V-type proton ATPase subunit C

Overview
NameV-type proton ATPase subunit C
Smed IDSMED30026995
Length (bp)2294
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of V-type proton ATPase subunit C (SMED30026995) t-SNE clustered cells

Violin plots show distribution of expression levels for V-type proton ATPase subunit C (SMED30026995) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of V-type proton ATPase subunit C (SMED30026995) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for V-type proton ATPase subunit C (SMED30026995) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026995

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30026995SMESG000061029.1 Contig313GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30026995SMESG000061029.1 dd_Smed_v4_1255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026995SMESG000061029.1 dd_Smed_v4_1255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026995SMESG000061029.1 Contig37331newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026995SMESG000061029.1 Contig37331uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Match: ATP6V1C1 (ATPase H+ transporting V1 subunit C1 [Source:HGNC Symbol;Acc:HGNC:856])

HSP 1 Score: 214.157 bits (544), Expect = 7.825e-63
Identity = 100/188 (53.19%), Postives = 137/188 (72.87%), Query Frame = 3
Query: 1410 YNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +N W  +YETL + VVPRSS ++ ED +  L NVTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +H+K+LR+FVESVLRYGLPVNFQ++++ P+KK  KK+RE+L + + +L+++A    +   + PGLN L+  EYYPYVYYK+D N ++
Sbjct:  119 HNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN-LSQQEYYPYVYYKIDCNLLE 305          

HSP 2 Score: 108.612 bits (270), Expect = 3.022e-25
Identity = 50/110 (45.45%), Postives = 78/110 (70.91%), Query Frame = 1
Query:  268 MGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            M ++LE+ K ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   ++  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++ E+VKK+ FV DSEY VTL
Sbjct:    1 MADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTL 110          
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Match: ATP6V1C1 (ATPase H+ transporting V1 subunit C1 [Source:HGNC Symbol;Acc:HGNC:856])

HSP 1 Score: 214.157 bits (544), Expect = 7.825e-63
Identity = 100/188 (53.19%), Postives = 137/188 (72.87%), Query Frame = 3
Query: 1410 YNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +N W  +YETL + VVPRSS ++ ED +  L NVTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +H+K+LR+FVESVLRYGLPVNFQ++++ P+KK  KK+RE+L + + +L+++A    +   + PGLN L+  EYYPYVYYK+D N ++
Sbjct:  119 HNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN-LSQQEYYPYVYYKIDCNLLE 305          

HSP 2 Score: 108.612 bits (270), Expect = 3.022e-25
Identity = 50/110 (45.45%), Postives = 78/110 (70.91%), Query Frame = 1
Query:  268 MGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            M ++LE+ K ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   ++  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++ E+VKK+ FV DSEY VTL
Sbjct:    1 MADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTL 110          
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Match: ATP6V1C1 (ATPase H+ transporting V1 subunit C1 [Source:HGNC Symbol;Acc:HGNC:856])

HSP 1 Score: 214.542 bits (545), Expect = 5.793e-62
Identity = 100/188 (53.19%), Postives = 137/188 (72.87%), Query Frame = 3
Query: 1410 YNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +N W  +YETL + VVPRSS ++ ED +  L NVTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +H+K+LR+FVESVLRYGLPVNFQ++++ P+KK  KK+RE+L + + +L+++A    +   + PGLN L+  EYYPYVYYK+D N ++
Sbjct:  194 HNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN-LSQQEYYPYVYYKIDCNLLE 380          

HSP 2 Score: 181.415 bits (459), Expect = 5.627e-50
Identity = 89/186 (47.85%), Postives = 129/186 (69.35%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q  +E ++    + NNL    K+++P D KVGTLDVLV LSDELAKLD F E V +K+ QYM ++LE+ K ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   ++  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++ E+VKK+ FV DSEY VTL
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIP-DLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTL 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Match: ATP6V1C1 (ATPase H+ transporting V1 subunit C1 [Source:HGNC Symbol;Acc:HGNC:856])

HSP 1 Score: 214.542 bits (545), Expect = 5.793e-62
Identity = 100/188 (53.19%), Postives = 137/188 (72.87%), Query Frame = 3
Query: 1410 YNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +N W  +YETL + VVPRSS ++ ED +  L NVTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +H+K+LR+FVESVLRYGLPVNFQ++++ P+KK  KK+RE+L + + +L+++A    +   + PGLN L+  EYYPYVYYK+D N ++
Sbjct:  194 HNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN-LSQQEYYPYVYYKIDCNLLE 380          

HSP 2 Score: 181.415 bits (459), Expect = 5.627e-50
Identity = 89/186 (47.85%), Postives = 129/186 (69.35%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q  +E ++    + NNL    K+++P D KVGTLDVLV LSDELAKLD F E V +K+ QYM ++LE+ K ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   ++  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++ E+VKK+ FV DSEY VTL
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIP-DLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTL 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Match: ATP6V1C2 (ATPase H+ transporting V1 subunit C2 [Source:HGNC Symbol;Acc:HGNC:18264])

HSP 1 Score: 190.66 bits (483), Expect = 3.173e-53
Identity = 97/197 (49.24%), Postives = 139/197 (70.56%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNH-KKIREILGQAFSYLENTAMIQT-NENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            ++  +  Y+ W+  YE+L+  VVPRS++LI ED E GL+ VTLFR +  DF  KAKEN+F VR+F Y+E EI+  R E++RL +DKK+Q+    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P KK+  K++RE+L   F +L+  A     + + E PGL  L   +Y+PYVY+ +D + +D
Sbjct:  186 VIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQ-LNNQDYFPYVYFHIDLSLLD 381          

HSP 2 Score: 160.614 bits (405), Expect = 1.698e-42
Identity = 81/186 (43.55%), Postives = 125/186 (67.20%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKS-QVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P  K++ Q  E + + +  ++NL    K+++P DFKVGTLD LV LSDEL KLD F+ES+ R++ Q + E++E+ K ++ +HL  N   L +FVT + WD AK+P +Q L  +   ++  ++++E  LK +T +YN LK +L+ LE+K +G+L TR + ++V KE FV DSEY VTL
Sbjct:    1 MSEFWLISAPGDKENLQALERM-NTVTSKSNLSYNTKFAIP-DFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTL 184          
BLAST of V-type proton ATPase subunit C vs. Ensembl Celegans
Match: vha-11 (V-type proton ATPase subunit C [Source:UniProtKB/Swiss-Prot;Acc:Q9XXU9])

HSP 1 Score: 190.274 bits (482), Expect = 1.443e-53
Identity = 86/185 (46.49%), Postives = 126/185 (68.11%), Query Frame = 3
Query: 1419 WRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            W  KY TL+  VVP SS+L+ E+ EH L+ VTLF+ +  +F   A+EN+F VRDF Y+E  ++  R E  +L  +K++Q+    RWLK+NFGE F   +HIK+LR+FVESVLRYGLPVNFQ+ +I P+K   KK+R+ L + + +L+ +A    +  E+ P L  L   EYYPYV++KL+ +F++
Sbjct:  199 WEQKYATLSSMVVPGSSKLLTEEGEHALYTVTLFKKVIDEFKNTARENKFIVRDFVYDEETLKAGRTERDKLMAEKQRQYAPLIRWLKINFGEIFAAYIHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQQKKLRQELHKLYIHLDGSAAGPIDTLEDSPALMSLGVNEYYPYVFFKLNIDFLN 383          

HSP 2 Score: 162.54 bits (410), Expect = 1.281e-43
Identity = 84/184 (45.65%), Postives = 127/184 (69.02%), Query Frame = 1
Query:   49 EYWLISVPQQKKSQVFETIYDKLVRQ-NNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            EYWLISVP +K +      +DKL R   N     KY +P D KVGTLD LV LSD+L+KLD  +E+V RK+VQY  E+LEE KS++ ++L I    ++ +VTK+ W+ AK+P +QSL+ +   +   +S+++N LK+K+ +YN LK +L +++RK +GSLLT+++ +LVK + FV +SEY  T+
Sbjct:    8 EYWLISVPGEKGAN---DAWDKLNRSTGNTSTNSKYLIP-DLKVGTLDQLVGLSDDLSKLDTSAEAVIRKLVQYFTEVLEEDKSKIAENLVIGNKDMKTYVTKFQWEGAKYPLKQSLKVLSEIIGKQISQIDNDLKVKSLTYNNLKNALASMDRKTVGSLLTKDLADLVKADDFVLNSEYLQTV 187          
BLAST of V-type proton ATPase subunit C vs. Ensembl Celegans
Match: vha-11 (V-type proton ATPase subunit C [Source:UniProtKB/Swiss-Prot;Acc:Q9XXU9])

HSP 1 Score: 85.1149 bits (209), Expect = 2.220e-19
Identity = 48/93 (51.61%), Postives = 62/93 (66.67%), Query Frame = 1
Query:   49 EYWLISVPQQKKSQVFETIYDKLVRQ-NNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKIN 324
            EYWLISVP +K +      +DKL R   N     KY +P D KVGTLD LV LSD+L+KLD  +E+V RK+VQY  E+LEE KS++ ++L I 
Sbjct:    8 EYWLISVPGEKGAN---DAWDKLNRSTGNTSTNSKYLIP-DLKVGTLDQLVGLSDDLSKLDTSAEAVIRKLVQYFTEVLEEDKSKIAENLVIG 96          
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Match: Vha44 (gene:FBgn0262511 transcript:FBtr0087176)

HSP 1 Score: 202.986 bits (515), Expect = 5.561e-58
Identity = 92/190 (48.42%), Postives = 136/190 (71.58%), Query Frame = 3
Query: 1413 NLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTA---MIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            N W   YE +T  +VPRSS+LI ED ++ L+NVTLF+ ++ +F   A+E +F VRDF YNE E+   +NE+++L  DKKKQF    RWLKVNF E+F  L+H+K+LR+FVESVLRYGLPVNFQ+I+I P+KK+ K++R++L Q + +L+  +    + + +N + PGL      EY+PYV+YK++ + V+
Sbjct:  196 NDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSSADNVDIPGLG-FGQSEYFPYVFYKVNIDMVE 384          

HSP 2 Score: 193.741 bits (491), Expect = 1.414e-54
Identity = 91/186 (48.92%), Postives = 131/186 (70.43%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + EYW+IS P  K  Q  ++T+ +   +Q+NLC  YK+ +P D KVGTLD LV LSD+L KLD + E +TRK+  Y+GE+LE+Q+ +L ++L  N   L  ++T++ WD AK+P +QSL  I   +S  + +++  LK K+Q+YN LKG+LQ LE+K+ GSLLTRN+ +LVKKEHF+ DSEY  TL
Sbjct:    2 MSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIP-DLKVGTLDQLVGLSDDLGKLDTYVEQITRKVANYLGEVLEDQRDKLHENLMANNTELPQYLTRFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTL 186          
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Match: Vha44 (gene:FBgn0262511 transcript:FBtr0087173)

HSP 1 Score: 202.986 bits (515), Expect = 5.561e-58
Identity = 92/190 (48.42%), Postives = 136/190 (71.58%), Query Frame = 3
Query: 1413 NLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTA---MIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            N W   YE +T  +VPRSS+LI ED ++ L+NVTLF+ ++ +F   A+E +F VRDF YNE E+   +NE+++L  DKKKQF    RWLKVNF E+F  L+H+K+LR+FVESVLRYGLPVNFQ+I+I P+KK+ K++R++L Q + +L+  +    + + +N + PGL      EY+PYV+YK++ + V+
Sbjct:  196 NDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSSADNVDIPGLG-FGQSEYFPYVFYKVNIDMVE 384          

HSP 2 Score: 193.741 bits (491), Expect = 1.414e-54
Identity = 91/186 (48.92%), Postives = 131/186 (70.43%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + EYW+IS P  K  Q  ++T+ +   +Q+NLC  YK+ +P D KVGTLD LV LSD+L KLD + E +TRK+  Y+GE+LE+Q+ +L ++L  N   L  ++T++ WD AK+P +QSL  I   +S  + +++  LK K+Q+YN LKG+LQ LE+K+ GSLLTRN+ +LVKKEHF+ DSEY  TL
Sbjct:    2 MSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIP-DLKVGTLDQLVGLSDDLGKLDTYVEQITRKVANYLGEVLEDQRDKLHENLMANNTELPQYLTRFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTL 186          
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Match: Vha44 (gene:FBgn0262511 transcript:FBtr0087175)

HSP 1 Score: 202.601 bits (514), Expect = 3.325e-57
Identity = 92/190 (48.42%), Postives = 136/190 (71.58%), Query Frame = 3
Query: 1413 NLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTA---MIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            N W   YE +T  +VPRSS+LI ED ++ L+NVTLF+ ++ +F   A+E +F VRDF YNE E+   +NE+++L  DKKKQF    RWLKVNF E+F  L+H+K+LR+FVESVLRYGLPVNFQ+I+I P+KK+ K++R++L Q + +L+  +    + + +N + PGL      EY+PYV+YK++ + V+
Sbjct:  250 NDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSSADNVDIPGLG-FGQSEYFPYVFYKVNIDMVE 438          

HSP 2 Score: 170.244 bits (430), Expect = 9.769e-46
Identity = 93/240 (38.75%), Postives = 134/240 (55.83%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKIN------EDS------------------------------------------------LENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + EYW+IS P  K  Q  ++T+ +   +Q+NLC  YK+ +P D KVGTLD LV LSD+L KLD + E +TRK+  Y+GE+LE+Q+ +L ++L  N      +DS                                                L  ++T++ WD AK+P +QSL  I   +S  + +++  LK K+Q+YN LKG+LQ LE+K+ GSLLTRN+ +LVKKEHF+ DSEY  TL
Sbjct:    2 MSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIP-DLKVGTLDQLVGLSDDLGKLDTYVEQITRKVANYLGEVLEDQRDKLHENLMANNSPGPPDDSMPCRHHQRIKHLSLRHQRKHQHTHHQNKPQHYHHHHHHHQLPQDLKAELPQYLTRFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTL 240          
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Match: Vha44 (gene:FBgn0262511 transcript:FBtr0290032)

HSP 1 Score: 202.601 bits (514), Expect = 1.750e-54
Identity = 92/190 (48.42%), Postives = 136/190 (71.58%), Query Frame = 3
Query: 1413 NLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTA---MIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            N W   YE +T  +VPRSS+LI ED ++ L+NVTLF+ ++ +F   A+E +F VRDF YNE E+   +NE+++L  DKKKQF    RWLKVNF E+F  L+H+K+LR+FVESVLRYGLPVNFQ+I+I P+KK+ K++R++L Q + +L+  +    + + +N + PGL      EY+PYV+YK++ + V+
Sbjct:  644 NDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSSADNVDIPGLG-FGQSEYFPYVFYKVNIDMVE 832          

HSP 2 Score: 103.219 bits (256), Expect = 3.116e-22
Identity = 46/88 (52.27%), Postives = 65/88 (73.86%), Query Frame = 1
Query:  334 LENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            L  ++T++ WD AK+P +QSL  I   +S  + +++  LK K+Q+YN LKG+LQ LE+K+ GSLLTRN+ +LVKKEHF+ DSEY  TL
Sbjct:  547 LPQYLTRFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTL 634          

HSP 3 Score: 97.8265 bits (242), Expect = 1.273e-20
Identity = 45/95 (47.37%), Postives = 66/95 (69.47%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKIN 324
            + EYW+IS P  K  Q  ++T+ +   +Q+NLC  YK+ +P D KVGTLD LV LSD+L KLD + E +TRK+  Y+GE+LE+Q+ +L ++L  N
Sbjct:    2 MSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIP-DLKVGTLDQLVGLSDDLGKLDTYVEQITRKVANYLGEVLEDQRDKLHENLMAN 95          
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Match: Vha44 (gene:FBgn0262511 transcript:FBtr0290031)

HSP 1 Score: 202.601 bits (514), Expect = 1.750e-54
Identity = 92/190 (48.42%), Postives = 136/190 (71.58%), Query Frame = 3
Query: 1413 NLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTA---MIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            N W   YE +T  +VPRSS+LI ED ++ L+NVTLF+ ++ +F   A+E +F VRDF YNE E+   +NE+++L  DKKKQF    RWLKVNF E+F  L+H+K+LR+FVESVLRYGLPVNFQ+I+I P+KK+ K++R++L Q + +L+  +    + + +N + PGL      EY+PYV+YK++ + V+
Sbjct:  644 NDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGHLDGASAGGAVSSADNVDIPGLG-FGQSEYFPYVFYKVNIDMVE 832          

HSP 2 Score: 103.219 bits (256), Expect = 3.116e-22
Identity = 46/88 (52.27%), Postives = 65/88 (73.86%), Query Frame = 1
Query:  334 LENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            L  ++T++ WD AK+P +QSL  I   +S  + +++  LK K+Q+YN LKG+LQ LE+K+ GSLLTRN+ +LVKKEHF+ DSEY  TL
Sbjct:  547 LPQYLTRFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTL 634          

HSP 3 Score: 97.8265 bits (242), Expect = 1.273e-20
Identity = 45/95 (47.37%), Postives = 66/95 (69.47%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKIN 324
            + EYW+IS P  K  Q  ++T+ +   +Q+NLC  YK+ +P D KVGTLD LV LSD+L KLD + E +TRK+  Y+GE+LE+Q+ +L ++L  N
Sbjct:    2 MSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIP-DLKVGTLDQLVGLSDDLGKLDTYVEQITRKVANYLGEVLEDQRDKLHENLMAN 95          
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Match: atp6v1c1a (ATPase H+ transporting V1 subunit C1a [Source:NCBI gene;Acc:368907])

HSP 1 Score: 219.935 bits (559), Expect = 4.111e-64
Identity = 104/196 (53.06%), Postives = 144/196 (73.47%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENE-EFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ Y  W+  YETL + VVPRS+ L+ ED++ GL+ VTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P+KKN KK+RE+L   + +L+++A    +++  + PGLN L+  EYYPYVYYK+D N +D
Sbjct:  187 VVVPKTNYTDWQRTYETLAEMVVPRSTNLLFEDHDSGLFTVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDSSAAAIIDQSAMDIPGLN-LSQQEYYPYVYYKIDCNLLD 381          

HSP 2 Score: 182.956 bits (463), Expect = 1.251e-50
Identity = 93/189 (49.21%), Postives = 131/189 (69.31%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQVFETIYDKLV----RQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q     +DKL+    R NNL    K+++P D KVGTLDVLV LSDELAKLD F ESV +K+ QYM ++LE+ + ++ ++L  N   L  +VT++ WD AK+P +QSL+ I   +S  +S+++N LK +  +YN LKG+LQ LERK  GSLLTR++ ++VKK+ FV DSEY +TL
Sbjct:    1 MTEFWLISAPGEKTCQ---QTWDKLMTATTRTNNLSTNNKFNIP-DLKVGTLDVLVGLSDELAKLDAFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLKNISEIISKQVSQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKDDFVLDSEYLITL 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Match: atp6v1c1a (ATPase H+ transporting V1 subunit C1a [Source:NCBI gene;Acc:368907])

HSP 1 Score: 219.935 bits (559), Expect = 4.111e-64
Identity = 104/196 (53.06%), Postives = 144/196 (73.47%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENE-EFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ Y  W+  YETL + VVPRS+ L+ ED++ GL+ VTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P+KKN KK+RE+L   + +L+++A    +++  + PGLN L+  EYYPYVYYK+D N +D
Sbjct:  187 VVVPKTNYTDWQRTYETLAEMVVPRSTNLLFEDHDSGLFTVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDSSAAAIIDQSAMDIPGLN-LSQQEYYPYVYYKIDCNLLD 381          

HSP 2 Score: 182.956 bits (463), Expect = 1.251e-50
Identity = 93/189 (49.21%), Postives = 131/189 (69.31%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQVFETIYDKLV----RQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q     +DKL+    R NNL    K+++P D KVGTLDVLV LSDELAKLD F ESV +K+ QYM ++LE+ + ++ ++L  N   L  +VT++ WD AK+P +QSL+ I   +S  +S+++N LK +  +YN LKG+LQ LERK  GSLLTR++ ++VKK+ FV DSEY +TL
Sbjct:    1 MTEFWLISAPGEKTCQ---QTWDKLMTATTRTNNLSTNNKFNIP-DLKVGTLDVLVGLSDELAKLDAFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLKNISEIISKQVSQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKDDFVLDSEYLITL 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Match: atp6v1c1b (ATPase H+ transporting V1 subunit C1b [Source:NCBI gene;Acc:449655])

HSP 1 Score: 217.624 bits (553), Expect = 2.362e-63
Identity = 100/196 (51.02%), Postives = 145/196 (73.98%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVDV 1976
            ++  ++ Y  W+  YETL++ VVPRS++L+ ED E GL++VTLF     DF  +A+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+F ESVLRYGLPVNFQ++++ P+KKN KK+RE+L   + +L+++A +  + + + PGLN L+  EYYPYVYYK+D N +++
Sbjct:  187 VIVSKTNYPEWQKTYETLSEMVVPRSTKLLFEDQESGLFSVTLFTKAIDDFKQQARENKFMVRDFLYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSETFIAWIHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNVKKLREVLKDLYKHLDSSAAV-IDGSVDIPGLN-LSQQEYYPYVYYKIDVNLLEL 380          

HSP 2 Score: 178.718 bits (452), Expect = 3.872e-49
Identity = 91/189 (48.15%), Postives = 129/189 (68.25%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQVFETIYDKL----VRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P  K  Q     +DK+       NNL    K+++P+  KVGTLDVLV LSDELAKLD F ESV +KI QYM ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   +S  +++++N LK +  +YN LKGSLQ+LERK +GSLLTR++ ++VKKE FV DSEY  TL
Sbjct:    1 MTEFWLISAPGDKTCQ---QTWDKMNMATAESNNLSTNNKFNIPE-LKVGTLDVLVGLSDELAKLDTFVESVVKKIAQYMTDVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKSISEIMSKQVTQIDNDLKARASAYNSLKGSLQSLERKNVGSLLTRSLADIVKKEDFVLDSEYLTTL 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Match: atp6v1c1b (ATPase H+ transporting V1 subunit C1b [Source:NCBI gene;Acc:449655])

HSP 1 Score: 217.624 bits (553), Expect = 2.362e-63
Identity = 100/196 (51.02%), Postives = 145/196 (73.98%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVDV 1976
            ++  ++ Y  W+  YETL++ VVPRS++L+ ED E GL++VTLF     DF  +A+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+F ESVLRYGLPVNFQ++++ P+KKN KK+RE+L   + +L+++A +  + + + PGLN L+  EYYPYVYYK+D N +++
Sbjct:  187 VIVSKTNYPEWQKTYETLSEMVVPRSTKLLFEDQESGLFSVTLFTKAIDDFKQQARENKFMVRDFLYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSETFIAWIHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNVKKLREVLKDLYKHLDSSAAV-IDGSVDIPGLN-LSQQEYYPYVYYKIDVNLLEL 380          

HSP 2 Score: 178.718 bits (452), Expect = 3.872e-49
Identity = 91/189 (48.15%), Postives = 129/189 (68.25%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQVFETIYDKL----VRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P  K  Q     +DK+       NNL    K+++P+  KVGTLDVLV LSDELAKLD F ESV +KI QYM ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   +S  +++++N LK +  +YN LKGSLQ+LERK +GSLLTR++ ++VKKE FV DSEY  TL
Sbjct:    1 MTEFWLISAPGDKTCQ---QTWDKMNMATAESNNLSTNNKFNIPE-LKVGTLDVLVGLSDELAKLDTFVESVVKKIAQYMTDVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKSISEIMSKQVTQIDNDLKARASAYNSLKGSLQSLERKNVGSLLTRSLADIVKKEDFVLDSEYLTTL 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Match: atp6v1c2 (ATPase H+ transporting V1 subunit C2 [Source:ZFIN;Acc:ZDB-GENE-131127-65])

HSP 1 Score: 167.933 bits (424), Expect = 2.681e-45
Identity = 86/195 (44.10%), Postives = 127/195 (65.13%), Query Frame = 3
Query: 1401 RSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAG----EYYPYVYYKLDTNFVD 1973
            R+ Y LW+  YE+++K+VVPRSS  + ED E G++ VTLF+S+ ++F A AK+++F VR+  YN  E ++ + +I RL  DKK+  +    WLKVNF E+F+  +H+K LR FVESVLRYGLPV+FQ+I++ P KKN K +++ L   F +L+  A+    E     GL++   G    EYY Y+ Y +  N VD
Sbjct:  190 RTEYVLWQKTYESMSKFVVPRSSRKLAEDAEAGVFTVTLFKSVIAEFKANAKKHKFTVRE--YNLEEAEKQKQKIGRLALDKKELCRTFVCWLKVNFSETFVAWIHVKVLRTFVESVLRYGLPVSFQAILLQPGKKNVKHLKQQLNSLFKHLDPAAISTKPEM----GLDIPDGGAGQQEYYSYICYPIKINLVD 378          

HSP 2 Score: 133.65 bits (335), Expect = 2.215e-33
Identity = 76/186 (40.86%), Postives = 114/186 (61.29%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKS-QVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            +ME+WLISVP  K S Q  E +  ++  +N      +  +P + KVGTLDVL+ LSD+L++LD F+E V R+  Q + E+++E   +L + L      L  +VT++ WD AK+PT Q L+ +   +S  +S+V+  LK +  SY+ LK S+Q+ ERK  GSL  R +  +VKKE  V +SEY  TL
Sbjct:    1 VMEFWLISVPLDKISCQSVEKL-KRVAAKNGQSASSRMHIP-ELKVGTLDVLLGLSDDLSRLDSFTEGVMRQTSQCLAEVMDEFSGKLLESLLAGGVDLATYVTRFQWDRAKYPTAQPLKTLADIISKQVSQVDTELKSRRASYSHLKASIQSYERKSEGSLQNRLLTNIVKKEDLVLNSEYLTTL 184          
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Match: atoh8 (atonal bHLH transcription factor 8 [Source:Xenbase;Acc:XB-GENE-877027])

HSP 1 Score: 215.698 bits (548), Expect = 2.181e-62
Identity = 102/195 (52.31%), Postives = 140/195 (71.79%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ YN W  +YETL + VVPRSS ++ ED +  L NVTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +H+K+LR+FVESVLRYGLPVNFQ++++ P+KK  KK+RE+L   + +L+++A    +   + PGLN L+  EYYPYVYYK+D N ++
Sbjct:  187 VVVPKNNYNDWVKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFVVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYDLYKHLDSSAASIIDAPMDIPGLN-LSQQEYYPYVYYKIDCNLLE 380          

HSP 2 Score: 177.178 bits (448), Expect = 1.650e-48
Identity = 85/186 (45.70%), Postives = 127/186 (68.28%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q  +E +     + NNL    K+++P D KVGTLDVLV LSDELAKLD F E   +K+ QYM ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   ++  +++++N LK +  +YN LKG+LQ LERK  GSL+TR++ E+VKK+ FV DSEY +TL
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLMAATTKNNNLSTNAKFNIP-DLKVGTLDVLVGLSDELAKLDAFVEGTVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLITRSLAEIVKKDDFVLDSEYLITL 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Match: ttc28 (tetratricopeptide repeat domain 28 [Source:Xenbase;Acc:XB-GENE-998938])

HSP 1 Score: 211.075 bits (536), Expect = 1.056e-61
Identity = 99/196 (50.51%), Postives = 140/196 (71.43%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYL-ENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  +S Y  W+  YE+L+  VVPRS+++I ED E GL+ VTLFR +  DF AKA+EN+F VR+F +NE E+Q  + EI +L  DKK+ +    RWLKVNF E+FIG +HIK+LR+FVESVLRYGLPVNFQ++++ P+KK+ K++R++L   F +L EN A    +   E PGL  L++ +YYPYV +K+D   +D
Sbjct:  111 VVVPKSSYGAWQKTYESLSDMVVPRSTKMIAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREFLFNEKELQSEKAEIVKLAADKKQLYGPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAVVLQPNKKSMKRLRDVLNAIFRHLDENAAANMKDIGMEIPGLQ-LSSQDYYPYVCFKIDLTNLD 305          

HSP 2 Score: 96.6709 bits (239), Expect = 2.588e-21
Identity = 43/88 (48.86%), Postives = 64/88 (72.73%), Query Frame = 1
Query:  334 LENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            L +++ ++ WD AK+P +Q L+ I   LS  MS+++  LK ++ +YN +KGSLQ+LERK +G+LLTR + ++V KE FV DSEY VTL
Sbjct:   22 LISYLARFEWDMAKYPVKQPLKNIMEVLSKQMSQIDTDLKSRSSAYNNIKGSLQSLERKTVGNLLTRTLADIVNKEDFVLDSEYLVTL 109          
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Match: ttc28 (tetratricopeptide repeat domain 28 [Source:Xenbase;Acc:XB-GENE-998938])

HSP 1 Score: 211.46 bits (537), Expect = 1.439e-61
Identity = 99/196 (50.51%), Postives = 140/196 (71.43%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYL-ENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  +S Y  W+  YE+L+  VVPRS+++I ED E GL+ VTLFR +  DF AKA+EN+F VR+F +NE E+Q  + EI +L  DKK+ +    RWLKVNF E+FIG +HIK+LR+FVESVLRYGLPVNFQ++++ P+KK+ K++R++L   F +L EN A    +   E PGL  L++ +YYPYV +K+D   +D
Sbjct:  129 VVVPKSSYGAWQKTYESLSDMVVPRSTKMIAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREFLFNEKELQSEKAEIVKLAADKKQLYGPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAVVLQPNKKSMKRLRDVLNAIFRHLDENAAANMKDIGMEIPGLQ-LSSQDYYPYVCFKIDLTNLD 323          

HSP 2 Score: 114.005 bits (284), Expect = 5.465e-27
Identity = 51/118 (43.22%), Postives = 82/118 (69.49%), Query Frame = 1
Query:  244 VTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + +KI QY+GE++++   +  ++L  N   L +++ ++ WD AK+P +Q L+ I   LS  MS+++  LK ++ +YN +KGSLQ+LERK +G+LLTR + ++V KE FV DSEY VTL
Sbjct:   10 LIKKIAQYIGEVMDDSTDKAQENLLANGVDLISYLARFEWDMAKYPVKQPLKNIMEVLSKQMSQIDTDLKSRSSAYNNIKGSLQSLERKTVGNLLTRTLADIVNKEDFVLDSEYLVTL 127          
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Match: ttc28 (tetratricopeptide repeat domain 28 [Source:Xenbase;Acc:XB-GENE-998938])

HSP 1 Score: 199.134 bits (505), Expect = 4.508e-56
Identity = 101/220 (45.91%), Postives = 141/220 (64.09%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQ-----------------------FQAT-FRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYL-ENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  +S Y  W+  YE+L+  VVPRS+++I ED E GL+ VTLFR +  DF AKA+EN+F VR+F +NE E+Q  + EI +L  DKK+                        FQ    RWLKVNF E+FIG +HIK+LR+FVESVLRYGLPVNFQ++++ P+KK+ K++R++L   F +L EN A    +   E PGL  L++ +YYPYV +K+D   +D
Sbjct:  186 VVVPKSSYGAWQKTYESLSDMVVPRSTKMIAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREFLFNEKELQSEKAEIVKLAADKKQLYVKPPENVKVSLPQSLVNKEINIFQGPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAVVLQPNKKSMKRLRDVLNAIFRHLDENAAANMKDIGMEIPGLQ-LSSQDYYPYVCFKIDLTNLD 404          

HSP 2 Score: 165.236 bits (417), Expect = 6.041e-44
Identity = 81/183 (44.26%), Postives = 121/183 (66.12%), Query Frame = 1
Query:   49 EYWLISVPQQKKSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            E WLISVP  K +       + +  + NL    K+ +P+  KVGTLD LV LSDEL KLD ++ES+ +KI QY+GE++++   +  ++L  N   L +++ ++ WD AK+P +Q L+ I   LS  MS+++  LK ++ +YN +KGSLQ+LERK +G+LLTR + ++V KE FV DSEY VTL
Sbjct:    3 ELWLISVPGDKTNLTALDRMNTVTSKANLSSNAKFVIPE-LKVGTLDALVGLSDELGKLDAYAESLIKKIAQYIGEVMDDSTDKAQENLLANGVDLISYLARFEWDMAKYPVKQPLKNIMEVLSKQMSQIDTDLKSRSSAYNNIKGSLQSLERKTVGNLLTRTLADIVNKEDFVLDSEYLVTL 184          
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Match: ttc28 (tetratricopeptide repeat domain 28 [Source:Xenbase;Acc:XB-GENE-998938])

HSP 1 Score: 199.134 bits (505), Expect = 5.222e-56
Identity = 101/220 (45.91%), Postives = 141/220 (64.09%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQ-----------------------FQAT-FRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYL-ENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  +S Y  W+  YE+L+  VVPRS+++I ED E GL+ VTLFR +  DF AKA+EN+F VR+F +NE E+Q  + EI +L  DKK+                        FQ    RWLKVNF E+FIG +HIK+LR+FVESVLRYGLPVNFQ++++ P+KK+ K++R++L   F +L EN A    +   E PGL  L++ +YYPYV +K+D   +D
Sbjct:  196 VVVPKSSYGAWQKTYESLSDMVVPRSTKMIAEDAEGGLFTVTLFRKVMDDFKAKARENKFIVREFLFNEKELQSEKAEIVKLAADKKQLYVKPPENVKVSLPQSLVNKEINIFQGPLLRWLKVNFSEAFIGWIHIKALRVFVESVLRYGLPVNFQAVVLQPNKKSMKRLRDVLNAIFRHLDENAAANMKDIGMEIPGLQ-LSSQDYYPYVCFKIDLTNLD 414          

HSP 2 Score: 155.221 bits (391), Expect = 1.973e-40
Identity = 81/193 (41.97%), Postives = 121/193 (62.69%), Query Frame = 1
Query:   49 EYWLISVPQQKKSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINED----------SLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            E WLISVP  K +       + +  + NL    K+ +P+  KVGTLD LV LSDEL KLD ++ES+ +KI QY+GE++++   +  ++L  N             L +++ ++ WD AK+P +Q L+ I   LS  MS+++  LK ++ +YN +KGSLQ+LERK +G+LLTR + ++V KE FV DSEY VTL
Sbjct:    3 ELWLISVPGDKTNLTALDRMNTVTSKANLSSNAKFVIPE-LKVGTLDALVGLSDELGKLDAYAESLIKKIAQYIGEVMDDSTDKAQENLLANGGKKKNNKNMHMDLISYLARFEWDMAKYPVKQPLKNIMEVLSKQMSQIDTDLKSRSSAYNNIKGSLQSLERKTVGNLLTRTLADIVNKEDFVLDSEYLVTL 194          
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Match: Atp6v1c1 (ATPase, H+ transporting, lysosomal V1 subunit C1 [Source:MGI Symbol;Acc:MGI:1913585])

HSP 1 Score: 215.698 bits (548), Expect = 1.266e-62
Identity = 101/188 (53.72%), Postives = 138/188 (73.40%), Query Frame = 3
Query: 1410 YNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +N W  +YETL + VVPRSS ++ ED +  L NVTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P+KK+ KK+RE+L + + +L+++A    +   + PGLN L+  EYYPYVYYK+D N ++
Sbjct:  194 HNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN-LSQQEYYPYVYYKIDCNLLE 380          

HSP 2 Score: 179.489 bits (454), Expect = 2.094e-49
Identity = 88/186 (47.31%), Postives = 129/186 (69.35%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q  +E ++    + NNL    K+++P D KVGTLDVLV LSDELAKLD F E V +K+ QYM ++LE+ K ++ ++L  +   L  ++T++ WD AK+P +QSL+ I   ++  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++ E+VKK+ FV DSEY VTL
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIP-DLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTL 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Match: Atp6v1c1 (ATPase, H+ transporting, lysosomal V1 subunit C1 [Source:MGI Symbol;Acc:MGI:1913585])

HSP 1 Score: 215.698 bits (548), Expect = 1.266e-62
Identity = 101/188 (53.72%), Postives = 138/188 (73.40%), Query Frame = 3
Query: 1410 YNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +N W  +YETL + VVPRSS ++ ED +  L NVTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P+KK+ KK+RE+L + + +L+++A    +   + PGLN L+  EYYPYVYYK+D N ++
Sbjct:  194 HNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN-LSQQEYYPYVYYKIDCNLLE 380          

HSP 2 Score: 179.489 bits (454), Expect = 2.094e-49
Identity = 88/186 (47.31%), Postives = 129/186 (69.35%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q  +E ++    + NNL    K+++P D KVGTLDVLV LSDELAKLD F E V +K+ QYM ++LE+ K ++ ++L  +   L  ++T++ WD AK+P +QSL+ I   ++  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++ E+VKK+ FV DSEY VTL
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIP-DLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTL 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Match: Atp6v1c2 (ATPase, H+ transporting, lysosomal V1 subunit C2 [Source:MGI Symbol;Acc:MGI:1916025])

HSP 1 Score: 195.282 bits (495), Expect = 4.146e-55
Identity = 98/197 (49.75%), Postives = 141/197 (71.57%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNH-KKIREILGQAFSYLENTAMIQT-NENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            ++  +S +  W+  YE+L+  VVPRS++LI EDNE GL+ VTLFR +  DF  KAKEN+F VR+F Y+E EI+  R E++RL +DKK+Q+    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P KK+  K++RE+L   F +L+  A     + + E PGL  L+  +Y+PYVY+ +D + +D
Sbjct:  186 VIVPKSSFAQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKAKENKFIVREFYYDEKEIKREREEMTRLLSDKKQQYGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSATKRLREVLNSVFRHLDEVAAASILDASVEIPGLQ-LSNQDYFPYVYFHIDLSLLD 381          

HSP 2 Score: 153.295 bits (386), Expect = 3.275e-40
Identity = 77/186 (41.40%), Postives = 122/186 (65.59%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKS-QVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P  K++ Q  E + + +  ++NL    K+++P DFKVGTLD LV LSDEL KLD F+ES+ +++ Q + E++E+ K +  + L  N   L +FVT + WD AK+P +Q L  +   L+  ++++E  LK +T +Y+ LK +L+ LE++  G+L TR + ++V KE FV DSEY +TL
Sbjct:    1 MSEFWLISAPGDKENLQALERM-NNVTSKSNLSHNTKFAIP-DFKVGTLDSLVGLSDELGKLDTFAESLIKRMAQSVVEVMEDSKGKAHETLLANGVDLTSFVTHFEWDMAKYPAKQPLVSVVDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKRSTGNLFTRTLSDIVSKEDFVLDSEYLITL 184          
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Match: Atp6v1c2 (ATPase, H+ transporting, lysosomal V1 subunit C2 [Source:MGI Symbol;Acc:MGI:1916025])

HSP 1 Score: 174.866 bits (442), Expect = 4.837e-48
Identity = 98/243 (40.33%), Postives = 142/243 (58.44%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQAT----------------------------------------------FRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNH-KKIREILGQAFSYLENTAMIQT-NENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            ++  +S +  W+  YE+L+  VVPRS++LI EDNE GL+ VTLFR +  DF  KAKEN+F VR+F Y+E EI+  R E++RL +DKK+Q+  +                                               RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P KK+  K++RE+L   F +L+  A     + + E PGL  L+  +Y+PYVY+ +D + +D
Sbjct:  116 VIVPKSSFAQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKAKENKFIVREFYYDEKEIKREREEMTRLLSDKKQQYPTSCVALKKGSATYRDHKVKVAPLGNPARPAAGQTDRDRESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSATKRLREVLNSVFRHLDEVAAASILDASVEIPGLQ-LSNQDYFPYVYFHIDLSLLD 357          

HSP 2 Score: 93.9745 bits (232), Expect = 4.249e-20
Identity = 43/114 (37.72%), Postives = 72/114 (63.16%), Query Frame = 1
Query:  256 IVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + Q + E++E+ K +  + L  N   L +FVT + WD AK+P +Q L  +   L+  ++++E  LK +T +Y+ LK +L+ LE++  G+L TR + ++V KE FV DSEY +TL
Sbjct:    1 MAQSVVEVMEDSKGKAHETLLANGVDLTSFVTHFEWDMAKYPAKQPLVSVVDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKRSTGNLFTRTLSDIVSKEDFVLDSEYLITL 114          
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Match: Atp6v1c2 (ATPase, H+ transporting, lysosomal V1 subunit C2 [Source:MGI Symbol;Acc:MGI:1916025])

HSP 1 Score: 174.866 bits (442), Expect = 2.972e-47
Identity = 98/243 (40.33%), Postives = 142/243 (58.44%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQAT----------------------------------------------FRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNH-KKIREILGQAFSYLENTAMIQT-NENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            ++  +S +  W+  YE+L+  VVPRS++LI EDNE GL+ VTLFR +  DF  KAKEN+F VR+F Y+E EI+  R E++RL +DKK+Q+  +                                               RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P KK+  K++RE+L   F +L+  A     + + E PGL  L+  +Y+PYVY+ +D + +D
Sbjct:  186 VIVPKSSFAQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIEDFKVKAKENKFIVREFYYDEKEIKREREEMTRLLSDKKQQYPTSCVALKKGSATYRDHKVKVAPLGNPARPAAGQTDRDRESEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSATKRLREVLNSVFRHLDEVAAASILDASVEIPGLQ-LSNQDYFPYVYFHIDLSLLD 427          

HSP 2 Score: 153.68 bits (387), Expect = 8.220e-40
Identity = 77/186 (41.40%), Postives = 122/186 (65.59%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKS-QVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P  K++ Q  E + + +  ++NL    K+++P DFKVGTLD LV LSDEL KLD F+ES+ +++ Q + E++E+ K +  + L  N   L +FVT + WD AK+P +Q L  +   L+  ++++E  LK +T +Y+ LK +L+ LE++  G+L TR + ++V KE FV DSEY +TL
Sbjct:    1 MSEFWLISAPGDKENLQALERM-NNVTSKSNLSHNTKFAIP-DFKVGTLDSLVGLSDELGKLDTFAESLIKRMAQSVVEVMEDSKGKAHETLLANGVDLTSFVTHFEWDMAKYPAKQPLVSVVDTLAKQLAQIETDLKSRTAAYSVLKANLENLEKRSTGNLFTRTLSDIVSKEDFVLDSEYLITL 184          
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Match: sp|Q7T385|VTC1A_DANRE (V-type proton ATPase subunit C 1-A OS=Danio rerio OX=7955 GN=atp6v1c1a PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.103e-63
Identity = 104/196 (53.06%), Postives = 144/196 (73.47%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENE-EFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ Y  W+  YETL + VVPRS+ L+ ED++ GL+ VTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P+KKN KK+RE+L   + +L+++A    +++  + PGLN L+  EYYPYVYYK+D N +D
Sbjct:  187 VVVPKTNYTDWQRTYETLAEMVVPRSTNLLFEDHDSGLFTVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDSSAAAIIDQSAMDIPGLN-LSQQEYYPYVYYKIDCNLLD 381          

HSP 2 Score: 182.956 bits (463), Expect = 9.445e-50
Identity = 93/189 (49.21%), Postives = 131/189 (69.31%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQVFETIYDKLV----RQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q     +DKL+    R NNL    K+++P D KVGTLDVLV LSDELAKLD F ESV +K+ QYM ++LE+ + ++ ++L  N   L  +VT++ WD AK+P +QSL+ I   +S  +S+++N LK +  +YN LKG+LQ LERK  GSLLTR++ ++VKK+ FV DSEY +TL
Sbjct:    1 MTEFWLISAPGEKTCQ---QTWDKLMTATTRTNNLSTNNKFNIP-DLKVGTLDVLVGLSDELAKLDAFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLKNISEIISKQVSQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKDDFVLDSEYLITL 185          
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Match: sp|Q5XIY6|VTC1B_DANRE (V-type proton ATPase subunit C 1-B OS=Danio rerio OX=7955 GN=atp6v1c1b PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.783e-62
Identity = 100/196 (51.02%), Postives = 145/196 (73.98%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVDV 1976
            ++  ++ Y  W+  YETL++ VVPRS++L+ ED E GL++VTLF     DF  +A+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+F ESVLRYGLPVNFQ++++ P+KKN KK+RE+L   + +L+++A +  + + + PGLN L+  EYYPYVYYK+D N +++
Sbjct:  187 VIVSKTNYPEWQKTYETLSEMVVPRSTKLLFEDQESGLFSVTLFTKAIDDFKQQARENKFMVRDFLYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSETFIAWIHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNVKKLREVLKDLYKHLDSSAAV-IDGSVDIPGLN-LSQQEYYPYVYYKIDVNLLEL 380          

HSP 2 Score: 178.718 bits (452), Expect = 2.923e-48
Identity = 91/189 (48.15%), Postives = 129/189 (68.25%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQVFETIYDKL----VRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P  K  Q     +DK+       NNL    K+++P+  KVGTLDVLV LSDELAKLD F ESV +KI QYM ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   +S  +++++N LK +  +YN LKGSLQ+LERK +GSLLTR++ ++VKKE FV DSEY  TL
Sbjct:    1 MTEFWLISAPGDKTCQ---QTWDKMNMATAESNNLSTNNKFNIPE-LKVGTLDVLVGLSDELAKLDTFVESVVKKIAQYMTDVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKSISEIMSKQVTQIDNDLKARASAYNSLKGSLQSLERKNVGSLLTRSLADIVKKEDFVLDSEYLTTL 185          
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Match: sp|Q9Z1G3|VATC1_MOUSE (V-type proton ATPase subunit C 1 OS=Mus musculus OX=10090 GN=Atp6v1c1 PE=1 SV=4)

HSP 1 Score: 215.698 bits (548), Expect = 8.856e-62
Identity = 101/188 (53.72%), Postives = 138/188 (73.40%), Query Frame = 3
Query: 1410 YNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +N W  +YETL + VVPRSS ++ ED +  L NVTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P+KK+ KK+RE+L + + +L+++A    +   + PGLN L+  EYYPYVYYK+D N ++
Sbjct:  194 HNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN-LSQQEYYPYVYYKIDCNLLE 380          

HSP 2 Score: 179.489 bits (454), Expect = 1.465e-48
Identity = 88/186 (47.31%), Postives = 129/186 (69.35%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q  +E ++    + NNL    K+++P D KVGTLDVLV LSDELAKLD F E V +K+ QYM ++LE+ K ++ ++L  +   L  ++T++ WD AK+P +QSL+ I   ++  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++ E+VKK+ FV DSEY VTL
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIP-DLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTL 185          
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Match: sp|Q6P4Y9|VATC1_XENTR (V-type proton ATPase subunit C 1 OS=Xenopus tropicalis OX=8364 GN=atp6v1c1 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.155e-61
Identity = 102/195 (52.31%), Postives = 140/195 (71.79%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ YN W  +YETL + VVPRSS ++ ED +  L NVTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +H+K+LR+FVESVLRYGLPVNFQ++++ P+KK  KK+RE+L   + +L+++A    +   + PGLN L+  EYYPYVYYK+D N ++
Sbjct:  187 VVVPKNNYNDWVKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFVVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYDLYKHLDSSAASIIDAPMDIPGLN-LSQQEYYPYVYYKIDCNLLE 380          

HSP 2 Score: 177.178 bits (448), Expect = 8.740e-48
Identity = 85/186 (45.70%), Postives = 127/186 (68.28%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q  +E +     + NNL    K+++P D KVGTLDVLV LSDELAKLD F E   +K+ QYM ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   ++  +++++N LK +  +YN LKG+LQ LERK  GSL+TR++ E+VKK+ FV DSEY +TL
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLMAATTKNNNLSTNAKFNIP-DLKVGTLDVLVGLSDELAKLDAFVEGTVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLITRSLAEIVKKDDFVLDSEYLITL 185          
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Match: sp|Q5XH14|VATC1_XENLA (V-type proton ATPase subunit C 1 OS=Xenopus laevis OX=8355 GN=atp6v1c1 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.333e-61
Identity = 101/195 (51.79%), Postives = 140/195 (71.79%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ Y  W  +YETL++ VVPRSS ++ ED +  L NVTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +H+K+LR+FVESVLRYGLPVNFQ++++ P+KK  KK+RE+L   + +L+++A    +   + PGLN L+  EYYPYVYYK+D N ++
Sbjct:  187 VVVPKNNYTDWMKEYETLSEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFVVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDSSAASIIDAPMDIPGLN-LSQQEYYPYVYYKIDCNLLE 380          

HSP 2 Score: 177.948 bits (450), Expect = 6.116e-48
Identity = 85/186 (45.70%), Postives = 127/186 (68.28%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q  +E +     + NNL    K+++P D KVGTLDVLV LSDELAKLD F E   +K+ QYM ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   ++  +++++N LK +  +YN LKG+LQ LERK  GSL+TR++ E+VKK+ FV DSEY +TL
Sbjct:    1 MTEFWLISAPGEKTCQQTWEKLMAATTKNNNLSTNAKFNIP-DLKVGTLDVLVGLSDELAKLDAFVEGAVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLITRSLAEIVKKDDFVLDSEYLITL 185          
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Match: A0A3Q1JRN0 (V-type proton ATPase subunit C OS=Anabas testudineus OX=64144 GN=ATP6V1C1 PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.522e-65
Identity = 107/195 (54.87%), Postives = 143/195 (73.33%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ Y+ W   YETL + VVPRSS L+CEDN+ GL++VTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ PSKK  KK+RE+L   + +L+++A    +   + PGLN L+  EYYPYVYYK+D N +D
Sbjct:  187 VVVPKTSYSDWDKTYETLAEMVVPRSSNLLCEDNDSGLFSVTLFRKAIDDFKHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPSKKTMKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLN-LSQQEYYPYVYYKIDCNLLD 380          

HSP 2 Score: 186.808 bits (473), Expect = 9.213e-49
Identity = 91/186 (48.92%), Postives = 131/186 (70.43%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q  ++ +     R NNL   +K+S+P D KVGTLDVLV LSDELAKLD F ESV +K+ QYM ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   +S  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++G++VKKE FV DSEY +TL
Sbjct:    1 MTEFWLISAPGEKTCQQTWDKMMAATTRTNNLSTNHKFSIP-DLKVGTLDVLVGLSDELAKLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIISKQITQIDNDLKTRASAYNNLKGNLQNLERKNAGSLLTRSLGDIVKKEDFVLDSEYLITL 185          
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Match: A0A0S7JKD9 (V-type proton ATPase subunit C OS=Poeciliopsis prolifica OX=188132 GN=VTC1A PE=3 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.791e-65
Identity = 106/195 (54.36%), Postives = 143/195 (73.33%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ Y  W+  YETL + VVPRSS L+ ED++ GL++VTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ PSKKN KK+RE+L   + +L+++A    +   + PGLN L+  EYYPYVYYK+D N +D
Sbjct:    3 VVVPKTNYPDWQKTYETLAEMVVPRSSNLLFEDSDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPSKKNMKKLREVLNDLYKHLDSSAAAIIDSAMDIPGLN-LSQQEYYPYVYYKIDCNLLD 196          
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Match: A0A0R3WB90 (V-type proton ATPase subunit C OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7891 PE=3 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.849e-65
Identity = 108/195 (55.38%), Postives = 147/195 (75.38%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  R+ Y  W+A YE+L   VVPRS+ELI ED ++GLW VTLF+ + +DF  +A+E RF VRDF Y+E  I+ES+N  S+LE DKKKQF   FRWL+VNFGE+F  +MHIK+LRIFVESVLRYGLPV+F++I+I P++KN+K++RE+L   + +L+N A+  T  +EE  G   ++ GEYYPYV   ++TNFVD
Sbjct:  182 VVVPRAAYKEWKATYESLVDMVVPRSTELIFEDQDNGLWTVTLFQKMLNDFTLRAREKRFIVRDFVYDEKAIEESKNMFSKLEADKKKQFPPLFRWLRVNFGEAFSAMMHIKALRIFVESVLRYGLPVDFEAILIVPNRKNYKRLREVLHNMYEHLDNLALSSTT-DEEMVGAG-MSHGEYYPYVSISVETNFVD 374          

HSP 2 Score: 162.155 bits (409), Expect = 5.569e-40
Identity = 77/153 (50.33%), Postives = 115/153 (75.16%), Query Frame = 1
Query:  148 KYSVPQ---DFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            K+ V Q   +F VGTLDVLV +SDEL KLD ++E+VTRKI QYMG++LEEQ+ +L D+L +N  S   +++K+ WD AK+P +Q+L+ +   LS+++S++E  L+ ++ +YN +KG+L  LE+KQ GSLLTRN+ E+VKK+ FV  SEY +T+
Sbjct:   28 KHPVAQSVAEFSVGTLDVLVGISDELVKLDSYAENVTRKIAQYMGDVLEEQRHKLEDNLLVNGLSPSLYISKFQWDTAKYPIKQTLQALHDILSENLSRLEADLRTRSTNYNSIKGALHALEKKQTGSLLTRNLAEIVKKQQFVLGSEYLITV 180          
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Match: A0A4U5VJ93 (V-type proton ATPase subunit C OS=Collichthys lucidus OX=240159 GN=D9C73_023143 PE=3 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 1.694e-64
Identity = 106/195 (54.36%), Postives = 148/195 (75.90%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ Y  W+ +YETL + VVPRS++L+ EDN+ GL++VTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P+KKN KK+RE+L + + +L+++A I  + + + PGLN L+  EYYPYVYYK+D N +D
Sbjct:  112 VVVPKTNYADWQKEYETLAEMVVPRSTKLLFEDNDSGLFSVTLFRKAIDDFRHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLSELYKHLDSSAAI-IDASMDIPGLN-LSQQEYYPYVYYKIDCNLLD 304          

HSP 2 Score: 107.842 bits (268), Expect = 7.095e-22
Identity = 48/110 (43.64%), Postives = 77/110 (70.00%), Query Frame = 1
Query:  268 MGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            M ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   +S   ++++N LK +  +YN LKG+LQ LERK  GSLLTR++ ++VKKE FV DSEY +T+
Sbjct:    1 MADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIISKQATQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDSEYLITM 110          
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Match: A0A0R3WQS6 (V-type proton ATPase subunit C OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS3101 PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 4.162e-64
Identity = 108/196 (55.10%), Postives = 147/196 (75.00%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVDV 1976
            +V  R+ Y  W A YETL   VVPRS+ELI ED ++GLW VTLF+ + +DF  +A+E RF VRDF Y+E  I++S+N  S+LE DKKKQF   FRWL+VNFGE+F  +MHIK+LRIFVESVLRYGLPV+F++I+I P++KN+K++RE+L   + +L+N A+  T+ +EE  G   ++ GEYYPYV   ++TNFVD 
Sbjct:  171 VVVPRTAYKEWEATYETLVNMVVPRSTELIFEDQDNGLWTVTLFQKMLNDFTLRAREKRFIVRDFVYDEKAIEDSKNMFSKLEADKKKQFPPLFRWLRVNFGEAFSIMMHIKALRIFVESVLRYGLPVDFEAILIVPNRKNYKRLREVLHNMYEHLDNLALSSTS-DEEMAGAG-MSHGEYYPYVSINVETNFVDA 364          

HSP 2 Score: 134.806 bits (338), Expect = 1.211e-30
Identity = 68/186 (36.56%), Postives = 118/186 (63.44%), Query Frame = 1
Query:   43 LMEYWLISVPQQK-KSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + ++ +ISVP +   ++ +  +   L +      + +++VPQ+ K                  +F  SVTRKI QYMGE+LEEQ+ +L D+L +N  S   +++++ WD AK+P +Q+L+ ++  LS+++S++E  L++++ +YN +KG+L  LE+KQ GSLLTRN+ E+VKK+ FV  SEY +T+
Sbjct:    1 MSDFLIISVPAEGDPTKAYRDLSTGLTKYPVAQSVTEFAVPQNLKSA----------------VFC-SVTRKIAQYMGEVLEEQRHKLEDNLLVNGFSPSLYISQFQWDTAKYPIKQTLQSLYDILSENLSRLEADLRVRSTNYNNIKGALHALEKKQTGSLLTRNLAEIVKKQQFVLGSEYLITV 169          
BLAST of V-type proton ATPase subunit C vs. Ensembl Cavefish
Match: atp6v1c1b (V-type proton ATPase subunit C 1-A [Source:NCBI gene;Acc:103030451])

HSP 1 Score: 223.016 bits (567), Expect = 2.392e-65
Identity = 104/195 (53.33%), Postives = 145/195 (74.36%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ Y  W+  YETL++ VVPRSS L+ ED + GL++VTLFR    DF  +A+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+F ESVLRYGLPVNFQ++++ P+KKN KK+RE+L + + +L+++A I  + + + PGLN L+  EYYPYVYYK+D N +D
Sbjct:  186 VVVPKTSYAEWQKTYETLSEMVVPRSSNLLFEDQDSGLFSVTLFRKAIDDFKHQARENKFAVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFTESVLRYGLPVNFQAMLLQPNKKNMKKLREVLQELYKHLDSSAAI-IDASMDIPGLN-LSQQEYYPYVYYKIDLNLLD 378          

HSP 2 Score: 177.948 bits (450), Expect = 6.290e-49
Identity = 90/188 (47.87%), Postives = 130/188 (69.15%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQVFETIYDKL---VRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q     +DK+     Q+NL    K+S+P D KVGTLDVLV LSDELAKLD F ESV +K+ QYM ++LE+ + ++ ++L  N   L  +VT++ WD AK+P +QSL+ I   +S  +++++N LK +  +YN +KG+LQ LERK  GSLLTR++ ++VKKE FV DSEY +T+
Sbjct:    1 MTEFWLISAPGEKTCQ---QTWDKMNIATTQSNLSTNSKFSIP-DLKVGTLDVLVGLSDELAKLDSFVESVVKKLAQYMTDVLEDSRDKVQENLLANGVDLITYVTRFQWDMAKYPIKQSLKNILEIVSKQVTQIDNDLKARASAYNSIKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDSEYLITM 184          
BLAST of V-type proton ATPase subunit C vs. Ensembl Cavefish
Match: atp6v1c1a (ATPase H+ transporting V1 subunit C1a [Source:NCBI gene;Acc:368907])

HSP 1 Score: 219.935 bits (559), Expect = 3.278e-65
Identity = 104/196 (53.06%), Postives = 144/196 (73.47%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENE-EFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ Y  W+  YETL + VVPRS+ L+ ED + GL++VTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P+KKN KK+RE+L   + +L+++A    +++  + PGLN L+  EYYPYVYYK+D N +D
Sbjct:  112 VVVPKTNYADWQKTYETLAEMVVPRSTNLLFEDQDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDSSAAAIIDQSAMDIPGLN-LSQQEYYPYVYYKIDCNLLD 306          

HSP 2 Score: 108.612 bits (270), Expect = 1.401e-25
Identity = 49/110 (44.55%), Postives = 78/110 (70.91%), Query Frame = 1
Query:  268 MGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            M ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   +S  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++ ++VKKE FV DSEY +TL
Sbjct:    1 MADVLEDSRDKVQENLLANGVDLITYITRFQWDMAKYPIKQSLKNISEIISKQVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDSEYLITL 110          
BLAST of V-type proton ATPase subunit C vs. Ensembl Cavefish
Match: atp6v1c2 (V-type proton ATPase subunit C 1-B-like [Source:NCBI gene;Acc:103027342])

HSP 1 Score: 166.777 bits (421), Expect = 1.181e-44
Identity = 85/194 (43.81%), Postives = 130/194 (67.01%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMI-QTNENEEFPGLNLLAAGEYYPYVYYKLDTNF 1967
            +V  RS   LW   YE+++++VVPRSS  + E+ + G++ VTLF+    +F AKA  ++F VR+F   E E Q  R E+SRL  +KK+Q+    RWLKVNF E F+  +HIK+LR+F ESVLRYGLPV+FQ++++ P KK+ K++RE L  +F++L+ TA   +++ + + PG+N     EYY Y+ Y ++ N 
Sbjct:  216 VVVPRSGDKLWENTYESMSQFVVPRSSRKLLEEEDAGIFTVTLFKKAVREFKAKASVHKFTVREFNLEETEKQ--RQEMSRLSVEKKEQYGTFVRWLKVNFREVFVAWIHIKALRVFAESVLRYGLPVSFQTLLLQPEKKHVKRLREELQFSFTHLDPTAAASKSDMSLDIPGVN-SGQQEYYSYICYSININL 406          

HSP 2 Score: 130.568 bits (327), Expect = 2.901e-32
Identity = 72/186 (38.71%), Postives = 114/186 (61.29%), Query Frame = 1
Query:   43 LMEYWLISVPQQ-KKSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLISVP     SQ  E  + +   +  L   +++ +P + KVGTLDVL+ ++D+L++LD  +E V +K  Q M E++E    +L ++   N   L  ++TK+ WD AK+PT  S++ +   +S  +S+VE  LK ++ +Y+ +K SLQ LER+  GSL TR +  +VKKE  V +SEY  TL
Sbjct:   31 MSEFWLISVPLDIASSQSLEK-FKRAAAKAGLGSSFRFHMP-ELKVGTLDVLLGVADDLSRLDTHAEGVMQKTSQCMAEVMEHFNDKLLENALANGVELATYLTKFQWDRAKYPTALSVKSLTEIISKQVSQVEMELKSRSAAYSSVKASLQGLERRTEGSLQTRTLAGIVKKEDLVLNSEYLTTL 214          
BLAST of V-type proton ATPase subunit C vs. Ensembl Cavefish
Match: ENSAMXT00000056324.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000064.1:968229:970800:1 gene:ENSAMXG00000033086.1 transcript:ENSAMXT00000056324.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.562e-12
Identity = 39/89 (43.82%), Postives = 50/89 (56.18%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQVFETIYDKLV----RQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKS 297
            + E+WLIS P +K  Q     +DKL+    R NNL    K+++P D KVGTLDVLV LSDELAKL  F E     +       ++E  S
Sbjct:    1 MTEFWLISAPGEKTCQ---QTWDKLMMATTRTNNLSTNTKFNIP-DLKVGTLDVLVGLSDELAKLSSFVERYVTPLCTPPSRTIQESIS 85          
BLAST of V-type proton ATPase subunit C vs. Ensembl Sea Lamprey
Match: atp6v1c1b (ATPase H+ transporting V1 subunit C1b [Source:NCBI gene;Acc:449655])

HSP 1 Score: 215.312 bits (547), Expect = 2.128e-64
Identity = 101/195 (51.79%), Postives = 140/195 (71.79%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            ++  ++ Y  W   YETLT  VVPRS++LI ED E G++ VTLF+    DF  KA+E++F VR+F YNE  +   + EI+RL +DKKKQF    RWLKVNF E+FI   H+K+LR+FVESVLRYGLPVNFQ++++HP+KK  +K+RE+L   + +L+++A    + + + PGLN L+  EYYPYVYYKLD N +D
Sbjct:   94 VIVPKAAYTEWNKVYETLTDMVVPRSTKLIVEDQEGGMFTVTLFQKAVDDFKHKARESKFTVREFQYNEVFLAADKEEITRLASDKKKQFGPLVRWLKVNFSEAFIAWTHVKALRVFVESVLRYGLPVNFQAMLLHPNKKMVRKLREVLNGLYKHLDSSAAAIIDASMDIPGLN-LSQQEYYPYVYYKLDLNLLD 287          

HSP 2 Score: 92.4337 bits (228), Expect = 6.786e-21
Identity = 45/90 (50.00%), Postives = 65/90 (72.22%), Query Frame = 1
Query:  334 LENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQI--GSLLTRNIGELVKKEHFVSDSEYFVTL 597
            L  +VT++ WD AK+P +QSL+ I   ++  +S+++N LK +   YN LKGSLQ+LERK    GSL+TR++ ++V+KE FV DSEY VTL
Sbjct:    3 LFTYVTRFQWDMAKYPIKQSLKNISDIIAKGVSQIDNDLKSRASVYNNLKGSLQSLERKNTCSGSLMTRSLADIVRKEDFVLDSEYLVTL 92          
BLAST of V-type proton ATPase subunit C vs. Ensembl Sea Lamprey
Match: atp6v1c2 (ATPase H+ transporting V1 subunit C2 [Source:ZFIN;Acc:ZDB-GENE-131127-65])

HSP 1 Score: 191.43 bits (485), Expect = 1.515e-54
Identity = 88/185 (47.57%), Postives = 130/185 (70.27%), Query Frame = 3
Query: 1419 WRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            W   YETL++ VVPRSS ++ ED E  +  VTL +    DF  +A+ N+F VRDF YNE  ++  + EI+RL  DKKKQF    RWL+VNF E+F+  +H+K+LR+FVESVLRYGLPVNFQ+ ++ P +KN K++RE+L Q + +L+N A I  + + + PG++   + +YYPYV+++LD N ++
Sbjct:  194 WNKCYETLSEMVVPRSSRIVFEDPEGYMCTVTLLQKAVEDFKQEARRNKFMVRDFQYNEEALKADKEEINRLITDKKKQFGPMVRWLQVNFSEAFVAWIHLKALRVFVESVLRYGLPVNFQAALLKP-RKNQKRLREVLQQLYKHLDNGAGISVDASMDLPGMS-FNSQDYYPYVHFRLDLNLLE 376          

HSP 2 Score: 115.931 bits (289), Expect = 3.810e-28
Identity = 68/185 (36.76%), Postives = 109/185 (58.92%), Query Frame = 1
Query:   49 EYWLISVPQQKKS-QVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNL-SDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            E W++  P +  + Q +E +     R   L E +K+ +P+  KVGTLD LVS+SD+L KLD F E V RKI Q M ++LE+ + +  ++L  N      + T+   D       +    + S + S  +S++++ LK +  +YN LK  LQ++ER+  GSL+TR++ ++VKK+ FV DSEY +TL
Sbjct:    3 ELWIVCAPGEPGAPQAWEKLQAATERAG-LSENHKFHIPE-LKVGTLDSLVSMSDDLVKLDTFVEGVVRKITQTMVDVLEDARDKARENLVANGADPMTYXTR---DNEGSNRERVTSLLLSEVKSSQVSQIDSDLKGRASAYNVLKSGLQSIERRATGSLMTRSLADIVKKDDFVLDSEYLITL 182          
BLAST of V-type proton ATPase subunit C vs. Ensembl Yeast
Match: VMA5 (Subunit C of the V1 peripheral membrane domain of V-ATPase; part of the electrogenic proton pump found throughout the endomembrane system; required for the V1 domain to assemble onto the vacuolar membrane; the V1 peripheral membrane domain of vacuolar H+-ATPase (V-ATPase) has eight subunits [Source:SGD;Acc:S000001563])

HSP 1 Score: 105.531 bits (262), Expect = 8.320e-25
Identity = 67/182 (36.81%), Postives = 102/182 (56.04%), Query Frame = 3
Query: 1431 YETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNE---NEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNE---NEEFPGLNLLAA---GEYYPYVYY 1949
            YETL+K VVP S+ +I ED E+ L+NV LF+    +F   A+E +F  R+F Y+E   +++++  +  + LE   + Q     R  K  + + FI   HIK+LR++VESVLRYGLP +F   II    KN  K +  L  AF +L   A ++  +   N++   L+  A+    EY P+V Y
Sbjct:  210 YETLSKNVVPASASVIAEDAEYVLFNVHLFKKNVQEFTTAAREKKFIPREFNYSEELIDQLKKEHDSAASLEQSLRVQL---VRLAKTAYVDVFINWFHIKALRVYVESVLRYGLPPHFNIKIIAVPPKNLSKCKSELIDAFGFLGGNAFMKDKKGKINKQDTSLHQYASLVDTEYEPFVMY 388          

HSP 2 Score: 72.4034 bits (176), Expect = 5.688e-14
Identity = 43/149 (28.86%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  151 YSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + +P+ FK+G+LD L+  S+EL+K+D    +   KI++ + + L E  +     L IN   +  ++  + W   KF   +S++ + + +S+  S+++  ++    +YN  K +L   ERK+ G L  R++ ++VK E FV +SE+  T+
Sbjct:   48 FKIPE-FKIGSLDTLIVESEELSKVDNQIGASIGKIIEIL-QGLNETSTNAYRTLPINNMPVPEYLENFQWQTRKFKLDKSIKDLITLISNESSQLDADVRATYANYNSAKTNLAAAERKKTGDLSVRSLHDIVKPEDFVLNSEHLTTV 194          
BLAST of V-type proton ATPase subunit C vs. Ensembl Nematostella
Match: EDO47815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL79])

HSP 1 Score: 201.445 bits (511), Expect = 6.290e-58
Identity = 98/198 (49.49%), Postives = 141/198 (71.21%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIK-SLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQT-NENE-EFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ +N W+ KY  LT  VVP SS+L+ EDNEHGL+ VTLF+ +  +F   A++N+F VRDF Y+E  +   +NEIS+LE+D+K+QF    RWL+VNF +SF   +HIK S ++FVESVLRYGLPVNFQ++++ PSKK  KKIR+ L  A+SYLE+ +   T NE   + PGL +++  +YYPYV+Y +  N ++
Sbjct:  184 VVVPKALFNEWKEKYWKLTDMVVPESSKLLFEDNEHGLFTVTLFKKVLEEFKHHARDNKFLVRDFVYDEQALSAGKNEISKLESDRKRQFGPLVRWLRVNFSDSFTAWIHIKASQKVFVESVLRYGLPVNFQAMLLEPSKKTQKKIRDSLDTAYSYLESKSFSATVNEQAIDIPGL-MISHQQYYPYVFYNIKLNLLE 380          

HSP 2 Score: 187.963 bits (476), Expect = 6.077e-53
Identity = 92/186 (49.46%), Postives = 131/186 (70.43%), Query Frame = 1
Query:   43 LMEYWLISVPQQK-KSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + EYWL+S P +K + Q +E +  ++V    +  +YK+ +P+  KVGTLD LV LSD+L K+D F ES TRK+  YM ++LEE + R+ ++L  N   L N+VTK+ WD+AK+P +QSL  +   +S  +S++E+ LK K+ +YN +KG+L +LERK  GSLLTRN+GELVKKEHFV DSEY  TL
Sbjct:    1 MAEYWLVSAPGEKTQQQTYEALKSRMV---GMSPVYKFPIPE-LKVGTLDTLVGLSDDLNKVDSFVESTTRKLAHYMVDVLEEHQDRVKENLLANGHELSNYVTKFQWDSAKYPIKQSLRNLTEIISKQVSQIEHDLKTKSAAYNNIKGTLASLERKSTGSLLTRNLGELVKKEHFVLDSEYLTTL 182          
BLAST of V-type proton ATPase subunit C vs. Ensembl Medaka
Match: atp6v1c1a (ATPase H+ transporting V1 subunit C1 [Source:NCBI gene;Acc:101166658])

HSP 1 Score: 226.098 bits (575), Expect = 1.821e-66
Identity = 105/195 (53.85%), Postives = 143/195 (73.33%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ Y+ W+  YETL + VVPRSS L+ EDN+ GL++VTLFR    DF  KA+EN+F VRDF YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+FVESVLRYGLPVNFQ++++ P+KK  KK+RE+L   + +L+++A    +   + PGLN L+  EYYPYVYYK+D N +D
Sbjct:  187 VVVPKTSYSDWQKTYETLAEMVVPRSSNLLYEDNDSGLFSVTLFRKAIDDFKHKARENKFTVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDSSAAAIMDTAMDIPGLN-LSQQEYYPYVYYKIDCNLLD 380          

HSP 2 Score: 184.111 bits (466), Expect = 3.282e-51
Identity = 90/186 (48.39%), Postives = 131/186 (70.43%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQ-VFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q  ++ +     R NNL   +K+S+P D KVGTLDVLV LSDELAKLD F ESV +K+ QYM ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   +S  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++ ++VKKE+FV DSEY +TL
Sbjct:    1 MTEFWLISAPGEKTCQQTWDKMMAATTRTNNLSVNHKFSIP-DLKVGTLDVLVGLSDELAKLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLITYITRFQWDMAKYPIKQSLKNISEIISKQVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKENFVLDSEYLITL 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Medaka
Match: atp6v1c1b (V-type proton ATPase subunit C 1-A [Source:NCBI gene;Acc:101161904])

HSP 1 Score: 224.557 bits (571), Expect = 6.814e-66
Identity = 104/195 (53.33%), Postives = 146/195 (74.87%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVD 1973
            +V  ++ YN W   YETL++ VVPRS+++I EDN+ GL++VTLFR    DF  KA+EN+F VR+F YNE E++  + E++RL  DKKKQF    RWLKVNF E+FI  +HIK+LR+F+ESVLRYGLPVNFQ++++ P+KKN K++RE+L   + +L+++A I  +   + PGLN L+  EYYPYVYYK+D N +D
Sbjct:  187 VVVPKTSYNDWNKTYETLSEMVVPRSTKMIIEDNDSGLFSVTLFRKAVDDFKHKARENKFTVREFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKTLRVFIESVLRYGLPVNFQAMLLQPNKKNMKRLREVLYDLYKHLDSSAAI-IDAAMDIPGLN-LSQQEYYPYVYYKIDCNLLD 379          

HSP 2 Score: 179.104 bits (453), Expect = 2.530e-49
Identity = 90/189 (47.62%), Postives = 131/189 (69.31%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQVFETIYDKLV----RQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + E+WLIS P +K  Q     +DKL+    R NNL   +K ++P D KVGTLDVLV LSDELAKLD F ESV +K+ QYM ++LE+ + ++ ++L  N   L  ++T++ WD AK+P +QSL+ I   +S  +++++N LK +  +YN LKG+LQ LERK  GSLLTR++ ++VKKE FV +SEY +T+
Sbjct:    1 MTEFWLISAPGEKTCQ---QTWDKLMVATTRTNNLSTNHKLNIP-DLKVGTLDVLVGLSDELAKLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIISKQVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLESEYLITM 185          
BLAST of V-type proton ATPase subunit C vs. Ensembl Medaka
Match: atp6v1c2 (V-type proton ATPase subunit C 1-B-like [Source:NCBI gene;Acc:111946874])

HSP 1 Score: 142.124 bits (357), Expect = 3.030e-36
Identity = 75/196 (38.27%), Postives = 125/196 (63.78%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESR--NEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFV 1970
            +V  R  Y  W   YE+L+  VVPRSS  + ED E  +++VTLF+ +  +F AKA+E++F VR++ ++    QE+R   EI      K+++++   RWL VNF + FI  +H+K++ +FVESVLRYGLPVN+Q++++   KK+ KK+R+ L   F +L+ TA ++ + + + PG   L   EY  Y+ + ++T+ +
Sbjct:  203 VVVSRDRYLQWERSYESLSLLVVPRSSRKLFEDGEGAVFSVTLFKRVVCEFKAKAQESKFIVREYCFD----QEAREQQEIREYTILKREKYEIFVRWLMVNFSQLFIAWIHLKAIGVFVESVLRYGLPVNYQALLLQTDKKHSKKLRDTLSSLFKHLDPTASLK-DVSCDIPG---LCQEEYSSYICFPINTSML 390          

HSP 2 Score: 101.293 bits (251), Expect = 1.585e-22
Identity = 64/206 (31.07%), Postives = 102/206 (49.51%), Query Frame = 1
Query:   43 LMEYWLISVPQQKKSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLEN---------------------FVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            + ++WLISVP  K +        + + +  LC  +K+S+P D KVG LD L+S+SD  +KLD  +ESV +K  Q M E++E  + ++  ++ +N +   N                     +VTK+ WD AK+P    L  +   +   + + E   K    +YN LK +   LE K    L TR++  +V ++ FV  SEY  TL
Sbjct:    1 MADFWLISVPLDKTTSASVEKLKRAITKAQLCSNWKFSIP-DLKVGVLDSLLSVSDNFSKLDTLTESVIKKTCQCMNEVMEPSEDKVHPNILVNGEPSRNQSNVPAQLKAYLTSLRVNMMKYVTKFQWDTAKYPPALPLSSLVDIIGKEVLQAETEFKSHASAYNSLKAN---LEHKLNEKLQTRSLHGIVSEDDFVV-SEYLTTL 201          
BLAST of V-type proton ATPase subunit C vs. Planmine SMEST
Match: SMESG000061029.1 (SMESG000061029.1)

HSP 1 Score: 405.601 bits (1041), Expect = 2.561e-135
Identity = 194/198 (97.98%), Postives = 196/198 (98.99%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVDVLR 1982
            +V  +SYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVDVLR
Sbjct:  186 VVVAKSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVDVLR 383          

HSP 2 Score: 374.015 bits (959), Expect = 6.051e-123
Identity = 184/184 (100.00%), Postives = 184/184 (100.00%), Query Frame = 1
Query:   46 MEYWLISVPQQKKSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            MEYWLISVPQQKKSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL
Sbjct:    1 MEYWLISVPQQKKSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 184          
BLAST of V-type proton ATPase subunit C vs. Planmine SMEST
Match: SMESG000051728.1 (SMESG000051728.1)

HSP 1 Score: 180.644 bits (457), Expect = 4.553e-50
Identity = 95/200 (47.50%), Postives = 132/200 (66.00%), Query Frame = 3
Query: 1389 MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSDFIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVNFGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILGQAFSYLENTAMIQTNENEEFPG------LNLLAAGEYYPYVYYKLDTNFV 1970
            +V  + ++  WR+ Y  LT +VVPRSSELI EDNEHGL+ VTLF+ ++S F   AKE +FFVRDF Y+E + +E+R  ++ L ++KKK+F   FRWL   F  S   L+HIKS+RIFVESVLRYGLPVNFQSI++ P +   KK+   L + F +L+N  + Q +  +  P        NLL   EY+PYV  K++ N++
Sbjct:  185 VVVAKIHFQAWRSSYGKLTDFVVPRSSELIYEDNEHGLFTVTLFKRVASIFTTIAKEKKFFVRDFQYDETKTEENRLMLTNLRSEKKKEFINLFRWLTNKFKISIGYLLHIKSMRIFVESVLRYGLPVNFQSILVAPLRNQEKKVHLKLRKMFRHLDN-FISQFDRTDNSPDSDDDFVANLLGEPEYFPYVCCKVELNYL 383          

HSP 2 Score: 149.443 bits (376), Expect = 4.577e-39
Identity = 72/184 (39.13%), Postives = 132/184 (71.74%), Query Frame = 1
Query:   46 MEYWLISVPQQKKSQVFETIYDKLVRQNNLCEIYKYSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSRLTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGLKMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTL 597
            MEY +ISVP ++ + VF+ ++  L  +++L E+ K+SVP+  KVGT D L+ LS +L KLD F++ + RK+V +  EI+EE+K++L+ +L IN++  E  V K+ WD ++F +++ +E+ + +++D +++++   K+K++ Y ++K  ++ +ERK  G+LLTRN+ +LVK+++FV DSE  +TL
Sbjct:    1 MEYLIISVPNERGNNVFDKVHQYLSAKHHLGEVMKFSVPE-LKVGTFDNLMELSAKLLKLDNFTDVLIRKLVHFTNEIMEEEKTKLSTYLTINQEPYEKSVRKFHWDHSEFSSKEPIERSYLSINDKINEIDIEFKVKSKFYTKIKLDIENMERKNSGNLLTRNLADLVKRDNFVLDSENLITL 183          
The following BLAST results are available for this feature:
BLAST of V-type proton ATPase subunit C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V1C17.825e-6353.19ATPase H+ transporting V1 subunit C1 [Source:HGNC ... [more]
ATP6V1C17.825e-6353.19ATPase H+ transporting V1 subunit C1 [Source:HGNC ... [more]
ATP6V1C15.793e-6253.19ATPase H+ transporting V1 subunit C1 [Source:HGNC ... [more]
ATP6V1C15.793e-6253.19ATPase H+ transporting V1 subunit C1 [Source:HGNC ... [more]
ATP6V1C23.173e-5349.24ATPase H+ transporting V1 subunit C2 [Source:HGNC ... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vha-111.443e-5346.49V-type proton ATPase subunit C [Source:UniProtKB/... [more]
vha-112.220e-1951.61V-type proton ATPase subunit C [Source:UniProtKB/... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vha445.561e-5848.42gene:FBgn0262511 transcript:FBtr0087176[more]
Vha445.561e-5848.42gene:FBgn0262511 transcript:FBtr0087173[more]
Vha443.325e-5748.42gene:FBgn0262511 transcript:FBtr0087175[more]
Vha441.750e-5448.42gene:FBgn0262511 transcript:FBtr0290032[more]
Vha441.750e-5448.42gene:FBgn0262511 transcript:FBtr0290031[more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v1c1a4.111e-6453.06ATPase H+ transporting V1 subunit C1a [Source:NCBI... [more]
atp6v1c1a4.111e-6453.06ATPase H+ transporting V1 subunit C1a [Source:NCBI... [more]
atp6v1c1b2.362e-6351.02ATPase H+ transporting V1 subunit C1b [Source:NCBI... [more]
atp6v1c1b2.362e-6351.02ATPase H+ transporting V1 subunit C1b [Source:NCBI... [more]
atp6v1c22.681e-4544.10ATPase H+ transporting V1 subunit C2 [Source:ZFIN;... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atoh82.181e-6252.31atonal bHLH transcription factor 8 [Source:Xenbase... [more]
ttc281.056e-6150.51tetratricopeptide repeat domain 28 [Source:Xenbase... [more]
ttc281.439e-6150.51tetratricopeptide repeat domain 28 [Source:Xenbase... [more]
ttc284.508e-5645.91tetratricopeptide repeat domain 28 [Source:Xenbase... [more]
ttc285.222e-5645.91tetratricopeptide repeat domain 28 [Source:Xenbase... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp6v1c11.266e-6253.72ATPase, H+ transporting, lysosomal V1 subunit C1 [... [more]
Atp6v1c11.266e-6253.72ATPase, H+ transporting, lysosomal V1 subunit C1 [... [more]
Atp6v1c24.146e-5549.75ATPase, H+ transporting, lysosomal V1 subunit C2 [... [more]
Atp6v1c24.837e-4840.33ATPase, H+ transporting, lysosomal V1 subunit C2 [... [more]
Atp6v1c22.972e-4740.33ATPase, H+ transporting, lysosomal V1 subunit C2 [... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7T385|VTC1A_DANRE3.103e-6353.06V-type proton ATPase subunit C 1-A OS=Danio rerio ... [more]
sp|Q5XIY6|VTC1B_DANRE1.783e-6251.02V-type proton ATPase subunit C 1-B OS=Danio rerio ... [more]
sp|Q9Z1G3|VATC1_MOUSE8.856e-6253.72V-type proton ATPase subunit C 1 OS=Mus musculus O... [more]
sp|Q6P4Y9|VATC1_XENTR1.155e-6152.31V-type proton ATPase subunit C 1 OS=Xenopus tropic... [more]
sp|Q5XH14|VATC1_XENLA1.333e-6151.79V-type proton ATPase subunit C 1 OS=Xenopus laevis... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q1JRN01.522e-6554.87V-type proton ATPase subunit C OS=Anabas testudine... [more]
A0A0S7JKD92.791e-6554.36V-type proton ATPase subunit C OS=Poeciliopsis pro... [more]
A0A0R3WB903.849e-6555.38V-type proton ATPase subunit C OS=Taenia asiatica ... [more]
A0A4U5VJ931.694e-6454.36V-type proton ATPase subunit C OS=Collichthys luci... [more]
A0A0R3WQS64.162e-6455.10V-type proton ATPase subunit C OS=Hydatigena taeni... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atp6v1c1b2.392e-6553.33V-type proton ATPase subunit C 1-A [Source:NCBI ge... [more]
atp6v1c1a3.278e-6553.06ATPase H+ transporting V1 subunit C1a [Source:NCBI... [more]
atp6v1c21.181e-4443.81V-type proton ATPase subunit C 1-B-like [Source:NC... [more]
ENSAMXT00000056324.11.562e-1243.82pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atp6v1c1b2.128e-6451.79ATPase H+ transporting V1 subunit C1b [Source:NCBI... [more]
atp6v1c21.515e-5447.57ATPase H+ transporting V1 subunit C2 [Source:ZFIN;... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VMA58.320e-2536.81Subunit C of the V1 peripheral membrane domain of ... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO478156.290e-5849.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atp6v1c1a1.821e-6653.85ATPase H+ transporting V1 subunit C1 [Source:NCBI ... [more]
atp6v1c1b6.814e-6653.33V-type proton ATPase subunit C 1-A [Source:NCBI ge... [more]
atp6v1c23.030e-3638.27V-type proton ATPase subunit C 1-B-like [Source:NC... [more]
back to top
BLAST of V-type proton ATPase subunit C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000061029.12.561e-13597.98SMESG000061029.1[more]
SMESG000051728.14.553e-5047.50SMESG000051728.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026995 ID=SMED30026995|Name=V-type proton ATPase subunit C|organism=Schmidtea mediterranea sexual|type=transcript|length=2294bp
GAAATCTATTCAAATTTTATCAATAAAATTCGGAATTTTCATTTAATGGA
ATATTGGCTTATTTCAGTTCCTCAGCAAAAAAAGAGTCAAGTTTTTGAAA
CAATTTATGATAAGCTAGTGCGACAAAATAATCTTTGTGAAATATATAAG
TATTCCGTTCCTCAGGATTTTAAAGTTGGTACTTTAGATGTTCTAGTTAG
TTTGTCAGATGAACTGGCAAAGTTAGATATATTTTCGGAATCAGTTACCC
GTAAAATTGTGCAATATATGGGCGAGATATTGGAAGAACAAAAATCTCGA
TTAACTGATCATCTTAAAATTAATGAGGATTCCCTTGAAAATTTTGTAAC
TAAATATGTGTGGGATGCTGCGAAGTTTCCTACAAGACAATCTTTAGAAC
AAATATTTAGTAATCTATCTGATCATATGTCGAAGGTTGAAAATGGATTG
AAAATGAAAACTCAGTCTTATAATCAACTTAAAGGAAGTTTGCAGACTTT
GGAACGTAAGCAAATTGGGAGTTTATTAACAAGAAATATTGGTGAACTGG
TTAAAAAGGAGCATTTTGTTTCGGATTCTGAGTATTTTGTAACGCTTATT
GTTGTAGTGGCTAAGTAAATATTTTAATTTAAAAAAATAGTTGATTTAAA
AATGTTTGATAATATTTTAAAATCTAAATCAACCACTTTCAATTGAGAAT
AAAATCTGTTTTGATAATTCTGAATGAAGAAAAATTCAATTCAAACATGA
ATATCAGCATTCCCGTATTTTCCTAATTAACTCATCCTTATTCATAAATT
AGCAAGTAAATACCCCCCCCCATTATAACTAGTATGCAATTTTCTAATTT
TTTATCAATGTCGTTTCAATTATGATACATCCAAGATTTCTAACTCAAAT
TAAAGGAATAAATATGGAAACTGTTTCGAGCCATCGCACGTGTTATAGCC
GGCAGCTTTCTGGGTAAGGCTTGATGATAGGATAATTCTGAAGAGTTGCA
AACATAAAATAATTAAATTTGGATATGATAATGCTAACTTTTCATAGCTC
TTTTTATTTCATCGATTGCTGAAGGGTCTGACAATAAACGCCAAGGTGGC
TGTCTGGAGTATATGAGCCCCACATGGGGCTGGGAACACCTTGGCGCACC
TCTGGGCTCATCGGCTATCAATAGGCGGTCAGTGGCCACCCTTTACTTTG
CTCGGTTCGCTTTCTCTAGGCTTTCACTCATCCTTTTCTCTCAGGTTCAA
TTAAATCAGACCAGGAAATTGTACAATTTTATTAGGCCCGTTATATATTT
CCTTCCCGTACAGAATATGCTGAATCCCTACATTAATTGTCTCTGAATCT
AATTTATTATATGCTGAGCATGTCAATCTATTTACCATATGGTCTGTATT
AGAAGTTATTACAATTTGTGGCGGGCCAAGTACGAAACTCTCACTAAATA
TGTCGTGCCGAGATCGTCCGAATTAATTTGCGAAGACAACGAGCATGGTC
TGTGGAATGTCACGTTGTTCAGGAGCATTTCTAGTGACTTCATTGCTAAA
GCCAAAGAAAATCGATTTTTTGTTAGAGATTTCACTTATAATGAGAATGA
GATCCAAGAAAGCCGAAATGAAATATCGCGTTTGGAAAATGACAAAAAGA
AGCAATTTCAAGCAACTTTTCGATGGCTGAAAGTCAATTTCGGGGAGAGC
TTTATCGGCTTGATGCATATTAAATCACTGAGAATATTTGTGGAATCAGT
TCTCAGATACGGACTTCCGGTAAATTTTCAATCTATTATAATCCACCCTT
CAAAGAAAAACCATAAGAAGATTCGTGAAATATTGGGACAAGCGTTTAGT
TACTTGGAAAACACCGCTATGATTCAAACAAATGAAAACGAGGAGTTTCC
AGGCCTTAATTTGCTGGCCGCAGGAGAATATTATCCCTATGTTTATTATA
AGCTAGATACCAATTTTGTAGATGTGCTGCGTTGATTTGTGGAGTATAAT
TTGAGGTGACATGATTGCATAATATAGACAATTCTTTTCATGGAATAAAT
TTTATTATTTTGATTTTCAATTGCAATATTTGATTTTTGAAATGAGGCGG
CTTTCCCTTCGAGTATTTTTTTCTGTAAATTAAAATTTTGTCAATGAAAT
GTTTATCGGAGCATATAAAGAAATTATCGTGATATGCATGTCAAAGTTCA
AATAACGGTTTTTAGCACACTTTGACTGGAAATTCAATTGATTTTAAAAT
TTTGAAGTTATCTGTCAAAATGTTTGTCGATTGCACAAGATTGT
back to top

protein sequence of SMED30026995-orf-1

>SMED30026995-orf-1 ID=SMED30026995-orf-1|Name=SMED30026995-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=206bp
EIYSNFINKIRNFHLMEYWLISVPQQKKSQVFETIYDKLVRQNNLCEIYK
YSVPQDFKVGTLDVLVSLSDELAKLDIFSESVTRKIVQYMGEILEEQKSR
LTDHLKINEDSLENFVTKYVWDAAKFPTRQSLEQIFSNLSDHMSKVENGL
KMKTQSYNQLKGSLQTLERKQIGSLLTRNIGELVKKEHFVSDSEYFVTLI
VVVAK*
back to top

protein sequence of SMED30026995-orf-2

>SMED30026995-orf-2 ID=SMED30026995-orf-2|Name=SMED30026995-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=199bp
MVCIRSYYNLWRAKYETLTKYVVPRSSELICEDNEHGLWNVTLFRSISSD
FIAKAKENRFFVRDFTYNENEIQESRNEISRLENDKKKQFQATFRWLKVN
FGESFIGLMHIKSLRIFVESVLRYGLPVNFQSIIIHPSKKNHKKIREILG
QAFSYLENTAMIQTNENEEFPGLNLLAAGEYYPYVYYKLDTNFVDVLR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0015991ATP hydrolysis coupled proton transport
GO:0006810transport
GO:0006811ion transport
GO:0015992proton transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036132Vac_ATP_synth_c_sf
IPR004907ATPase_V1-cplx_csu
Vocabulary: molecular function
TermDefinition
GO:0015078hydrogen ion transmembrane transporter activity
GO:0008553hydrogen-exporting ATPase activity, phosphorylative mechanism
GO:0046961proton-transporting ATPase activity, rotational mechanism
Vocabulary: cellular component
TermDefinition
GO:0033180proton-transporting V-type ATPase, V1 domain
GO:0000221vacuolar proton-transporting V-type ATPase, V1 domain
GO:0005765lysosomal membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 150..170
NoneNo IPR availableGENE3DG3DSA:1.20.1460.10coord: 53..205
e-value: 1.1E-39
score: 138.6
IPR004907ATPase, V1 complex, subunit CPFAMPF03223V-ATPase_Ccoord: 18..205
e-value: 1.4E-61
score: 209.0
IPR004907ATPase, V1 complex, subunit CPANTHERPTHR10137V-TYPE PROTON ATPASE SUBUNIT Ccoord: 16..205
IPR004907ATPase, V1 complex, subunit CCDDcd14785V-ATPase_Ccoord: 18..205
e-value: 8.14548E-66
score: 204.774
IPR036132Vacuolar ATP synthase subunit C superfamilySUPERFAMILYSSF118203Vacuolar ATP synthase subunit Ccoord: 17..205