228/354 (64.41%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F +LGV   L E  E++GW +PT+IQ + IP+ L+  D++ LAETGSGKTGAFA+PI+Q L + P+  +AL+LTPT ELA QI  +F  LG   G+K   IVGG  +  Q+ L  + K HVV+ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +K+P++  VS K+       QQ  +F     +  +LV+ L  L   S        ++F  T  +T+ +  LL  L  +   L   M++ +R  +L+ F +   ++L+ATDVASRGLDIP+V +VINF +P  SKDY+HRVGRTARAGRSG AI+  + Y
Sbjct:   21 FRELGVTDVLCETCEQLGWKQPTKIQIEAIPVALQGRDIIGLAETGSGKTGAFALPILQTLLESPQRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQS-LALAKKPHVVIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKDPVKCAVSSKY-QTVEKLQQFYVFIPSKFKDSYLVYILNELAGNS-------FMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQY 365          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 285.034 bits (728), Expect = 4.222e-91
Identity = 156/351 (44.44%), Postives = 226/351 (64.39%), Query Frame = 3
Query:   63 LGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            LGV   L E  E++GW +PT+IQ + IP+ L+  D++ LAETGSGKTGAFA+PI+Q L + P+  +AL+LTPT ELA QI  +F  LG   G+K   IVGG  +  Q+ L  + K HVV+ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +K+P++  VS K+       QQ  +F     +  +LV+ L  L   S        ++F  T  +T+ +  LL  L  +   L   M++ +R  +L+ F +   ++L+ATDVASRGLDIP+V +VINF +P  SKDY+HRVGRTARAGRSG AI+  + Y
Sbjct:   20 LGVTDVLCETCEQLGWKQPTKIQIEAIPVALQGRDIIGLAETGSGKTGAFALPILQTLLESPQRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQS-LALAKKPHVVIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKDPVKCAVSSKY-QTVEKLQQFYVFIPSKFKDSYLVYILNELAGNS-------FMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQY 361          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 283.878 bits (725), Expect = 7.741e-91
Identity = 155/350 (44.29%), Postives = 225/350 (64.29%), Query Frame = 3
Query:   66 GVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            GV   L E  E++GW +PT+IQ + IP+ L+  D++ LAETGSGKTGAFA+PI+Q L + P+  +AL+LTPT ELA QI  +F  LG   G+K   IVGG  +  Q+ L  + K HVV+ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +K+P++  VS K+       QQ  +F     +  +LV+ L  L   S        ++F  T  +T+ +  LL  L  +   L   M++ +R  +L+ F +   ++L+ATDVASRGLDIP+V +VINF +P  SKDY+HRVGRTARAGRSG AI+  + Y
Sbjct:    9 GVTDVLCETCEQLGWKQPTKIQIEAIPVALQGRDIIGLAETGSGKTGAFALPILQTLLESPQRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQS-LALAKKPHVVIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKDPVKCAVSSKY-QTVEKLQQFYVFIPSKFKDSYLVYILNELAGNS-------FMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQY 349          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 283.878 bits (725), Expect = 1.253e-90
Identity = 155/350 (44.29%), Postives = 225/350 (64.29%), Query Frame = 3
Query:   66 GVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            GV   L E  E++GW +PT+IQ + IP+ L+  D++ LAETGSGKTGAFA+PI+Q L + P+  +AL+LTPT ELA QI  +F  LG   G+K   IVGG  +  Q+ L  + K HVV+ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +K+P++  VS K+       QQ  +F     +  +LV+ L  L   S        ++F  T  +T+ +  LL  L  +   L   M++ +R  +L+ F +   ++L+ATDVASRGLDIP+V +VINF +P  SKDY+HRVGRTARAGRSG AI+  + Y
Sbjct:   27 GVTDVLCETCEQLGWKQPTKIQIEAIPVALQGRDIIGLAETGSGKTGAFALPILQTLLESPQRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQS-LALAKKPHVVIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKDPVKCAVSSKY-QTVEKLQQFYVFIPSKFKDSYLVYILNELAGNS-------FMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQY 367          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 283.493 bits (724), Expect = 1.490e-90
Identity = 155/350 (44.29%), Postives = 225/350 (64.29%), Query Frame = 3
Query:   66 GVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            GV   L E  E++GW +PT+IQ + IP+ L+  D++ LAETGSGKTGAFA+PI+Q L + P+  +AL+LTPT ELA QI  +F  LG   G+K   IVGG  +  Q+ L  + K HVV+ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +K+P++  VS K+       QQ  +F     +  +LV+ L  L   S        ++F  T  +T+ +  LL  L  +   L   M++ +R  +L+ F +   ++L+ATDVASRGLDIP+V +VINF +P  SKDY+HRVGRTARAGRSG AI+  + Y
Sbjct:   20 GVTDVLCETCEQLGWKQPTKIQIEAIPVALQGRDIIGLAETGSGKTGAFALPILQTLLESPQRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQS-LALAKKPHVVIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKDPVKCAVSSKY-QTVEKLQQFYVFIPSKFKDSYLVYILNELAGNS-------FMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQY 360          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Mouse
Match: Ddx47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:MGI Symbol;Acc:MGI:1915005])

HSP 1 Score: 286.574 bits (732), Expect = 9.664e-92
Identity = 157/356 (44.10%), Postives = 230/356 (64.61%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQS--LLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F+ LGV   L E  +++GW +PT+IQ + IPL L+  D++ LAETGSGKTGAFA+PI+  L + P+  FAL+LTPT ELA QI  +F  LG   G++   IVGG     Q+ L  + K H+V+ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +KNP++  VS K+QTV+ L           +  LF+  K +   L+   +E   ++ ++F  T  +T+    LL  L  +   L   M++ +R  +L+ F +   ++L+ATDVASRGLDIP+V +V+NF +P  SKDY+HRVGRTARAGRSG AI+  T Y
Sbjct:   26 FKDLGVTDVLCEACDQLGWAKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQCAVIVGGIDSMSQS-LALAKKPHIVIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKL----------QQYYLFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQY 370          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Mouse
Match: Ddx47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:MGI Symbol;Acc:MGI:1915005])

HSP 1 Score: 263.462 bits (672), Expect = 9.086e-84
Identity = 148/356 (41.57%), Postives = 217/356 (60.96%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQS--LLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F+ LGV   L E  +++GW +PT+IQ + IPL L+  D++ LAETGSGKTGAFA+PI+  L + P+  FAL+LTPT ELA QI  +F  LG   G++                           TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +KNP++  VS K+QTV+ L           +  LF+  K +   L+   +E   ++ ++F  T  +T+    LL  L  +   L   M++ +R  +L+ F +   ++L+ATDVASRGLDIP+V +V+NF +P  SKDY+HRVGRTARAGRSG AI+  T Y
Sbjct:   26 FKDLGVTDVLCEACDQLGWAKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQ-------------------------CATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKL----------QQYYLFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQY 346          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Mouse
Match: Ddx47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:MGI Symbol;Acc:MGI:1915005])

HSP 1 Score: 262.307 bits (669), Expect = 1.828e-83
Identity = 149/354 (42.09%), Postives = 209/354 (59.04%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F+ LGV   L E  +++GW +PT+IQ + IPL L+  D++ LAETGSGKTGAFA+PI+  L + P+  FAL+LTPT ELA QI  +F  LG   G++   IVGG     Q+ L  + K H+V+ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +KNP++  VS K+QT                     V KLQ               +F  +K  +K                        R  +L+ F +   ++L+ATDVASRGLDIP+V +V+NF +P  SKDY+HRVGRTARAGRSG AI+  T Y
Sbjct:   23 FKDLGVTDVLCEACDQLGWAKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQCAVIVGGIDSMSQS-LALAKKPHIVIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQT---------------------VEKLQ------------QYYLFIPSKFKSK------------------------RLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQY 318          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Mouse
Match: Ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:MGI Symbol;Acc:MGI:2136689])

HSP 1 Score: 255.758 bits (652), Expect = 1.868e-79
Identity = 156/393 (39.69%), Postives = 220/393 (55.98%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGG-EFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSD---DFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPL--RAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNV 1211
            F ++G+   L E+  ++G  +PT +Q   IP +L+  D +  A+TGSGKT AF +PI+QKL + P   F L+LTPT ELA QI  +F  LG+  GLK   IVGG + V    +L  S K HVV+ TPGR+  H+ +    N K ++FLV+DEADR+L     DF  DL  I+ ++P  RQT LFSAT+T+ L++L+ +    P    A+ + +           +  +  D  ++ LV   Q      D+ +  ++I+FT T K  +IL  +L + +     L S M + ER  AL  F S    +L+ATDVASRGLDIP V +VIN   P   K Y+HRVGRTARAGR G AI+L T Y    L  IE+ +   +  + V   E  +I   V
Sbjct:    4 FAEIGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALEL--SRKPHVVIATPGRLADHLRSSNTFNMKKIQFLVMDEADRLLEQGCTDFTTDLETILAAVPARRQTLLFSATLTDTLKELQGLATNEPFFWEAQATVRTVEQLDQRYLLVPEKVKDAYLVHLVQTFQ------DQLEDCSIIIFTNTCKTCQILCMMLRKFNFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLLHAIEEQIKQQLAELVVEEAEVLQILTQV 388          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Mouse
Match: Eif4a3 (eukaryotic translation initiation factor 4A3 [Source:MGI Symbol;Acc:MGI:1923731])

HSP 1 Score: 209.92 bits (533), Expect = 1.098e-62
Identity = 115/349 (32.95%), Postives = 199/349 (57.02%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            F+ +G+  +L   I   G+ +P+ IQ++ I  ++K  DV+A +++G+GKT  F++ ++Q L  + +   ALIL PT ELAVQI+   + LG+   ++    +GG  V +  + L   + HVV GTPGRV   I ++ L  + ++ LVLDEAD ML+  F   +  +   LP   Q  L SAT+ +++ ++ +  + +P+R  V R   T++ + Q  +    ++       WK  +L +  D    +  ++F  TK+    L   + E + +V+ +  DM + ER++ +  F SG   VL++TDV +RGLD+P V L+IN+ +P + + Y+HR+GR+ R GR G+AI+ 
Sbjct:   40 FDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSVSVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQ-HVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREE-------WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINF 380          
BLAST of ATP-dependent rRNA helicase RRP3 vs. UniProt/SwissProt
Match: sp|A2RB17|RRP3_ASPNC (ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rrp3 PE=3 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 2.351e-94
Identity = 170/387 (43.93%), Postives = 232/387 (59.95%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNV 1211
            F++LG+   L E  E +G+  PT IQR+ IPL LK  D++ LAETGSGKT AFA+PI+Q L +KP+  F L+L PT ELA QI   F  LG   G++   IVGG  +  Q+  L   K H++V TPGR+L H+ N K  + + L++LV+DEADR+L  DF   L  I++ LP+ R+T LFSATM++K+E L+   + NPLR  VS       +   Q  LF     + L+LV+    LLN   E    + I+FT T  +T+ L  LL  L      L   +++  R  AL  F +    +LVATDVA+RGLDIP+V +V+NF +P  S  Y+HRVGRTARAG+SGLAIS    Y     + IE  LG  +K  D P++E   + +NV
Sbjct:   50 FKELGIIEQLCEACETMGYKAPTPIQRESIPLALKGRDLIGLAETGSGKTAAFALPILQALMEKPQPFFGLVLAPTRELAYQISKSFESLGASMGVRSCVIVGGMDMVSQSISL-GKKPHIIVATPGRLLDHLENTKGFSLRNLKYLVMDEADRLLDMDFGPLLDKILKVLPRERRTFLFSATMSSKVESLQRASLSNPLRVSVSTSKYQTVSTLLQSYLFIPQKHKDLYLVY----LLN---EFAGQSTIIFTRTVNETQRLAFLLRALGFGAIPLHGQLSQSARLGALGKFRARSRNILVATDVAARGLDIPSVDVVLNFDLPGDSPSYVHRVGRTARAGKSGLAISFVAQYDVEVWLRIEGALGKKLKEYDCPKDEVMVLGENV 428          
BLAST of ATP-dependent rRNA helicase RRP3 vs. UniProt/SwissProt
Match: sp|P34580|DDX47_CAEEL (Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans OX=6239 GN=T26G10.1 PE=3 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 1.598e-92
Identity = 162/379 (42.74%), Postives = 234/379 (61.74%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNE 1187
            F +LGV   L +  +++GW +P++IQ+  +P  L+  DV+ LAETGSGKTGAFAIP++Q L D P+  F L+LTPT ELA QI  +F  LG   GL    IVGG  +  Q   L + + H++V TPGR++ H+ N K  N K L+FL++DEADR+L+ DF  +L  I++ +P+ R+T LFSATMT K+ KLE   +++P R  VS ++       +Q  +F  +  +  +LV+    LLN   E+  ++ IVF  T   T  +  +L +L +    L   M++ +R  +L+ F S    +LV TDVA+RGLDIP+V +VIN+ +P  SKDY+HRVGRTARAGRSG+AI++ T Y       IE +LG  +       NE
Sbjct:   46 FAELGVSQPLCDACQRLGWMKPSKIQQAALPHALQGKDVIGLAETGSGKTGAFAIPVLQSLLDHPQAFFCLVLTPTRELAFQIGQQFEALGSGIGLIAAVIVGGVDMAAQAMAL-ARRPHIIVATPGRLVDHLENTKGFNLKALKFLIMDEADRILNMDFEVELDKILKVIPRERRTYLFSATMTKKVSKLERASLRDPARVSVSSRY-KTVDNLKQHYIFVPNKYKETYLVY----LLN---EHAGNSAIVFCATCATTMQIAVMLRQLGMQAVPLHGQMSQEKRLGSLNKFKSKAREILVCTDVAARGLDIPHVDMVINYDMPSQSKDYVHRVGRTARAGRSGIAITVVTQYDVEAYQKIEANLGKKLDEYKCVENE 415          
BLAST of ATP-dependent rRNA helicase RRP3 vs. UniProt/SwissProt
Match: sp|Q2H1Q8|RRP3_CHAGB (ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=RRP3 PE=3 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 3.517e-92
Identity = 163/371 (43.94%), Postives = 229/371 (61.73%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGG-EFVEDQTKLLKSNKCHVVVGTPGRVLLHINK-KLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITM 1160
            F+ LG+  +L +  +++GW +PT IQ++ IPL L++ D++ LAETGSGKTGAFA+PI+Q L DKP+  FAL+L PT ELA QI   F  LG    L+   I+GG + V+    L K  K HVVV TPGR+L H+ K K  + + LR+LV+DEADR+L  DF   L  I++ LP+ R+T LFSATM++K+E L+  C+++PL+  +S       +   Q  +F     +  +L++    L N   E     +I+FT T  +T+ +  LL  L +    L   +++  R  AL+ F +G   +LVATDVA+RGLDIPNV  V+N  +P  SK Y+HRVGRTARAGRSG AIS  T Y     + IE  LG  +
Sbjct:   67 FQDLGIVDSLCDACKELGWKKPTPIQQESIPLALQDRDIIGLAETGSGKTGAFALPILQALLDKPQPLFALVLAPTRELAAQIAQSFEALGSLISLRCALILGGLDMVQQAIALGK--KPHVVVATPGRLLDHLEKTKGFSLRNLRYLVMDEADRLLDMDFGPILDKILKFLPRERRTFLFSATMSSKVESLQRACLRDPLKVSISSSKYQTVSTLVQNYVFIPHTHKDTYLIY----LCN---EFAGQTIIIFTRTVIETQRIAILLRTLGMGAIPLHGGLSQSARLGALNKFRAGSRDILVATDVAARGLDIPNVDCVLNLDLPGDSKTYVHRVGRTARAGRSGHAISFVTQYDLELWLRIEAALGTKL 428          
BLAST of ATP-dependent rRNA helicase RRP3 vs. UniProt/SwissProt
Match: sp|Q6CH58|RRP3_YARLI (ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=RRP3 PE=3 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 7.522e-92
Identity = 161/374 (43.05%), Postives = 232/374 (62.03%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXX--XFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKS 1166
            F+ LGV  ++ E  E++ + +PT IQ + IP  L+  D++ LA+TGSGKT AFAIP++Q L++ P+  + ++L PT ELA QI   F  LG   GL+   +VGG  +  Q   L S K HV+V TPGR++ H+ N K  + +TL+FLV+DEADR+L  +F   L  I++ +P+ R T LFSATMT+K+EKL+   + +P+R  VS K+QT   L Q  +   F+  D  +++LV           EN  +++I+F  TK DT+ +  LL  L      L  D+++  R  AL+ F SG   +L+ATDVASRGLDIP V LVIN+ +P  SK Y+HRVGRTARAGR+G +++L + Y     + IE  LG  + S
Sbjct:   66 FKDLGVIDSICETCEELKFTKPTPIQAQSIPYALEGRDIIGLAQTGSGKTAAFAIPVLQSLYENPQPLYCVVLAPTRELAYQISETFEALGSAMGLRTAVVVGGMNMMTQAVAL-SKKPHVIVATPGRLVDHLENTKGFSLRTLKFLVMDEADRLLDMEFGPSLDKILKVIPRQRNTYLFSATMTSKVEKLQRASLVDPVRVAVSTKYQTADNLLQYMVFCPFKHKDTHLVYLV----------SENAGNSMIIFARTKSDTQRISLLLRNLGYGAIPLHGDLSQTARLGALNKFKSGSRNILIATDVASRGLDIPAVDLVINYDIPSDSKSYIHRVGRTARAGRAGKSVALVSQYDLELYLRIEGALGKKLDS 428          
BLAST of ATP-dependent rRNA helicase RRP3 vs. UniProt/SwissProt
Match: sp|Q29S22|DDX47_BOVIN (Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus OX=9913 GN=DDX47 PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 2.664e-91
Identity = 157/356 (44.10%), Postives = 230/356 (64.61%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQS--LLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F+ LGV   L E  +++GW +PT+IQ + IPL L+  D++ LAETGSGKTGAFA+PI+  L + P+  FAL+LTPT ELA QI  +F  LG   G++   IVGG     Q+ L  + K H+V+ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +KNP++  VS K+QTV+ L           +  LF+  K +   L+   +E   ++ ++F  T  +T+    LL  L  +   L   M++ +R  +L+ F +   ++L+ATDVASRGLDIP+V +V+NF +P  SKDY+HRVGRTARAGRSG AI+  T Y
Sbjct:   28 FKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQCAVIVGGIDSMSQS-LALAKKPHIVIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKL----------QQYYLFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQY 372          
BLAST of ATP-dependent rRNA helicase RRP3 vs. TrEMBL
Match: A0A4S2MFQ5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000246 PE=4 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 2.374e-110
Identity = 184/389 (47.30%), Postives = 263/389 (67.61%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAM-------LQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVP------ESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVP 1178
            F KLG+   + + I+K+GW++P+EIQ K IP  L+  DVV LAETGSGKT AFAIPI+Q L  KPKHNFAL+LTPT ELA+Q+K++FM LGE  GL+V+ +VGG+ VEDQT+ LK +K H+++GTPGR+  H+ N K L    +R+LVLDEAD+ML D F ++L+AII +LP   +T L+SAT++ K++KL+ +C ++P+  EVS ++ +         +F  + ER ++LV+ L+++   S    +S  IVFT T +++   +R+   L+    +       L   M + +RQN+L SF +G+ A LVATD+ASRGLDIP+V L+IN+ VP      +S+K Y+HRVGRTARAGRSG AI+L T Y+   L  IE  LG  +  +  P
Sbjct:    6 FAKLGICQEILDVIKKLGWSKPSEIQAKTIPQALRGKDVVGLAETGSGKTAAFAIPILQDLISKPKHNFALVLTPTRELALQLKSQFMDLGEVYGLRVICLVGGQHVEDQTRDLKVSKYHIIIGTPGRICYHLENSKDLRLNHIRYLVLDEADQMLEDTFEDELSAIIANLPPNHRTYLYSATLSPKVQKLQEICTRSPIIVEVSLEY-SKVKKLDHAFVFIPEQERDVYLVYALKTI---SKAAANSRTIVFTTTWRES---FRIASLLNNLSQLLGGKAVPLNGAMQQDKRQNSLFSFRAGQAAFLVATDLASRGLDIPDVDLIINYDVPRRPSWSDSAKAYIHRVGRTARAGRSGRAITLVTPYSATRLKAIEAALGECIPQLPWP 387          
BLAST of ATP-dependent rRNA helicase RRP3 vs. TrEMBL
Match: A0A1S8WXX1 (DEAD/DEAH box helicase (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_04873 PE=4 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 4.605e-110
Identity = 184/388 (47.42%), Postives = 259/388 (66.75%), Query Frame = 3
Query:   48 NKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDI----SVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVP------ESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVP 1178
            N F+  G+   + + I+K+GW++P+EIQ K IP  L+  DVV LAETGSGKT AFAIPI+Q L  KPKHNFAL+LTPT ELA+Q+K++FM LGE  GL+V+ +VGG+ VEDQT+ LK +K H+++GTPGR+  H+ N K L    +R+LVLDEAD+ML D F + L+AII SLP   +T L+SAT++ K++KL+ +C ++P+  EVS ++ +         +F  + ER ++LV+ L+++   S    +S  IVFT T +++  +   L  L          L   M + +RQN+L SF +G+ A LVATD+ASRGLDIP+V L+IN+ VP      +S+K Y+HRVGRTARAGRSG AI+L T Y+   L  IE  LG  +  +  P
Sbjct:   17 NHFQ--GICQEILDVIKKLGWSKPSEIQAKTIPQALRGKDVVGLAETGSGKTAAFAIPILQDLISKPKHNFALVLTPTRELALQLKSQFMDLGEVYGLRVICLVGGQHVEDQTRDLKISKYHIIIGTPGRICYHLENSKDLRLNHVRYLVLDEADQMLEDTFESQLSAIIASLPPNHRTYLYSATLSPKVQKLQEICTRSPIIVEVSLEY-SKVKKLDHAFVFIPEQERDVYLVYALKTI---SKAAANSRTIVFTTTWRESFRIASFLNSLSQLLGGKAVPLNGAMQQDKRQNSLFSFRAGQAAFLVATDLASRGLDIPDVDLIINYDVPRRPSWSDSAKAYIHRVGRTARAGRSGRAITLVTPYSATRLKAIEAALGECIPQLPWP 398          
BLAST of ATP-dependent rRNA helicase RRP3 vs. TrEMBL
Match: A0A4S2MKH8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000246 PE=4 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 6.358e-110
Identity = 184/389 (47.30%), Postives = 263/389 (67.61%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAM-------LQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVP------ESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVP 1178
            F KLG+   + + I+K+GW++P+EIQ K IP  L+  DVV LAETGSGKT AFAIPI+Q L  KPKHNFAL+LTPT ELA+Q+K++FM LGE  GL+V+ +VGG+ VEDQT+ LK +K H+++GTPGR+  H+ N K L    +R+LVLDEAD+ML D F ++L+AII +LP   +T L+SAT++ K++KL+ +C ++P+  EVS ++ +         +F  + ER ++LV+ L+++   S    +S  IVFT T +++   +R+   L+    +       L   M + +RQN+L SF +G+ A LVATD+ASRGLDIP+V L+IN+ VP      +S+K Y+HRVGRTARAGRSG AI+L T Y+   L  IE  LG  +  +  P
Sbjct:    6 FAKLGICQEILDVIKKLGWSKPSEIQAKTIPQALRGKDVVGLAETGSGKTAAFAIPILQDLISKPKHNFALVLTPTRELALQLKSQFMDLGEVYGLRVICLVGGQHVEDQTRDLKVSKYHIIIGTPGRICYHLENSKDLRLNHIRYLVLDEADQMLEDTFEDELSAIIANLPPNHRTYLYSATLSPKVQKLQEICTRSPIIVEVSLEY-SKVKKLDHAFVFIPEQERDVYLVYALKTI---SKAAANSRTIVFTTTWRES---FRIASLLNNLSQLLGGKAVPLNGAMQQDKRQNSLFSFRAGQAAFLVATDLASRGLDIPDVDLIINYDVPRRPSWSDSAKAYIHRVGRTARAGRSGRAITLVTPYSATRLKAIEAALGECIPQLPWP 387          
BLAST of ATP-dependent rRNA helicase RRP3 vs. TrEMBL
Match: A0A4E0R1D2 (ATP-dependent rRNA helicase OS=Fasciola hepatica OX=6192 GN=D915_008057 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 6.155e-108
Identity = 182/389 (46.79%), Postives = 254/389 (65.30%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLG-------ELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVP------ESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVP 1178
            F +LGV   + + IEK+GW +P+EIQ K IP  L+  D+V LAETGSGKT AFAIPI+Q L  KP+HNFAL+LTPT ELA+Q+K++F+ LGE  GL+V+ +VGG+ VEDQ + LK NK H+++GTPGR++ H+ N K L    +R+LVLDEAD+ML D F + L  I+  +P+  +T L+SATM+ K+ K++SVC K+P+  +VS K+            F  D ER ++LV+ L    + + +N  S  IVFT T +++   +R+          +  +V+ L   M + +RQNAL  F  GK  +LVATD+ASRGLDIP+V LVIN+ VP      +S+K Y+HRVGRTARAGR G A++L T Y+   L  IE  LG  +  +  P
Sbjct:    3 FAQLGVCKEILDVIEKLGWEKPSEIQTKAIPPSLRGRDIVGLAETGSGKTAAFAIPILQDLISKPRHNFALVLTPTRELALQLKSQFLDLGEAYGLRVICLVGGQHVEDQLRDLKINKFHIIIGTPGRIVYHLENSKDLRLNRIRYLVLDEADQMLEDTFDSHLEIIVSRIPESHKTYLYSATMSQKVSKIQSVCSKSPVTIQVSNKY-AKVERLDHAFTFLPDQERDIYLVYLLSCAASKTTDNSRS--IVFTTTWRES---FRIASLLGLLGPLVGGTVSPLNGAMQQDKRQNALFGFRLGKTNILVATDLASRGLDIPDVDLVINYDVPKRPSWSDSAKAYIHRVGRTARAGRPGRAVTLVTPYSASRLKAIEAALGERVPQLPWP 385          
BLAST of ATP-dependent rRNA helicase RRP3 vs. TrEMBL
Match: A0A504YV23 (DEAD box ATP-dependent RNA helicase OS=Fasciola gigantica OX=46835 GN=FGIG_08448 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 6.497e-108
Identity = 181/389 (46.53%), Postives = 253/389 (65.04%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLG-------ELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVP------ESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVP 1178
            F +LGV   + + IEK+GW +P+EIQ K IP  L+  D+V LAETGSGKT AFAIPI+Q L  KP+HNFAL+LTPT ELA+Q+K++F+ LGE  GL+V+ +VGG+ VEDQ + LK NK H+++GTPGR++ H+ N K L    +R+LVLDEAD+ML D F + L  I+  +P+  +T L+SATM+ K+ K++SVC K+P+  +VS K+            F  D ER ++LV+ L    + + +N  S  IVFT T +++   +R+          +  + + L   M + +RQNAL  F  GK  +LVATD+ASRGLDIP+V LVIN+ VP      +S+K Y+HRVGRTARAGR G A++L T Y+   L  IE  LG  +  +  P
Sbjct:    3 FAQLGVCKEILDVIEKLGWEKPSEIQTKAIPPSLRGRDIVGLAETGSGKTAAFAIPILQDLISKPRHNFALVLTPTRELALQLKSQFLDLGEAYGLRVICLVGGQHVEDQLRDLKINKFHIIIGTPGRIVYHLENSKDLRLNRIRYLVLDEADQMLEDTFDSHLEIIVSRIPESHKTYLYSATMSQKVNKIQSVCAKSPVTIQVSNKY-AKVERLDHAFTFLPDQERDIYLVYLLSCAASKTTDNSRS--IVFTSTWRES---FRIASLLGLLGPLVGGTASPLNGAMQQDKRQNALFEFRLGKTNILVATDLASRGLDIPDVDLVINYDVPKRPSWSDSAKAYIHRVGRTARAGRPGRAVTLVTPYSASRLKAIEAALGERVPQLPWP 385          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Cavefish
Match: ddx47 (DEAD-box helicase 47 [Source:NCBI gene;Acc:103034543])

HSP 1 Score: 287.345 bits (734), Expect = 6.464e-92
Identity = 157/356 (44.10%), Postives = 229/356 (64.33%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQS--LLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F++LGV   L E  E++GW +PT+IQ + IP+ L+  DV+ LAETGSGKTGAFA+PI+Q L   P+    L+LTPT ELA QI  +F  LG   G+K   +VGG  +  Q  +L + K H+V+ TPGR++ H+ N K  N + LRFLV+DEADR+L+ DF +++  I++ +P+ R T LFSATMT K++KL+   +K+P++  VS K+ TV  L           +  +F+  K +   L++  +E   ++ ++F  T  + + +  LL  L I+   L   M++ +R  +L+ F +   +VL+ATDVASRGLDIP+V  VINF +P  SKDY+HRVGRTARAGRSG +I+  T Y
Sbjct:   30 FKELGVTEVLCEACEQLGWKQPTKIQIEAIPVALEGRDVIGLAETGSGKTGAFALPILQTLLSHPQRLHTLVLTPTRELAFQIAEQFEALGSSIGVKTAVVVGGIDMMSQAMVL-AKKPHIVIATPGRLIDHLENTKGFNLRALRFLVMDEADRILNMDFESEVDKILKVIPRERHTFLFSATMTKKVQKLQRAALKDPVKCAVSTKYATVDKL----------QQYYIFIPAKYKDCYLVSILNELAGNSFMIFCGTCNNAQRVALLLRNLGITAIPLHGQMSQNKRLGSLNKFKAKSRSVLLATDVASRGLDIPHVDCVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVTQY 374          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Cavefish
Match: ddx49 (DEAD-box helicase 49 [Source:NCBI gene;Acc:103043246])

HSP 1 Score: 250.751 bits (639), Expect = 8.484e-78
Identity = 153/395 (38.73%), Postives = 223/395 (56.46%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGG-EFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSD---DFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPL----RAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNV 1211
            F  LG+   L ++ +++G   PT +Q+  +P +L   D +  A+TGSGKT AF +P++QKL + P   F L+LTPT ELA QI  +F  LG+  GL+   IVGG + V    +L  S K H+VV TPGR+  HI +    N K ++FL+LDEADR+L     DF  DL  I+  +P  RQT LFSAT+T+ L++L+++ +  P     ++EV  +              +  D  ++ L+ K+Q      DE+   +V++FT T K+ +IL  +L E       L S M + +R   L  F S    +L+ATDVA+RGLDIP V +VIN   P   K Y+HRVGRTARAGR+G++I+L T Y    +  IE+ +   +K   V   E  +I   V
Sbjct:    4 FAALGLSDWLIQQCKQMGITRPTPVQQSCVPAILAGRDCMGCAKTGSGKTAAFVLPVLQKLAEDPYGIFCLVLTPTRELAYQIAEQFRALGKPLGLRDCIIVGGMDMVAQGLEL--SKKPHIVVATPGRLADHIRSSDTFNMKRIKFLILDEADRLLEQGCTDFTKDLEVILSVVPAKRQTLLFSATLTDTLQELKTIAMNEPFFWENKSEV--RTVDELDQRYILTPEKVKDAYLVHLIQKIQ------DEHDDWSVMIFTNTCKNCQILTMMLREFKFPAISLHSMMKQRQRFANLAKFKSNVFKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLVNAIEEQIQTKLKEYPVEEKEVLKILTQV 388          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Cavefish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:103037591])

HSP 1 Score: 206.453 bits (524), Expect = 1.482e-61
Identity = 114/349 (32.66%), Postives = 197/349 (56.45%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            F+ +G+  +L   I   G+ +P+ IQ++ I  ++K  DV+A +++G+GKT  F + ++Q L  + +   ALIL PT ELA QI+   + LG+   ++    +GG  V +  + L   + HVV GTPGRV   I ++ L  + ++ LVLDEAD ML+  F   +  +   LP   Q  L SAT+ +++ ++ +  + +P+R  V R   T++ + Q  +    ++       WK  +L +  D    +  ++F  TK+    L   + E + +V+ +  DM + ER++ +  F SG   VL++TDV +RGLD+P V L+IN+ +P + + Y+HR+GR+ R GR G+AI+ 
Sbjct:   35 FDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQ-HVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREE-------WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINF 375          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Cavefish
Match: ddx54 (DEAD-box helicase 54 [Source:NCBI gene;Acc:103046998])

HSP 1 Score: 211.075 bits (536), Expect = 5.187e-60
Identity = 138/360 (38.33%), Postives = 199/360 (55.28%), Query Frame = 3
Query:   33 KMFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNF---ALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKL-LNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            K  GG  F+ +G+   + + + K G+  PT IQRK IP++L   DVVA+A TGSGKT AF +P+ ++L   P+      ALILTPT ELA+Q      +LG+  GLK   I+GG+ ++DQ   L  N   +++GTPGR L+HI  ++ L    + ++V DEADR+    F + L  II  LP+ RQT LFSAT+   L       +  P+   +    +    L       R DD+  L L   L++++   ++      +VF  TK   + L +LL    I  A + S + +  R+  +  F   K  VL+ TDVA+RG+DIP +  VIN+  P  +K +LHRVGR ARAGRSG A SL
Sbjct:   75 KKSGG--FQSMGLSYPVYKGVMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTAAFLVPMFERL-KAPQAQTGARALILTPTRELALQTMKFTKELGKFTGLKTALILGGDSMDDQFAALHEN-PDIIIGTPGR-LMHIVMEMNLKLNNVEYVVFDEADRLFEMGFADQLQEIIRRLPETRQTLLFSATLPKLLVDFARAGLTEPVLMRLDVDTKLSDQLKLAFFHLRLDDKPALLLHL-LRNVVKPQEQ-----TVVFVSTKHHVEYLNQLLTAEGIECAYIYSALDQTARKINIGRFVHRKAMVLLVTDVAARGIDIPMLDNVINYNFPSKAKLFLHRVGRVARAGRSGTAFSL 423          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Cavefish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:103037591])

HSP 1 Score: 201.83 bits (512), Expect = 5.447e-60
Identity = 112/341 (32.84%), Postives = 192/341 (56.30%), Query Frame = 3
Query:   78 NLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            +L   I   G+ +P+ IQ++ I  ++K  DV+A +++G+GKT  F + ++Q L  + +   ALIL PT ELA QI+   + LG+   ++    +GG  V +  + L   + HVV GTPGRV   I ++ L  + ++ LVLDEAD ML+  F   +  +   LP   Q  L SAT+ +++ ++ +  + +P+R  V R   T++ + Q  +    ++       WK  +L +  D    +  ++F  TK+    L   + E + +V+ +  DM + ER++ +  F SG   VL++TDV +RGLD+P V L+IN+ +P + + Y+HR+GR+ R GR G+AI+ 
Sbjct:   29 DLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQ-HVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREE-------WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINF 361          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 286.96 bits (733), Expect = 3.699e-93
Identity = 163/379 (43.01%), Postives = 238/379 (62.80%), Query Frame = 3
Query:   66 GVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQS--LLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFE 1193
            GV   L E  E++GW +PT+IQ + IP+ L+  D++ LAETGSGKTGAFA+PI+Q L D P+  FAL+LTPT ELA QI  +F  LG   G+K   +VGG  +  Q+ L  + K HV++ TPGR++ H+ N K  N + L++LV+DEADR+L+ DF  ++  I++ +PK R+T LFSATMT K++KL+   +K P++  VS K+QTV+ L           +  +F+  K +   L+   +E   ++ I+F  T  +T+ +  LL  L  +   L   M++ +R  +L+ F     ++L+ATDVASRGLDIP+V +VINF +P  SKDY+HRVGRTARAGRSG +I+  + Y       IE  +G  + +   P NE E
Sbjct:    1 GVTEVLCEACEQLGWKQPTKIQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQALLDAPQRLFALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQS-LALAKKPHVIIATPGRLVDHLENTKGFNIRALKYLVMDEADRILNMDFETEVDKILKVIPKERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKYQTVEKL----------QQYYVFIPAKFKDSYLVYILNELAGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQYDVELFQRIEHLIGKKLPAF--PTNEEE 366          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Sea Lamprey
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 251.136 bits (640), Expect = 9.489e-79
Identity = 151/381 (39.63%), Postives = 226/381 (59.32%), Query Frame = 3
Query:   45 GNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRML---SDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVAS----RGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMK 1163
             N F++LG+D  L ++ +++G ++PT +Q   IP +L+  D +  A+TGSGKT AF +PI+QKL + P   F L+L PT ELA QI  +F  +G+  GLK   IVGG     Q + L + K HVV+ TPGR+  H+ +    + K ++FLV+DEADR+L   + DF  DL  I+ +LP  RQT LFSAT+T+ L++L ++ + NP   E S++         Q+ +   D  +  +LV  +Q + +  D+    ++IVFT T K+ ++L  +L   +     L S M + ER  +L  F S    +L+ATDVAS    RGLDIP V +V+N   P   K Y+HRVGRTARAGR+G+AI++ T Y    +  IE+ +   +K
Sbjct:    4 ANLFKRLGLDDWLMQQCKQMGISKPTPVQENCIPPILRGQDCMGCAQTGSGKTAAFVLPILQKLSEDPFGIFCLVLAPTRELAYQIAEQFRVMGKPLGLKDSVIVGGMDSVRQAQEL-ARKPHVVIATPGRLADHLRSSNTFSLKKIQFLVMDEADRLLEQGATDFTKDLQVIL-ALPAKRQTLLFSATLTDTLQELRNLALTNPFFWE-SKEPVRTVEELDQRYILVADKVKDAYLVHIIQKIQDAHDD---WSIIVFTNTCKNCQVLNMMLRHFNFPSVALHSMMRQTERFASLSKFKSSMFKILIATDVASSFWARGLDIPTVQVVLNHNTPSLPKTYIHRVGRTARAGRNGVAITIVTQYDIHLVQAIEETINTKLK 378          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Sea Lamprey
Match: DDX54 (DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:20084])

HSP 1 Score: 214.157 bits (544), Expect = 2.969e-65
Identity = 133/364 (36.54%), Postives = 203/364 (55.77%), Query Frame = 3
Query:   27 NLKMFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHN--FALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNP--LRAEVSRKHXXXXXXXXXXXXFRCD--DERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            N K      F+ +G+   + + +   G+  PT IQRK IP++L+  DVVA+A TGSGKT AF +P+ ++L  +       AL+L+PT ELA+Q      +LG+  GLK   I+GG+ +EDQ   L  N   +++GTPGR++  + +  L  + + ++V DEADR+    F   LT II  LP  RQT LFSAT+  +L +     + +P  +R +V  K        Q KL F C   D++   L+  L++++   ++      +VF  TK   + L  L+ +  +S A + S + + ER+  +  F   K  +L+ TDVA+RG+D P +  VIN+  P   K ++HRVGR ARAGRSG A SL
Sbjct:   26 NCKKKKSGGFQSMGLSYPVFKGVMGKGYKVPTPIQRKCIPVILEGRDVVAMARTGSGKTAAFLVPMFERLHARSAQAGARALVLSPTRELALQTSKFTKELGKHTGLKTALILGGDRMEDQFAALHENP-DIIIGTPGRLMHVVVEMNLKLQAMEYVVFDEADRLFEMGFAEQLTEIIRRLPDSRQTLLFSATLPKQLVEFARAGLSDPVLIRLDVDSK-----LSDQLKLAFMCSRADDKPCVLLHLLRTVVKPHEQT-----VVFVATKHHVEYLRELVSQAGMSCAYIYSALDQTERKINVGKFVHKKTMLLIVTDVAARGID-PMLDNVINYNFPGKPKLFIHRVGRVARAGRSGTAYSL 377          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Sea Lamprey
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 201.06 bits (510), Expect = 2.132e-59
Identity = 127/376 (33.78%), Postives = 206/376 (54.79%), Query Frame = 3
Query:   45 GNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEE-DGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSI 1169
            GN+FE   +   L   I + GW +P+ IQ + IP+ L   D++A A+ G+GK+GA+ IP++++L  K  +  AL + PT ELA+Q     ++L +   G+KV+   GG  + D    L     HV++ TPGR+L  INK L     ++ +VLDEAD++LS DFV  L  II ++P+ RQ  L+SAT    ++K  +  ++ P   E++   +       Q   +  + ++V      L +L +    NQS   I+F  + +  ++L + + +L  S   + + M +  R      F  G+   LV +D+ +RG+DI  V +VINF  P++++ YLHR+GR+ R G  GLAI+L T     +L  IE+ LG  +K I
Sbjct:   98 GNEFEDYCLKRELLMGIFEKGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDMKKPYIQALTIVPTRELALQTSQICIELSKHMGGVKVMATTGGTNLRDDILRLDET-VHVIIATPGRILDLINKGLAKVDAVQMIVLDEADKLLSQDFVQMLDDIIRAMPRNRQILLYSATFPLSVQKFMNRHLQKPY--EINLMEELTLKGITQFYAYVNERQKV----HCLNTLFSKLQINQS---IIFCNSTQRVELLAKKITQLGYSCFYIHAKMKQEHRNRVFHDFRRGECRNLVCSDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRYGHLGLAINLITYEDRFNLKGIEEQLGTEIKPI 463          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 204.527 bits (519), Expect = 8.020e-59
Identity = 126/390 (32.31%), Postives = 201/390 (51.54%), Query Frame = 3
Query:   78 NLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPI---------IQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLP--------------------------KMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFL--VWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLAT---IYTFVDL 1127
            ++ E IEK G+ +PT IQR+ IP+ L+  D++ +AETGSGKT AF IP+         I ++ D  +  +A+IL PT ELA QI+ E +K G+  G++ V ++GG   EDQ   L+   C +V+ TPGR++  +  + L      ++VLDEADRM+   F  D+  I+E +P                          K RQT +F+ATM   +E+L    ++ P    +                    ++RV  +    K + LL          +I+F   KK   +L + L ++  +   L     + +R+ AL +  +G   +LVATDVA RG+DI +V +V+N+ + ++ +DY HR+GRT RAG+SG++++  T      F DL
Sbjct:  330 HIREVIEKCGYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITTLPKIDRIEDTDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMG-CKIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYRQTVMFTATMPAAVERLARSYLRRPAVVYIG----------SVGKPIERVEQRVFIMGESEKRKKLLELLSRGFEPPIIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYTHRIGRTGRAGKSGVSVTFLTKEDAAVFYDL 708          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Yeast
Match: RRP3 (Protein involved in rRNA processing; required for maturation of the 35S primary transcript of pre-rRNA and for cleavage leading to mature 18S rRNA; homologous to eIF-4a, which is a DEAD box RNA-dependent ATPase with helicase activity [Source:SGD;Acc:S000001107])

HSP 1 Score: 266.544 bits (680), Expect = 1.826e-84
Identity = 159/388 (40.98%), Postives = 242/388 (62.37%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLP-KMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNV 1211
            F +L +   L +  + + +++PT IQ K IP  L+ +D++ LA+TGSGKT AFAIPI+ +L+   +  +A IL PT ELA QIK  F  LG   G++   IVGG  + DQ + L   K H+++ TPGR++ H+ N K  + + L+FLV+DEADR+L  +F   L  I++ +P + R T LFSATMT+K++KL+   + NP++  VS K+QTV TL Q  ++     +   +L++ L   +  +       +I+FT TK + + L  L   L+ S   L  D+ + +R  +LD F +GK ++LVATDVA+RGLDIP+V +V+N+ +P  SK Y+HRVGRTARAGRSG +ISL + Y    ++ IE+ LG  +    V +N    ++D+V
Sbjct:   83 FSELNLVPELIQACKNLNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILNRLWHDQEPYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDL-MRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNT-YLIYLLNEFIGKT-------MIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKLPKESVDKNIILTLRDSV 461          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Yeast
Match: DBP8 (ATPase, putative RNA helicase of the DEAD-box family; component of 90S preribosome complex involved in production of 18S rRNA and assembly of 40S small ribosomal subunit; ATPase activity stimulated by association with Esf2p [Source:SGD;Acc:S000001212])

HSP 1 Score: 224.942 bits (572), Expect = 3.345e-69
Identity = 141/360 (39.17%), Postives = 203/360 (56.39%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI----NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPK--MRQTCLFSATMTNKLEKLESVCV---KNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLAT 1106
            F+ LG+   L+E +  +   +PT IQ+  IP +L+  D +  A+TGSGKT AFA P++ K  + P   F ++LTPT ELA+QI  +F  LG    ++V  IVGGE +  Q   L+  K H ++ TPGR+  HI    +  +      ++LVLDEAD +L+  F + L   I +LP    RQT LF+AT+T++++ L++  V   K PL A        V   +  K+ +    E V      L  LL T +E ++   I+F       +IL R L +L++ VA L S M + ER N+L  F +    +L+ATDVASRGLDIP V LV+N+ +P     ++HR GRTARAGR G AIS  T
Sbjct:    4 FKSLGLSKWLTESLRAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDPSGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVIVGGESIVQQALDLQ-RKPHFIIATPGRLAHHIMSSGDDTVGGLMRAKYLVLDEADILLTSTFADHLATCISALPPKDKRQTLLFTATITDQVKSLQNAPVQKGKPPLFAYQVESVDNVAIPSTLKIEYILVPEHVKEAY--LYQLL-TCEEYENKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARILIATDVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAISFVT 359          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Yeast
Match: FAL1 (Nucleolar protein required for maturation of 18S rRNA; member of the eIF4A subfamily of DEAD-box ATP-dependent RNA helicases; 18S rRNA biogenesis defect of the null mutant is functionally complemented by human EIF4A3 [Source:SGD;Acc:S000002428])

HSP 1 Score: 205.682 bits (522), Expect = 2.639e-62
Identity = 123/365 (33.70%), Postives = 196/365 (53.70%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSD--DFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEK 1142
            FE + +  +L   I   G+  P+ IQ + I  ++   DV+A A++G+GKT  F I ++Q +  + K   ALIL+PT ELA QI      LG+   +    I GG+ ++D  K ++ + C  V GTPGRVL  I K++L  + ++ LVLDEAD +LS+   F   +  I   LPK  Q  + SATM   + ++    + +P++  V R    +     ++ +   D E      WK  +L +  D    +  ++F  TKK    L + L + + +V  +  DM + ER   ++ F +G   VL++TDV +RG+D+  V LVIN+ +PE  ++Y+HR+GR+ R GR G+AI+  T      L  IEK
Sbjct:   25 FESMNLKDDLLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKKDLQALILSPTRELASQIGQVVKNLGDYMNVNAFAITGGKTLKDDLKKMQKHGCQAVSGTPGRVLDMIKKQMLQTRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNCQVVVVSATMNKDILEVTRKFMNDPVKILVKRDE--ISLEGIKQYVVNVDKEE-----WKFDTLCDIYDSLTITQCVIFCNTKKKVDWLSQRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYIHRIGRSGRFGRKGVAINFITKADLAKLREIEK 382          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Yeast
Match: DRS1 (Nucleolar DEAD-box protein required for ribosome assembly and function; including synthesis of 60S ribosomal subunits; constituent of 66S pre-ribosomal particles [Source:SGD;Acc:S000003931])

HSP 1 Score: 212.616 bits (540), Expect = 6.204e-62
Identity = 129/338 (38.17%), Postives = 202/338 (59.76%), Query Frame = 3
Query:  102 IGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKH---NFALILTPTHELAVQIKNEFMKLGE-EDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            +G+ +P+ IQ   IP+ L   D++A A TGSGKT AF IPII++L  KP        ++L PT ELA+Q+ +   ++     G+     VGG  +  Q ++LKS +  +V+ TPGR + HI N    N  ++  LV+DEADRML + F ++L  I+  LP  RQ  LFSATM +K++ L S+ +K P+R  +    +    LTQ+ +  R  D     L++ L   L+ + + +   ++VF   K+    L  ++G L +SV  L   +T+ +R ++++ F + +V VL+ TD+ASRGLDIP + +VIN+ +P+S + YLHRVGRTARAGR G +++ 
Sbjct:  249 LGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLKS-RPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNLIRKLDPTGQKR---IVVFVARKETAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTF 582          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 205.682 bits (522), Expect = 5.787e-61
Identity = 132/358 (36.87%), Postives = 203/358 (56.70%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLF-DKPKHNF-ALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAII-ESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXX----FRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLAT 1106
            F+ L +D ++  +I K  + +PT IQ    P +L   DVV +AETGSGKT AF +P I  L  D+ K     L+++PT ELA QI +  + L ++ G++   + GG   ++Q   LK  K  VVV TPGR+L  + +  ++   + +LVLDEADRML   F  D+  II E+    RQT +F+AT   ++ +L S  + NP++  +    Q        +++     R  + ++L L+ K  S        ++  V++F   KK+   + R L     +VA +  D+++ +R  AL+ F SGK  +L+ATDVA+RGLDIPNV  VIN   P + +DY+HR+GRT RAG++G A +L T
Sbjct:  116 FDYLSLDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLK--KSQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHS-----GPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 464          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Nematostella
Match: EDO33593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU4])

HSP 1 Score: 289.271 bits (739), Expect = 1.704e-93
Identity = 158/356 (44.38%), Postives = 232/356 (65.17%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQS--LLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F+ LGV   L E  +++GW  P++IQR+ IP+ L+  DV+ LAETGSGKTGAFA+PI+Q L D P+  FALILTPT ELA QI  +   LG   G+K   IVGG  +  Q  L+ + K H+++ TPGR++ H+ N K  + +TL++LV+DEADR+L+ DF  ++  +++ +PK R+T LFSATMT K++KL+   ++ P++ EV+ K+QTV+ L           +  LF+  K +   L+   +E   ++ +VF  T  + + +  +L  L +    L   M++ +R  AL+ F S   ++LVATDVASRGLDIP+V +VINF +P  SKDY+HRVGRTARAGRSG +++  T Y
Sbjct:   16 FKSLGVVDALCEACKQLGWKTPSKIQREAIPVALQGKDVIGLAETGSGKTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEALGSGIGVKCAVIVGGIDMMSQA-LMLAKKPHIIIATPGRLIDHLENTKGFSLRTLKYLVMDEADRILNMDFEKEVDKLLKVIPKERRTFLFSATMTKKVQKLQRASLQAPVKVEVATKYQTVEKL----------QQSYLFIPSKFKDCYLVYVLNELAGNSFMVFCGTCNNVQRVTLMLRNLGLDAVPLHGQMSQSKRLGALNKFKSKSRSILVATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGRSVTFVTQY 360          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Nematostella
Match: EDO43011 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV2])

HSP 1 Score: 280.411 bits (716), Expect = 3.794e-90
Identity = 164/359 (45.68%), Postives = 221/359 (61.56%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQ-----SLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F  LG++  L  +   +G  +PTEIQ   +P +L+  D +  A+TGSGKT AFA+PI+QKL D P   FA++LTPT ELA QI ++F  LG   GLK   IVGG  +  Q   L +NK HVV+ TPGR+  HI +   LN K ++FLVLDEADR+L   F +DL  I +++P+ RQT LFSAT+T+ + +L+ +    P   EV     TV  L          D+R L     ++      LL  +D+NQS  VIVFT T K+ ++L  +  +L ++   L S +++ ER  AL  F SG + +LVATDVASRGLDIP V LV+N  +P   KDY+HRVGRTARAGR G+AIS+ T Y
Sbjct:    9 FAGLGLNKWLVSQCVAMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQIADQFKVLGRPIGLKEAVIVGGLDMMKQALSL-ANKPHVVIATPGRLADHIKSTDTLNLKKIQFLVLDEADRLLDPSFGDDLKVIFDAVPEKRQTLLFSATLTDTMGELQKMSGSQPFSYEVQSDIATVAEL----------DQRYLLTPAHVRDCYLVHLLRENDDNQS--VIVFTHTCKNCQVLVSMFHKLGLTCVGLHSLLSQGERLAALARFKSGTIKILVATDVASRGLDIPQVELVVNSNIPADPKDYIHRVGRTARAGRGGMAISMVTQY 354          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Nematostella
Match: EDO43602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYA5])

HSP 1 Score: 209.534 bits (532), Expect = 3.198e-60
Identity = 131/403 (32.51%), Postives = 215/403 (53.35%), Query Frame = 3
Query:   24 FNLKMFGGN------KFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPI---------IQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLP------------------------KMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLV---WKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLAT 1106
            FN+   GG       K+++  +  ++ E ++K+G+ +PT IQR+ IP+ L+  D++ +AETGSGKT AFAIP+         I++  D  +  +ALIL PT ELA QI+ E +K G   G++ V+++GG   EDQ   L+     +V+ TPGR++  +  + L      ++V+DEADRM+   F  ++  I+E LP                        K RQT +F+ATM  ++E+L    ++ P    +    + V+ +           E+ ++LV    K + LL   +++    +I+F   KK   +L + L ++      L     + +R+ AL S   G   +LVATDVA RG+DI +V  VIN+ + ++ +DY HR+GRT RAG++G+A+S  T
Sbjct:  336 FNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPLGIRTVSVIGGLSREDQGFQLRLG-VEIVIATPGRLIDVLENRYLVLNRCSYIVMDEADRMIDMGFEPEVQKILEHLPVSNVKPDSEDSEDPEHLLTHMGKDKYRQTVMFTATMPPQVERLAKNYLRRPAVVYIGSVGKPVERV-----------EQRVYLVNEQQKRKKLLELLNKDLEPPIIIFVNQKKGADVLAKSLEKMGFRATTLHGGRNQEQREFALSSLKGGSKDILVATDVAGRGIDIKDVSHVINYDMAKTIEDYTHRIGRTGRAGKTGIAVSFLT 726          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Nematostella
Match: EDO48460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIU5])

HSP 1 Score: 201.445 bits (511), Expect = 3.709e-60
Identity = 113/349 (32.38%), Postives = 198/349 (56.73%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            F+ + +  +L   I   G+ +P+ IQ++ I  +LK  DV+A A++G+GKT  F+I ++Q +  + +   AL+L+PT ELA QI+   + LG+   ++    +GG  + +  + L   + H+V GTPGRV   I ++ L  ++++ LVLDEAD ML+  F   +  +   LP   Q  L SAT+ +++ ++ S  + +P+R  V R   T++ + Q  +    ++       WK  +L +  D    +  ++F  TK+    L   + E + +VA +  DM + ER+  +  F +G+  VL++TDV +RGLD+  V LVIN+ +P + + Y+HR+GR+ R GR G+AI+ 
Sbjct:   36 FDAMKLREDLLRGIYAYGFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKLDYGQ-HIVSGTPGRVFDMIRRRNLRTRSIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREE-------WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVASMHGDMPQKEREAIMKDFRAGQSRVLISTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINF 376          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Nematostella
Match: EDO39940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H2])

HSP 1 Score: 201.445 bits (511), Expect = 7.377e-60
Identity = 131/376 (34.84%), Postives = 205/376 (54.52%), Query Frame = 3
Query:   45 GNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNF-ALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSI 1169
            GN+FE   +   L   I + G+++P+ IQ + IP+ L   D++A A+ G+GKT A+ +P++++  D  K+   AL+L PT ELA+Q     ++LG+  G +V+   GG  ++D    L  NK HV+V TPGRVL  + KKL +    + LV+DEAD++LS DF   L  II+ LP+ RQ  LFSAT    +   +   ++ P   E++   +       Q   F  + ++V  L    Q L       Q +  I+F  + +  ++L R + EL  S   + + M++  R      F  G    LV +D+ +RG+DI +V +VINF  P++S+ YLHR+GR+ R G  G+AI+L T     DL  IE +L   +K I
Sbjct:   46 GNEFEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLERT-DTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSLKDDILRL-YNKVHVIVATPGRVLDLMKKKLADMSKCQMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKPY--EINLMDELTLHGVTQYYAFVEEKQKVHCLNTLFQKL-------QINQSIIFCNSVQRVELLARKILELGFSCFYIHARMSQSHRNRVFHDFRQGHCRNLVCSDLFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRFGHLGVAINLITYDDRFDLYKIENELDTEIKPI 410          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Medaka
Match: ddx47 (DEAD-box helicase 47 [Source:NCBI gene;Acc:101159675])

HSP 1 Score: 283.108 bits (723), Expect = 4.276e-90
Identity = 155/356 (43.54%), Postives = 228/356 (64.04%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQS--LLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F+ LGV   L E  +++GW  PT+IQ + IP+ L+  DV+ LAETGSGKTGAFA+PI+Q L   P+    L+LTPT ELA QI  +F  LG   G+K   IVGG  +  Q+ L+ + K H+V+ TPGR++ H+ N K  + + L+FLV+DEADR+L+ DF  ++  I++ +P+ R+T LFSATMT K++KL+   +K+P++  VS K+ TV  L           +  +F+  K +   L++  +E   ++ ++F  T  + + +  +L  L I+   L   M++ +R  AL+ F S   +VL+ATDVASRGLDIP+V  VIN+ +P  SKDY+HRVGRTARAGRSG +I+  T Y
Sbjct:   41 FKDLGVTDVLCEACDQLGWKSPTKIQVEAIPVALQGKDVIGLAETGSGKTGAFALPILQSLLASPQRLHTLVLTPTRELAFQISEQFEALGSSIGVKCAVIVGGIDMMSQS-LVLAKKPHIVIATPGRLIDHMENTKGFSLRALKFLVMDEADRILNMDFETEVDKILKVIPRERRTFLFSATMTKKVQKLQRAALKDPVKCAVSTKYSTVDKL----------QQYYVFIPAKYKDCYLVSILNELAGNSFMIFCSTCNNAQRVALMLRNLGITAIPLHGQMSQNKRLGALNKFKSKSRSVLLATDVASRGLDIPHVDCVINYDIPTHSKDYIHRVGRTARAGRSGKSITFVTQY 385          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Medaka
Match: ddx49 (DEAD-box helicase 49 [Source:NCBI gene;Acc:101169189])

HSP 1 Score: 247.669 bits (631), Expect = 1.137e-76
Identity = 149/390 (38.21%), Postives = 224/390 (57.44%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSD---DFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNV 1211
            F  LG+   L ++ +++G ++PT +Q   +P +L+  D +  A+TGSGKT AF +P++QKL + P   F L+LTPT ELA QI  +F  LG+  GLK   +VGG  +  Q   L S + HVVV TPGR+  H+ +    + + ++FL+LDEADR+L     DF  DL  I+ +LP  RQT LFSAT+T+ L++L+S+ +  P   E S           Q+ +   +  +  +LV  +Q+    +D++   ++I+FT T K+ +IL  +L E +     L S M + +R   L  F +    +L+ATDVA+RGLDIP V +VIN   P   K Y+HRVGRTARAGR+G++I+L T Y    +  IE+     +    V   E  +I   V
Sbjct:    4 FHSLGLSDWLVKQCKQLGIDKPTPVQENCVPAILEGRDCLGCAKTGSGKTAAFVLPVLQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIVVGGMDMVTQALEL-SKQPHVVVATPGRLADHVRSSNTFSMRKIKFLILDEADRLLEQGCTDFTKDLEEILGTLPAKRQTLLFSATLTDTLQELKSIAMNKPFFWE-STSETRTVEELDQRYILTPEKVKDAYLVHLIQTF---TDKHDDWSIIIFTNTCKNCQILTMMLREFNFPTISLHSMMKQRQRFANLAKFKASVYKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLVHSIEEQTKTKLTEYPVEEKEVHKILTQV 388          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Medaka
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:101159793])

HSP 1 Score: 207.223 bits (526), Expect = 7.566e-62
Identity = 115/349 (32.95%), Postives = 197/349 (56.45%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            F+ +G+  +L   I   G+ +P+ IQ++ I  ++K  DV+A +++G+GKT  F I ++Q L  + +   ALIL PT ELA QI+   + LG+   ++    +GG  V +  + L   + HVV GTPGRV   I ++ L  + ++ LVLDEAD ML+  F   +  +   LP   Q  L SAT+ +++ ++ +  + +P+R  V R   T++ + Q  +    ++       WK  +L +  D    +  ++F  TK+    L   + E + +V+ +  DM + ER++ +  F SG   VL++TDV +RGLD+P V L+IN+ +P + + Y+HR+GR+ R GR G+AI+ 
Sbjct:   35 FDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCISVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQ-HVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREE-------WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINF 375          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Medaka
Match: ddx54 (DEAD-box helicase 54 [Source:NCBI gene;Acc:101162145])

HSP 1 Score: 213.001 bits (541), Expect = 1.180e-60
Identity = 137/360 (38.06%), Postives = 196/360 (54.44%), Query Frame = 3
Query:   33 KMFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNF---ALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKL-LNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            K  GG  F+ +G+   + + + K G+  PT IQRK IP++L   DVVA+A TGSGKT AF +P+ +KL   P+ +    ALI++PT ELA+Q      +LG+  GLK   I+GG+ +EDQ   L  N   +++GTPGR L+H+ K++ L   ++ ++V DEADR+    F   L  II+ LP  RQT LFSAT+   L +     +  P+   +    +    +       R DD+  + L      LL    + Q   V VF  TK   + L  LL    I  A + S + +  R+  +  F   K  VL+ TDVA+RG+DIP + +VIN+  P   K +LHRVGR  RAGRSG   SL
Sbjct:   74 KKSGG--FQSMGLSYPVYKGVMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTAAFLVPMFEKL-KAPQASAGARALIMSPTRELALQTMKFTKELGKFAGLKTALILGGDRMEDQFAALHEN-PDIIIGTPGR-LMHVVKEMNLKLHSVEYVVFDEADRLFEMGFAEQLQEIIQRLPDTRQTLLFSATLPKLLVEFARAGLTEPVLIRLDVDSKLSDQIKLSFFHLRVDDKPAMLL-----HLLKNVAKPQEQTV-VFVATKHHVEYLRELLSSEGIECAYIYSALDQTARKINIGKFVHRKAMVLIVTDVAARGIDIPMLDIVINYNFPSKPKLFLHRVGRVGRAGRSGTTYSL 422          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Medaka
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:101158015])

HSP 1 Score: 204.527 bits (519), Expect = 3.662e-58
Identity = 131/351 (37.32%), Postives = 202/351 (57.55%), Query Frame = 3
Query:   72 DGNLSEKIEK----IGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHN---FALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHI-NKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISL 1100
            D NLS  I K    +G+ +PT IQ+  +P+ L   D+ A A TG+GKT AF +P++++L  KP+ +     L+L PT EL +Q+ +   +L +   +     VGG  ++ Q   L++    V++ TPGR++ H+ N        +  L+LDEADRML + F   +  II      RQT LFSATMT +++ L +V +K P+R  V+        L Q+ +  R   E     V  + +LL  + ++   +V++FT+T+K    L+ LLG + + V  L  ++++ +R   L  F   ++ +LVATDVA+RGLDI  V  VINF +P + K Y+HRVGRTARAGRSG ++SL
Sbjct:  177 DMNLSRPILKAITALGFKQPTPIQKACVPVSLLGRDLCACAATGTGKTAAFMLPVLERLIYKPRTSQVTRVLVLVPTRELGIQVHSVARQLAQFTSITTCLAVGGLDLKSQEAALRAGP-DVLIATPGRLIDHLHNTPNFELSHIEILILDEADRMLDEYFEEQMKEIIRLCSYNRQTMLFSATMTEEVKDLAAVSLKQPVRIFVNSNTDVAPFLRQEFIRIRPHREGDREAV--VAALLTRTFQD---HVMLFTQTRKQAHRLHILLGLMGLKVGELHGELSQNQRLENLRRFKDDQIDILVATDVAARGLDIDGVKTVINFTMPSTVKHYVHRVGRTARAGRSGRSVSL 521          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Planmine SMEST
Match: SMESG000067540.1 (SMESG000067540.1)

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 362/434 (83.41%), Postives = 369/434 (85.02%), Query Frame = 3
Query:   36 MFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNVXXXXXXXXXXXXXDEMPIREGNTXXXXXXXXXXXXXXPHLDN 1337
            MFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEF+EDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIE+LPK                 +   C+                                        + +   DENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDL ITMKSIDVPRNEFEEIQ+NVLSLLESTKKKLKEDEMPIREGNTKRKHGEKKEKHSKKPHLDN
Sbjct:    1 MFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFIEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIEALPK-----------------MRQTCL--------------------------------------FSATMTNKDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLRITMKSIDVPRNEFEEIQNNVLSLLESTKKKLKEDEMPIREGNTKRKHGEKKEKHSKKPHLDN 379          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Planmine SMEST
Match: SMESG000060310.1 (SMESG000060310.1)

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 362/434 (83.41%), Postives = 369/434 (85.02%), Query Frame = 3
Query:   36 MFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNVXXXXXXXXXXXXXDEMPIREGNTXXXXXXXXXXXXXXPHLDN 1337
            MFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEF+EDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIE+LPK                 +   C+                                        + +   DENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDL ITMKSIDVPRNEFEEIQ+NVLSLLESTKKKLKEDEMPIREGNTKRKHGEKKEKHSKKPHLDN
Sbjct:    1 MFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFIEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIEALPK-----------------MRQTCL--------------------------------------FSATMTNKDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLRITMKSIDVPRNEFEEIQNNVLSLLESTKKKLKEDEMPIREGNTKRKHGEKKEKHSKKPHLDN 379          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Planmine SMEST
Match: SMESG000067540.1 (SMESG000067540.1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 324/396 (81.82%), Postives = 331/396 (83.59%), Query Frame = 3
Query:  150 MLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERVLFLVWKLQSLLNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNVXXXXXXXXXXXXXDEMPIREGNTXXXXXXXXXXXXXXPHLDN 1337
            MLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEF+EDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIE+LPK                 +   C+                                        + +   DENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDL ITMKSIDVPRNEFEEIQ+NVLSLLESTKKKLKEDEMPIREGNTKRKHGEKKEKHSKKPHLDN
Sbjct:    1 MLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFIEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLRFLVLDEADRMLSDDFVNDLTAIIEALPK-----------------MRQTCL--------------------------------------FSATMTNKDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLRITMKSIDVPRNEFEEIQNNVLSLLESTKKKLKEDEMPIREGNTKRKHGEKKEKHSKKPHLDN 341          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Planmine SMEST
Match: SMESG000051946.1 (SMESG000051946.1)

HSP 1 Score: 286.574 bits (732), Expect = 5.467e-92
Identity = 157/376 (41.76%), Postives = 235/376 (62.50%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQ-TKLLKSNKCHVVVGTPGRVLLHI-NKKLLN---FKTLRFLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCD-DERVLFLVWKLQSL-----------------LNTSDENQSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 1112
            F++LGV+  L E IE+I W  PTEIQ+K IP  L+  D++ LA+TGSGKTGAF IPI+Q+L   PK  FAL+ TPT ELA+QI+ EF  LG+  G+K  T++GG   + Q T++L  NK H+++ TPGR L H+   K  N    K L+FLV+DEADRMLS  F  DL  I+  LP+ R+T LFSAT T+K+ KL+   + +P++  V  K+   ++   ++ +  C  +++   LVW L+ L                 L++  +  + ++IVF +T+  + +L   L +L ++   + SDM++ +R   +      KV ++VATDVA+RG+DIPNV +VI + +PES+K Y HR GRTARAG+ G++I++   Y
Sbjct:    3 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQIL--NKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKY--AESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHRAGRTARAGKRGVSITMVNQY 374          
BLAST of ATP-dependent rRNA helicase RRP3 vs. Planmine SMEST
Match: SMESG000030761.1 (SMESG000030761.1)

HSP 1 Score: 246.514 bits (628), Expect = 2.410e-76
Identity = 161/405 (39.75%), Postives = 236/405 (58.27%), Query Frame = 3
Query:   54 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKH-NFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRV--LLHINKKLLN-FKTLRFLVLDEADRMLSDDFVNDLTAIIESLPK-----------------MRQTCLFSATMTNKLEKLESVCVKNPLRAEVSRKHXXXXXXXXXXXXFRCDDERV--LFLVWKL-----------QSLLNTS-DENQS--SNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIYTFVDLIFIEKDLGIT 1157
            F++LG+  +L +  +  GWNEPT+IQ+  IP+ L   D++ LAETG GKTGAF +PI+    ++ K   FALILTPT ELA QI+ +F+ +G E GLK   I+GGE +  Q   L +   H+VV TPGRV  L+  +K+  +  +T+  LV+DEADRML  +F +D+ AI + LPK                 +RQT LFSAT ++ +EK+    +  P +  V  K Q  + L Q  L+ +   ERV  LF + +            Q++  T+  E+Q   S+ IVF  T K TK L   L ++  S   L S +++ +R+ A+D F +G+  +L+ATD+ASRGLD+ +V LV+N+ +P++   Y HRVGRTARAGRSG A++          I +EK LG+ 
Sbjct:    3 FKELGIRDDLCKVCQGCGWNEPTDIQKSAIPVALTGVDIIGLAETGGGKTGAFLLPILNDWLNREKPVMFALILTPTRELAAQIEEQFIAMGSEFGLKSTLIIGGEEMSQQMTELGNWDSHIVVATPGRVVSLMEKSKQARDMLETIEKLVIDEADRMLHLEFESDMEAISKVLPKKSSITSKKKLAKGQIKCIRQTQLFSATFSSHIEKVAGYLLWKPTKVFVDNKMQIPKQLKQFVLVMQY-VERVPNLFALLRFHLAKKIRPGGNQAVTETTKHESQRALSSAIVFVTTCKQTKPLEIYLNKMGASAVALHSQLSQNQRELAIDRFKTGEANILIATDIASRGLDVDHVRLVVNYDLPQTPDWYKHRVGRTARAGRSGTAVTFVNEINRDQFIGMEKRLGLA 406          
The following BLAST results are available for this feature:
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX472.711e-9143.79DEAD-box helicase 47 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX472.166e-8241.81DEAD-box helicase 47 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX491.215e-7939.95DEAD-box helicase 49 [Source:HGNC Symbol;Acc:HGNC:... [more]
EIF4A37.959e-6333.24eukaryotic translation initiation factor 4A3 [Sour... [more]
EIF4A37.959e-6333.24eukaryotic translation initiation factor 4A3 [Sour... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T26G10.11.256e-9342.74Putative ATP-dependent RNA helicase T26G10.1 [Sou... [more]
H20J04.44.414e-7638.76pep chromosome:WBcel235:II:4329023:4332507:1 gene:... [more]
H20J04.45.091e-7539.21pep chromosome:WBcel235:II:4329023:4334091:1 gene:... [more]
H20J04.45.091e-7539.21pep chromosome:WBcel235:II:4329023:4334484:1 gene:... [more]
ddx-275.263e-6638.87DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG92539.796e-9041.28gene:FBgn0032919 transcript:FBtr0081468[more]
Dbp45A1.248e-7841.00gene:FBgn0010220 transcript:FBtr0088564[more]
vas2.821e-6036.10gene:FBgn0283442 transcript:FBtr0445187[more]
vas2.821e-6036.10gene:FBgn0283442 transcript:FBtr0445185[more]
vas2.821e-6036.10gene:FBgn0283442 transcript:FBtr0445186[more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx492.740e-7942.90DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
eif4a33.241e-6332.95eukaryotic translation initiation factor 4A3 [Sour... [more]
ddx231.084e-5832.89DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ddx541.123e-5837.05DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [Source:... [more]
ddx272.674e-5835.41DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mki672.746e-9244.35marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
mki674.222e-9144.44marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
mki677.741e-9144.29marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
mki671.253e-9044.29marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
mki671.490e-9044.29marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx479.664e-9244.10DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:... [more]
Ddx479.086e-8441.57DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:... [more]
Ddx471.828e-8342.09DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:... [more]
Ddx491.868e-7939.69DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
Eif4a31.098e-6232.95eukaryotic translation initiation factor 4A3 [Sour... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2RB17|RRP3_ASPNC2.351e-9443.93ATP-dependent rRNA helicase rrp3 OS=Aspergillus ni... [more]
sp|P34580|DDX47_CAEEL1.598e-9242.74Putative ATP-dependent RNA helicase T26G10.1 OS=Ca... [more]
sp|Q2H1Q8|RRP3_CHAGB3.517e-9243.94ATP-dependent rRNA helicase RRP3 OS=Chaetomium glo... [more]
sp|Q6CH58|RRP3_YARLI7.522e-9243.05ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipol... [more]
sp|Q29S22|DDX47_BOVIN2.664e-9144.10Probable ATP-dependent RNA helicase DDX47 OS=Bos t... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MFQ52.374e-11047.30Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8WXX14.605e-11047.42DEAD/DEAH box helicase (Fragment) OS=Opisthorchis ... [more]
A0A4S2MKH86.358e-11047.30Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0R1D26.155e-10846.79ATP-dependent rRNA helicase OS=Fasciola hepatica O... [more]
A0A504YV236.497e-10846.53DEAD box ATP-dependent RNA helicase OS=Fasciola gi... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx476.464e-9244.10DEAD-box helicase 47 [Source:NCBI gene;Acc:1030345... [more]
ddx498.484e-7838.73DEAD-box helicase 49 [Source:NCBI gene;Acc:1030432... [more]
eif4a31.482e-6132.66eukaryotic translation initiation factor 4A3 [Sour... [more]
ddx545.187e-6038.33DEAD-box helicase 54 [Source:NCBI gene;Acc:1030469... [more]
eif4a35.447e-6032.84eukaryotic translation initiation factor 4A3 [Sour... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000216.13.699e-9343.01pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
ddx499.489e-7939.63DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
DDX542.969e-6536.54DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:... [more]
ddx62.132e-5933.78DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
ddx238.020e-5932.31DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RRP31.826e-8440.98Protein involved in rRNA processing; required for ... [more]
DBP83.345e-6939.17ATPase, putative RNA helicase of the DEAD-box fami... [more]
FAL12.639e-6233.70Nucleolar protein required for maturation of 18S r... [more]
DRS16.204e-6238.17Nucleolar DEAD-box protein required for ribosome a... [more]
DBP35.787e-6136.87RNA-Dependent ATPase, member of DExD/H-box family;... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO335931.704e-9344.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430113.794e-9045.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436023.198e-6032.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484603.709e-6032.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399407.377e-6034.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx474.276e-9043.54DEAD-box helicase 47 [Source:NCBI gene;Acc:1011596... [more]
ddx491.137e-7638.21DEAD-box helicase 49 [Source:NCBI gene;Acc:1011691... [more]
eif4a37.566e-6232.95eukaryotic translation initiation factor 4A3 [Sour... [more]
ddx541.180e-6038.06DEAD-box helicase 54 [Source:NCBI gene;Acc:1011621... [more]
ddx273.662e-5837.32DEAD-box helicase 27 [Source:NCBI gene;Acc:1011580... [more]
back to top
BLAST of ATP-dependent rRNA helicase RRP3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067540.10.000e+083.41SMESG000067540.1[more]
SMESG000060310.10.000e+083.41SMESG000060310.1[more]
SMESG000067540.10.000e+081.82SMESG000067540.1[more]
SMESG000051946.15.467e-9241.76SMESG000051946.1[more]
SMESG000030761.12.410e-7639.75SMESG000030761.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026996 ID=SMED30026996|Name=ATP-dependent rRNA helicase RRP3|organism=Schmidtea mediterranea sexual|type=transcript|length=1374bp
ATTTGTTTTAATAATCAAATTCTTTTAATCTAAAAATGTTTGGCGGTAAT
AAATTTGAGAAACTTGGAGTTGACGGGAATCTGTCAGAGAAAATTGAAAA
AATTGGATGGAATGAACCCACTGAAATTCAGCGTAAAGTAATTCCATTAA
TGTTAAAAGAGAACGATGTTGTTGCTCTTGCTGAAACTGGGTCTGGTAAA
ACTGGAGCATTTGCTATTCCTATTATTCAGAAATTATTTGATAAACCTAA
GCACAATTTCGCTTTAATACTGACTCCCACACATGAATTAGCAGTACAAA
TCAAAAACGAGTTTATGAAACTTGGTGAAGAAGATGGTCTTAAAGTTGTA
ACAATTGTCGGAGGTGAATTTGTTGAGGATCAAACTAAGTTATTAAAGTC
AAATAAATGTCATGTTGTAGTTGGTACTCCCGGCCGTGTGTTACTTCATA
TCAATAAAAAGTTGTTGAATTTTAAAACCTTACGCTTTTTAGTTTTGGAT
GAAGCAGATCGAATGTTATCTGATGATTTTGTTAATGATTTAACAGCTAT
TATCGAATCCTTACCTAAAATGCGACAGACATGTTTATTTTCAGCTACCA
TGACAAATAAATTGGAAAAATTAGAATCGGTTTGTGTCAAAAATCCTCTC
CGCGCTGAAGTTTCCAGAAAACACCAGACCGTCCAAACTCTGACTCAGCA
AAAATTATTATTCCGATGTGATGATGAGAGAGTTTTGTTTCTCGTTTGGA
AACTGCAAAGCCTCTTAAATACTTCAGATGAAAATCAATCGTCCAATGTT
ATTGTGTTTACAGAAACGAAAAAGGATACAAAAATTCTTTATCGGTTGTT
AGGAGAATTAGACATTTCTGTAGCTATGCTCCAGAGTGACATGACTCGAG
TTGAACGACAGAATGCGCTTGATAGCTTCTCTTCTGGTAAAGTAGCGGTT
CTTGTAGCAACAGATGTTGCTAGCCGTGGTTTAGATATCCCAAATGTTGG
ATTGGTTATAAATTTCCAGGTTCCAGAATCCAGTAAGGATTATCTACATC
GTGTCGGTAGAACTGCGCGTGCTGGTCGATCGGGGCTTGCGATTTCCCTA
GCAACTATCTACACTTTTGTCGATCTCATTTTCATTGAGAAAGATTTGGG
AATTACAATGAAAAGCATTGATGTCCCTAGAAATGAATTCGAGGAAATTC
AGGATAATGTTTTGAGCCTTTTAGAAAGCACAAAAAAGAAACTAAAGGAA
GATGAGATGCCAATAAGAGAAGGTAACACGAAAAGGAAACACGGAGAGAA
AAAAGAAAAACATTCAAAAAAACCTCATTTGGATAATTAATTGTTTTCAA
TAAATTTTCTTGAGATCGGAAGAG
back to top

protein sequence of SMED30026996-orf-1

>SMED30026996-orf-1 ID=SMED30026996-orf-1|Name=SMED30026996-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=435bp
MFGGNKFEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAE
TGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEED
GLKVVTIVGGEFVEDQTKLLKSNKCHVVVGTPGRVLLHINKKLLNFKTLR
FLVLDEADRMLSDDFVNDLTAIIESLPKMRQTCLFSATMTNKLEKLESVC
VKNPLRAEVSRKHQTVQTLTQQKLLFRCDDERVLFLVWKLQSLLNTSDEN
QSSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSS
GKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSG
LAISLATIYTFVDLIFIEKDLGITMKSIDVPRNEFEEIQDNVLSLLESTK
KKLKEDEMPIREGNTKRKHGEKKEKHSKKPHLDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003724RNA helicase activity
GO:0005524ATP binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
GO:0008186RNA-dependent ATPase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: biological process
TermDefinition
GO:0000462maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364rRNA processing
GO:0008150biological_process
GO:0042254ribosome biogenesis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 266..347
e-value: 1.6E-29
score: 114.1
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 240..347
e-value: 5.7E-27
score: 94.3
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 239..396
score: 20.871
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 24..222
e-value: 2.2E-53
score: 193.3
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 36..207
score: 29.818
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 213..433
e-value: 1.2E-47
score: 164.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 3..211
e-value: 2.5E-73
score: 247.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 404..419
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 404..434
NoneNo IPR availablePANTHERPTHR24031:SF390coord: 5..374
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 5..374
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 221..355
e-value: 1.88895E-49
score: 162.291
NoneNo IPR availableCDDcd00268DEADccoord: 16..206
e-value: 3.96145E-85
score: 256.6
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 29..196
e-value: 1.1E-49
score: 168.6
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 153..161
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 5..33
score: 9.482
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 75..369