GCR104

Overview
NameGCR104
Smed IDSMED30026993
Length (bp)2668
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR104 (SMED30026993) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR104 (SMED30026993) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR104 (SMED30026993) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR104 (SMED30026993) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026993

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30026993SMESG000018211.1 dd_Smed_v4_6153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30026993SMESG000018211.1 dd_Smed_v4_6153_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30026993SMESG000018211.1 GCR104smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30026993SMESG000018212.1 Contig4367_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR104 vs. Ensembl Human
Match: WBP2NL (WBP2 N-terminal like [Source:HGNC Symbol;Acc:HGNC:28389])

HSP 1 Score: 68.1662 bits (165), Expect = 1.561e-11
Identity = 45/141 (31.91%), Postives = 75/141 (53.19%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSN-LLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAA 1944
            M++N SH  +  G +I NGE  L   P++EL      +   ++  G   G L+LT++R+IFIT  + S+ +LS  MP   + NL + + +     + G I+A P G + G+  F  +F+ G  +EF    A L +++  AA
Sbjct:    1 MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSE-GSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEF----AQLMVKAASAA 136          
BLAST of GCR104 vs. Ensembl Human
Match: WBP2NL (WBP2 N-terminal like [Source:HGNC Symbol;Acc:HGNC:28389])

HSP 1 Score: 68.1662 bits (165), Expect = 1.561e-11
Identity = 45/141 (31.91%), Postives = 75/141 (53.19%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSN-LLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAA 1944
            M++N SH  +  G +I NGE  L   P++EL      +   ++  G   G L+LT++R+IFIT  + S+ +LS  MP   + NL + + +     + G I+A P G + G+  F  +F+ G  +EF    A L +++  AA
Sbjct:    1 MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSE-GSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEF----AQLMVKAASAA 136          
BLAST of GCR104 vs. Ensembl Human
Match: WBP2NL (WBP2 N-terminal like [Source:HGNC Symbol;Acc:HGNC:28389])

HSP 1 Score: 68.1662 bits (165), Expect = 1.561e-11
Identity = 45/141 (31.91%), Postives = 75/141 (53.19%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSN-LLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAA 1944
            M++N SH  +  G +I NGE  L   P++EL      +   ++  G   G L+LT++R+IFIT  + S+ +LS  MP   + NL + + +     + G I+A P G + G+  F  +F+ G  +EF    A L +++  AA
Sbjct:    1 MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSE-GSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEF----AQLMVKAASAA 136          
BLAST of GCR104 vs. Ensembl Human
Match: WBP2NL (WBP2 N-terminal like [Source:HGNC Symbol;Acc:HGNC:28389])

HSP 1 Score: 67.0106 bits (162), Expect = 2.215e-11
Identity = 41/130 (31.54%), Postives = 70/130 (53.85%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSN-LLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEAL 1911
            M++N SH  +  G +I NGE  L   P++EL      +   ++  G   G L+LT++R+IFIT  + S+ +LS  MP   + NL + + +     + G I+A P G + G+  F  +F+ G  +EF + +
Sbjct:    1 MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSE-GSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEFAQLM 129          
BLAST of GCR104 vs. Ensembl Human
Match: WBP2 (WW domain binding protein 2 [Source:HGNC Symbol;Acc:HGNC:12738])

HSP 1 Score: 56.6102 bits (135), Expect = 4.595e-8
Identity = 42/156 (26.92%), Postives = 78/156 (50.00%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKP-GALFTSHFPN 1989
            M++N +H  +G GVI+ N E  L+    +EL  +       + + G   G +YLT +R+IF+++  K  + S  MP   + + ++ + +     + G ++AE  G + G   +   F  GG +EF + +  +   + QA+R   P GA   S+ P+
Sbjct:    1 MALNKNH-SEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFK-GTKKGTVYLTPYRVIFLSKG-KDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQV---ASQASRGEVPSGAYGYSYMPS 150          
BLAST of GCR104 vs. Ensembl Celegans
Match: C18B2.4 (pep chromosome:WBcel235:X:3604291:3605741:-1 gene:WBGene00015955.1 transcript:C18B2.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C18B2.4)

HSP 1 Score: 98.2117 bits (243), Expect = 3.298e-22
Identity = 85/276 (30.80%), Postives = 126/276 (45.65%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKPGALFTSHFPN------RPLYAAPQKVYL-----DVFKDPQFKFVRKHVAFVYPQKNQIYMHRELVPYPGF----------FECVSTVNSLNL-AVPLEPDPRGLSKAYRNPTIYNTYWTPCTKPVRPGFTC 2286
            MS+NTSH  DG G++I+NGE  LLY  +++LK +   +YN    +    G LYLT+HR+IF+  + K    S  MP   + ++K+ + L     L G ++  P GNF G   +   F +GG +EF EAL    +R+   A   +P A   ++  N         YAAP   YL       F+ P   F  +      P    +Y++    PYPG           F+ V TV   N+ A P +P         + P  Y+ Y  P  +P + GF  
Sbjct:    1 MSLNTSHTPDGQGILIYNGEMILLYTTNVKLKFE---KYNVPAFKSTKSGALYLTSHRIIFMNESKKDEFKSFAMPFNSVRDVKLEQPLLTPNYLKGWVQPMPGGNFDGCPEWRLSFPKGGCIEFGEAL----LRAADMASRARPFAAPPAYGGNMQQQSGTTYYAAPPTYYLVQGTYQGFQAPTNVFPER------PPAQNVYVYDMPPPYPGIGQTTPYPAGQFQPVGTVQYQNVGAYPGQP---------QQPGQYHPY--PTNQPPQGGFNV 252          
BLAST of GCR104 vs. Ensembl Celegans
Match: D2013.6 (pep chromosome:WBcel235:II:9329757:9331510:1 gene:WBGene00008404.1 transcript:D2013.6.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2013.6)

HSP 1 Score: 70.0922 bits (170), Expect = 3.948e-13
Identity = 56/205 (27.32%), Postives = 92/205 (44.88%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKPGALFTSHFPNRPLYAAPQKVYLDVFKDPQFKFVRKHVAFV-YPQKNQIYMHRELVPYPGF 2136
            MSINT++  DG+GV+++NGE  +++   + + L  S   N    EG   G +YLT+HR+IF+  +    L S  +P   + ++ + + +     L G   A   G   G + +   F +GG +EF ++L     R   A R+    A      P    Y+AP   Y          F     +F   P  ++++M     PYPG 
Sbjct:    1 MSINTANTPDGLGVLLYNGETIVIFAQGVVMTLGTSENENL---EGRRTGTIYLTSHRIIFMP-DPGDWLKSFEIPFNSMQDVNLNQPIFGANYLCGIASAVQGGQMRGEVKWRMTFNRGGCIEFGQSLLQAVER---AVRMRPENAPPAYSPPIGDFYSAPPAYYQPSPDQGPNGFNPTTDSFPDQPNPSRVFMSSAPPPYPGI 198          
BLAST of GCR104 vs. Ensembl Celegans
Match: D2013.6 (pep chromosome:WBcel235:II:9329774:9331510:1 gene:WBGene00008404.1 transcript:D2013.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2013.6)

HSP 1 Score: 70.0922 bits (170), Expect = 3.948e-13
Identity = 56/205 (27.32%), Postives = 92/205 (44.88%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKPGALFTSHFPNRPLYAAPQKVYLDVFKDPQFKFVRKHVAFV-YPQKNQIYMHRELVPYPGF 2136
            MSINT++  DG+GV+++NGE  +++   + + L  S   N    EG   G +YLT+HR+IF+  +    L S  +P   + ++ + + +     L G   A   G   G + +   F +GG +EF ++L     R   A R+    A      P    Y+AP   Y          F     +F   P  ++++M     PYPG 
Sbjct:    1 MSINTANTPDGLGVLLYNGETIVIFAQGVVMTLGTSENENL---EGRRTGTIYLTSHRIIFMP-DPGDWLKSFEIPFNSMQDVNLNQPIFGANYLCGIASAVQGGQMRGEVKWRMTFNRGGCIEFGQSLLQAVER---AVRMRPENAPPAYSPPIGDFYSAPPAYYQPSPDQGPNGFNPTTDSFPDQPNPSRVFMSSAPPPYPGI 198          
BLAST of GCR104 vs. Ensembl Celegans
Match: B0334.6 (pep chromosome:WBcel235:II:11510673:11513890:1 gene:WBGene00007146.1 transcript:B0334.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0334.6)

HSP 1 Score: 51.2174 bits (121), Expect = 2.549e-6
Identity = 81/334 (24.25%), Postives = 137/334 (41.02%), Query Frame = 2
Query:  206 VMWVMAIFMPPVVIFGLLGNSLSFIIL--KDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLIS--------NERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITXXXXXXXXXXXXXDWIFSFEKVLCKKYN----LYVCKPKQN---MLKFRILEMLML---SVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPK----------NKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFT--------LNFAINFVLYCFIGHNFR 1093
            V W     +P + + GL  N L+  +L    ++R++ S+  +  L + DSL LI      + TL + P+ I         N  Y  I   I    +   K+         S+  +V F +ER +CV  P+ S + CT RN+K  +   +++S L SI W  +++ + C + N     YV     N    + +R ++ + L   +V+P + ++  N  I+ TLR+        YEE K          +  R  +    L AV         PQ  + I+   + Q              YH   +L+         LN ++NF LYC +   +R
Sbjct:   41 VWWSNVAVLPVIALIGLACNLLNMAVLTSNKTARRIPSWNLLIALAVCDSLFLI------FATLDVTPLSIPSLAFSTSFNHFYSRIVLYIRTLASTFYKS---------SVLIVVAFNIERYLCVVCPLNSHRWCTSRNSKNAIATAIVLSFLCSIQWPLAYDTIRCFESNSNQYYYVILMSTNRALQIYYRTMDYVSLFAFNVLPIIGLLYMNSRIIFTLRRVVDEDSRKYEETKLSDGLIQHDAHNNRTMRANAMLFAVVFMLFFCVGPQAPARILFDMYGQ--------------YHPKAILYVCLSQQLVFLNASLNFCLYCVVSKRYR 345          
BLAST of GCR104 vs. Ensembl Fly
Match: Wbp2 (gene:FBgn0036318 transcript:FBtr0332047)

HSP 1 Score: 83.5741 bits (205), Expect = 7.294e-18
Identity = 62/207 (29.95%), Postives = 108/207 (52.17%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAA--RLWKPGALFTSHFPNRPLYAAPQKVYLDVFKDPQFK-FVRKHVAFVYPQKNQIYMHRELVPYPGF 2136
            MS+NT+H  +G  V+I  GE  LL+  S+ +  ++S Q N  + +G   G +YLT+HRMIF ++ +  ++ S + P V L ++++ + +     + G++ A+PNGN+ G + F   F+ GG +E+ +AL    +RS + A     + G       P +P  +  +         P +  ++ +H AF  P  N +YM     PYPG 
Sbjct:    1 MSVNTAHANNG--VLIHAGEYILLHSDSVSM--EFSGQDN-PIFKGSKGGRIYLTSHRMIFNSKKSSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQAL----LRSAKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSGPAPNTVYMSDNPPPYPGI 198          
BLAST of GCR104 vs. Ensembl Fly
Match: Wbp2 (gene:FBgn0036318 transcript:FBtr0332045)

HSP 1 Score: 82.8037 bits (203), Expect = 2.129e-17
Identity = 62/206 (30.10%), Postives = 108/206 (52.43%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAA--RLWKPGALFTSHFPNRPLYAAPQKVYLDVFKDPQFK-FVRKHVAFVYPQKNQIYMHRELVPYPG 2133
            MS+NT+H  +G  V+I  GE  LL+  S+ +  ++S Q N  + +G   G +YLT+HRMIF ++ +  ++ S + P V L ++++ + +     + G++ A+PNGN+ G + F   F+ GG +E+ +AL    +RS + A     + G       P +P  +  +         P +  ++ +H AF  P  N +YM     PYPG
Sbjct:    1 MSVNTAHANNG--VLIHAGEYILLHSDSVSM--EFSGQDN-PIFKGSKGGRIYLTSHRMIFNSKKSSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQAL----LRSAKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSGPAPNTVYMSDNPPPYPG 197          
BLAST of GCR104 vs. Ensembl Fly
Match: Wbp2 (gene:FBgn0036318 transcript:FBtr0332048)

HSP 1 Score: 78.9518 bits (193), Expect = 2.320e-15
Identity = 47/140 (33.57%), Postives = 84/140 (60.00%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAA 1944
            MS+NT+H  +G  V+I  GE  LL+  S+ +  ++S Q N  + +G   G +YLT+HRMIF ++ +  ++ S + P V L ++++ + +     + G++ A+PNGN+ G + F   F+ GG +E+ +AL    +RS + A
Sbjct:    1 MSVNTAHANNG--VLIHAGEYILLHSDSVSM--EFSGQDN-PIFKGSKGGRIYLTSHRMIFNSKKSSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQAL----LRSAKTA 131          
BLAST of GCR104 vs. Ensembl Fly
Match: Wbp2 (gene:FBgn0036318 transcript:FBtr0273240)

HSP 1 Score: 78.5666 bits (192), Expect = 3.226e-15
Identity = 47/140 (33.57%), Postives = 84/140 (60.00%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAA 1944
            MS+NT+H  +G  V+I  GE  LL+  S+ +  ++S Q N  + +G   G +YLT+HRMIF ++ +  ++ S + P V L ++++ + +     + G++ A+PNGN+ G + F   F+ GG +E+ +AL    +RS + A
Sbjct:    1 MSVNTAHANNG--VLIHAGEYILLHSDSVSM--EFSGQDN-PIFKGSKGGRIYLTSHRMIFNSKKSSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQAL----LRSAKTA 131          
BLAST of GCR104 vs. Ensembl Fly
Match: Wbp2 (gene:FBgn0036318 transcript:FBtr0273241)

HSP 1 Score: 78.5666 bits (192), Expect = 3.226e-15
Identity = 47/140 (33.57%), Postives = 84/140 (60.00%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAA 1944
            MS+NT+H  +G  V+I  GE  LL+  S+ +  ++S Q N  + +G   G +YLT+HRMIF ++ +  ++ S + P V L ++++ + +     + G++ A+PNGN+ G + F   F+ GG +E+ +AL    +RS + A
Sbjct:    1 MSVNTAHANNG--VLIHAGEYILLHSDSVSM--EFSGQDN-PIFKGSKGGRIYLTSHRMIFNSKKSSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQAL----LRSAKTA 131          
BLAST of GCR104 vs. Ensembl Zebrafish
Match: wbp2nl (WBP2 N-terminal like [Source:ZFIN;Acc:ZDB-GENE-030131-4012])

HSP 1 Score: 59.3066 bits (142), Expect = 3.709e-9
Identity = 39/139 (28.06%), Postives = 66/139 (47.48%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQA 1941
            M++N +H  +G GV+I  GE  L    ++EL     V     L +G   G +YLT +R++F++   K    S   P+  + N  + + +     + G I+AE  G + G+  F   F  GG +E  + L  L   + +A
Sbjct:    1 MALNRNHHPNG-GVLIQAGESILRECKNVELSFS-DVTPKNDLFKGTKKGSVYLTQYRLVFVSSVMKEKFCSFMFPYYLMKNCSIEQPVFSANFIQGLIKAEAGGGWEGQAGFKLSFPSGGAIELGQHLFKLATNASRA 137          
BLAST of GCR104 vs. Ensembl Zebrafish
Match: gpr142 (G protein-coupled receptor 142 [Source:ZFIN;Acc:ZDB-GENE-130603-30])

HSP 1 Score: 56.225 bits (134), Expect = 1.028e-7
Identity = 84/322 (26.09%), Postives = 141/322 (43.79%), Query Frame = 2
Query:  314 FFYIRCLTIFDSLS-LILTMLGFYM-TLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAK--ITXXXXXXXXXXXXXDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPKN---KKRDNKITIQLLAVSTTFTLLTIPQCISVI----INTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCR---------FRQMRQLRRAIFETVSNDTR-HTTVSKLSTKR 1216
            + Y+  LT  D LS L +  +GF + T V H         R++  ++      ++ + + FS    SIW  V  T++R V +  P++  ++     A+  I VV+ + ++      W     +V  +  NL                + ++  +P  I +V N +I+L LR+R+R  +   E  +      R  K T  LLAV++ F +L  P+   V+    + + H   ++      HLA  Y L  +L  LN A+NF LYCF+   FR A  +++L R          R  R    A   ++S+  R    V+ LS KR
Sbjct:   65 YVYLLALTGSDILSQLFIIFVGFLLETAVFH---------RDVPVLL-----LRSVSMMEFSANHASIWATVPLTVDRYVALCHPLLHRQISYPARARRIIAVVLTLALASGVPFFWWSDMWRVSHEPNNLDTA--------LIWTHVTIIYFLPCCIFLVLNSLIILRLRKRQRQQMCQDESGQQLAVPSRLGKTTAMLLAVTSVFAVLWAPRTGVVLYHLYVTSVHNDWRV------HLA--YDLANMLAMLNTAVNFFLYCFVSKPFRAAVRDVLLFRGAPLHPRRPLRNQRTPANASTSSISSTKRSQREVTPLSPKR 356          
BLAST of GCR104 vs. Ensembl Zebrafish
Match: wbp2 (WW domain binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-050522-137])

HSP 1 Score: 53.5286 bits (127), Expect = 4.308e-7
Identity = 38/139 (27.34%), Postives = 67/139 (48.20%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQA 1941
            M++N +H   G  VII N E  L+   ++EL    S +   +  +    G +YLT +R+IF+T+  K  L S  MP   +   ++ + +     + G + AE  G + G   F  IF  GG +EF + +  +  ++ + 
Sbjct:    1 MALNKNHDESGR-VIINNFEGVLMSYENVELVFSDSERLPDAFRKSK-KGSIYLTPYRVIFLTKG-KDPLQSFMMPFYLMKGCEVKQPVLGANYIKGTVGAESGGGWEGSATFKLIFSAGGAIEFGQRMLHVAEQASRG 136          
BLAST of GCR104 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 family 3 subfamily A member 5 [Source:Xenbase;Acc:XB-GENE-5821575])

HSP 1 Score: 71.633 bits (174), Expect = 6.798e-13
Identity = 44/149 (29.53%), Postives = 75/149 (50.34%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKPGALF 1971
            MS+N +H  +G G+I+ NGE  L     +EL      Q + + + G   G L+LT +R+IF+++  K  ++S NMP   +    + + +     + G I AEP G + G+  F   F  GG +EF + +    M +C +     P A++
Sbjct:    1 MSLNKNH-SEGAGIIVSNGESVLRQCKDVELSFSDMSQKSEAFK-GTKKGSLFLTPYRVIFLSKG-KDPMMSFNMPFYLMKGCSIEQPVFSANYIKGSIGAEPEGGWVGQASFKLTFNSGGAIEFGQVM--FKMATCASRAPPVPHAVY 144          
BLAST of GCR104 vs. Ensembl Mouse
Match: Wbp2nl (WBP2 N-terminal like [Source:MGI Symbol;Acc:MGI:1921966])

HSP 1 Score: 60.8474 bits (146), Expect = 3.659e-9
Identity = 39/143 (27.27%), Postives = 70/143 (48.95%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFIT-RNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARL 1950
            M++N +H  D     I +GE  L     ++L    S     +L  G   G L+LT++R+IF+T R +   + S  MP   ++N  + + +     + G I+A P+G + G   F  +F++GG ++F + +A     + Q   L
Sbjct:    1 MAVNQNHTVDRRWAAIPHGESLLKKCSEVDLSFPQSPP-GSNLFSGTKRGALFLTSYRVIFVTSRADNDPMFSFTMPFHLMNNCTVEQPIFGANYIKGTIQAAPDGGWEGSATFKIVFRKGGAIDFAQLMAKAASAAAQGVPL 142          
BLAST of GCR104 vs. Ensembl Mouse
Match: Wbp2 (WW domain binding protein 2 [Source:MGI Symbol;Acc:MGI:104709])

HSP 1 Score: 53.5286 bits (127), Expect = 3.413e-7
Identity = 38/149 (25.50%), Postives = 73/149 (48.99%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKPGALF 1971
            M++N +H  +G GVI+ N E  L+    +EL  +       + + G   G +YLT +R+IF+++  K  + S  MP   + + ++ + +     + G ++AE  G + G   +   F  GG +EF + +  +   + QA+R   P   +
Sbjct:    1 MALNKNH-SEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFK-GTKKGTVYLTPYRVIFLSKG-KDAMQSFMMPFYLMKDCEIKQPVFGANFIKGIVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQV---ASQASRGEVPNGAY 143          
BLAST of GCR104 vs. Ensembl Mouse
Match: Wbp2 (WW domain binding protein 2 [Source:MGI Symbol;Acc:MGI:104709])

HSP 1 Score: 51.9878 bits (123), Expect = 7.639e-7
Identity = 38/140 (27.14%), Postives = 67/140 (47.86%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAA 1944
            M++N +H  +G GVI+ N E  L+    +EL  +       + + G   G +YLT +R+IF+++  K  + S  MP   + + ++ + +     + G ++AE  G + G   +   F  GG +EF       G R  Q A
Sbjct:    1 MALNKNH-SEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFK-GTKKGTVYLTPYRVIFLSKG-KDAMQSFMMPFYLMKDCEIKQPVFGANFIKGIVKAEAGGGWEGSASYKLTFTAGGAIEF-------GQRMLQVA 130          
BLAST of GCR104 vs. UniProt/SwissProt
Match: sp|Q6ICG8|WBP2L_HUMAN (Postacrosomal sheath WW domain-binding protein OS=Homo sapiens OX=9606 GN=WBP2NL PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.497e-11
Identity = 45/141 (31.91%), Postives = 75/141 (53.19%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSN-LLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAA 1944
            M++N SH  +  G +I NGE  L   P++EL      +   ++  G   G L+LT++R+IFIT  + S+ +LS  MP   + NL + + +     + G I+A P G + G+  F  +F+ G  +EF    A L +++  AA
Sbjct:    1 MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSE-GSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEF----AQLMVKAASAA 136          
BLAST of GCR104 vs. UniProt/SwissProt
Match: sp|Q4R3M1|WBP2L_MACFA (Postacrosomal sheath WW domain-binding protein OS=Macaca fascicularis OX=9541 GN=WBP2NL PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.386e-11
Identity = 43/129 (33.33%), Postives = 72/129 (55.81%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRS-LEEGYYPGGLYLTTHRMIFITRNNKSN-LLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYE 1905
            M++N SH  +  GV+I NGE   L   S+ ++L +  Q   S +  G   G L+LT++R+IFIT ++ +  +LS  MP   + NL + + +     + G I+A P G + G+  F  +F+ GG +EF +
Sbjct:    1 MAVNQSHTENRRGVLIPNGES--LLKQSLNVELSFPRQSEGSNVFNGTKTGTLFLTSYRVIFITSHSINGPMLSFMMPFDLITNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQ 127          
BLAST of GCR104 vs. UniProt/SwissProt
Match: sp|Q9D529|WBP2L_MOUSE (Postacrosomal sheath WW domain-binding protein OS=Mus musculus OX=10090 GN=Wbp2nl PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.560e-8
Identity = 39/143 (27.27%), Postives = 70/143 (48.95%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFIT-RNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARL 1950
            M++N +H  D     I +GE  L     ++L    S     +L  G   G L+LT++R+IF+T R +   + S  MP   ++N  + + +     + G I+A P+G + G   F  +F++GG ++F + +A     + Q   L
Sbjct:    1 MAVNQNHTVDRRWAAIPHGESLLKKCSEVDLSFPQSPP-GSNLFSGTKRGALFLTSYRVIFVTSRADNDPMFSFTMPFHLMNNCTVEQPIFGANYIKGTIQAAPDGGWEGSATFKIVFRKGGAIDFAQLMAKAASAAAQGVPL 142          
BLAST of GCR104 vs. UniProt/SwissProt
Match: sp|Q969T9|WBP2_HUMAN (WW domain-binding protein 2 OS=Homo sapiens OX=9606 GN=WBP2 PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 2.300e-7
Identity = 42/156 (26.92%), Postives = 78/156 (50.00%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKP-GALFTSHFPN 1989
            M++N +H  +G GVI+ N E  L+    +EL  +       + + G   G +YLT +R+IF+++  K  + S  MP   + + ++ + +     + G ++AE  G + G   +   F  GG +EF + +  +   + QA+R   P GA   S+ P+
Sbjct:    1 MALNKNH-SEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFK-GTKKGTVYLTPYRVIFLSKG-KDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQV---ASQASRGEVPSGAYGYSYMPS 150          
BLAST of GCR104 vs. UniProt/SwissProt
Match: sp|A3KFF6|WBP2L_BOVIN (Postacrosomal sheath WW domain-binding protein OS=Bos taurus OX=9913 GN=WBP2NL PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 7.897e-7
Identity = 42/147 (28.57%), Postives = 74/147 (50.34%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELK-LDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSN-LLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKP 1959
            M++N SH     G +I +GE  L     ++L  L   V+    L  G   G L+LT++R++F+T +  ++ +LS  MP   + +  + + +     + G I+A P G + G+  F   F++GG +EF    A L +++  AA    P
Sbjct:    1 MAVNQSHTESRRGALIPSGESVLKQCEDVDLCFLQKPVE--SYLFNGTKKGTLFLTSYRVVFVTSHLVNDPMLSFMMPFGLMSDCTIEQPIFAPNYIKGTIQAAPGGGWEGQAVFKLSFRKGGAIEF----AQLMVKAASAAARGIP 141          
BLAST of GCR104 vs. TrEMBL
Match: A0A193KUB9 (GCR104 OS=Schmidtea mediterranea OX=79327 GN=gcr104 PE=2 SV=1)

HSP 1 Score: 734.947 bits (1896), Expect = 0.000e+0
Identity = 385/385 (100.00%), Postives = 385/385 (100.00%), Query Frame = 2
Query:  158 MSNCSDKIFSPIGTNCVMWVMAIFMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITXXXXXXXXXXXXXDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI 1312
            MSNCSDKIFSPIGTNCVMWVMAIFMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITVVILVIVSLLSSIDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALIIIVSNIIIVLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI
Sbjct:    1 MSNCSDKIFSPIGTNCVMWVMAIFMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITVVILVIVSLLSSIDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALIIIVSNIIIVLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI 385          
BLAST of GCR104 vs. TrEMBL
Match: A0A1I8I6Q0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.183e-43
Identity = 111/306 (36.27%), Postives = 183/306 (59.80%), Query Frame = 2
Query:  230 MPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQT---KTYLAFSCRTMSIWTIVVFTLERLVCVKFPI-ISMKVCTIRNAKITXXXXXXXXXXXXXDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQM 1135
            +P + I G++GN+ SFIILK+S+ +VSS FY+ CL+I DSL+L+  +   ++  VI P        +  +++ +    CQ    + Y++F CR +S+WT+V+ ++ER + V  P+    ++CT+RN    +  LV+++   SI  +F FE    +KY    C+P  +     IL  ++ S+VP ++I +SN ++VL LR+R R S  +  + K  +++N IT +LL VS TF  LT+P  I+  IN+ +E   L  ++ G +A+ + ++F+LFT NFA NF LYC  G NFR AA+ ++ C    M
Sbjct:   40 IPIIAILGVIGNTCSFIILKESATRVSSHFYLCCLSILDSLTLVSIVFSIWLA-VIMPGYYYVLYGQVAAWLRSVTSNCQVSQFRVYISFYCRMVSVWTVVILSVERCISVSSPLRWGTRLCTVRNGVWAIGGLVLLAAPFSIYAVFGFE--YSEKYR--TCRPNDHFFIGNILSNVLFSIVPWIVICISNSVLVLVLRKRNRRS--SQMDQKTLRQENSITTRLLVVSVTFLFLTLPLAITSAINSYYELQDLRTHKTGIVADLWMVSFVLFTANFASNFWLYCLTGRNFRRAAVALLTCHLDSM 338          
BLAST of GCR104 vs. TrEMBL
Match: A0A267EIX8 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001026g1 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.462e-42
Identity = 111/307 (36.16%), Postives = 183/307 (59.61%), Query Frame = 2
Query:  227 FMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQT---KTYLAFSCRTMSIWTIVVFTLERLVCVKFPI-ISMKVCTIRNAKITXXXXXXXXXXXXXDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQM 1135
             +P + I G++GN+ SFIILK+S+ +VSS FY+ CL+I DSL+L+  +   ++  VI P        +  +++ +    CQ    + Y++F CR +S+WT+V+ ++ER + V  P+    ++CT+RN    +  LV+++   SI  +F FE    +KY    C+P  +     IL  ++ S+VP ++I +SN ++VL LR+R R S  +  + K  +++N IT +LL VS TF  LT+P  I+  IN+ +E   L  ++ G +A+ + ++F+LFT NFA NF LYC  G NFR AA+ ++ C    M
Sbjct:   55 LIPIIAILGVIGNTCSFIILKESATRVSSHFYLCCLSILDSLTLVSIVFSIWLA-VIMPGYYYVLYGQVAAWLRSVTSNCQVSQFRVYISFYCRMVSVWTVVILSVERCISVSSPLRWGTRLCTVRNGVWAIGGLVLLAAPFSIYAVFGFE--YSEKYR--TCRPNDHFFIGNILSNVLFSIVPWIVICISNSVLVLVLRKRNRRS--SQMDQKTLRQENSITTRLLVVSVTFLFLTLPLAITSAINSYYELQDLRTHKTGIVADLWMVSFVLFTANFASNFWLYCLTGRNFRRAAVALLTCHLDSM 354          
BLAST of GCR104 vs. TrEMBL
Match: A0A1I8GTM1 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.659e-41
Identity = 110/306 (35.95%), Postives = 183/306 (59.80%), Query Frame = 2
Query:  230 MPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQT---KTYLAFSCRTMSIWTIVVFTLERLVCVKFPI-ISMKVCTIRNAKITXXXXXXXXXXXXXDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQM 1135
            +P + I G++GN+ SFIILK+S+ +VSS FY+ CL+I DSL+L+  +   ++  VI P        +  +++ +    CQ    + Y++F CR +S+WT+V+ ++ER + V  P+    ++CT+RN    +  LV+++   SI  +F FE    +KY    C+P  +     IL  ++ S+VP ++I +SN+++VL LR+R R S  +  + K  +++N IT +LL VS TF  LT+P  I+  IN+ +E   L  ++ G +A+ + ++F+LFT NFA NF LYC  G NFR AA+ ++      M
Sbjct:   40 IPIIAILGVIGNTCSFIILKESATRVSSHFYLCCLSILDSLTLVSIVFSIWLA-VIMPGYYYVLYGQVAAWLRSVTSNCQVSQFRVYISFYCRMVSVWTVVILSVERCISVSSPLRWGTRLCTVRNGVWAIGGLVLLAAPFSIYAVFGFE--YSEKYR--TCRPNDHFFIGNILSNVLFSIVPWIVICISNLVLVLVLRKRNRRS--SQMDQKTLRQENSITTRLLVVSVTFLFLTLPLAITSAINSYYELQDLRTHKTGIVADLWMVSFVLFTANFASNFWLYCLTGRNFRRAAVALLTWHLDSM 338          
BLAST of GCR104 vs. TrEMBL
Match: A0A267DP97 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031474g1 PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 3.529e-41
Identity = 110/307 (35.83%), Postives = 183/307 (59.61%), Query Frame = 2
Query:  227 FMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQT---KTYLAFSCRTMSIWTIVVFTLERLVCVKFPI-ISMKVCTIRNAKITXXXXXXXXXXXXXDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQM 1135
             +P + I G++GN+ SFIILK+S+ +VSS FY+ CL+I DSL+L+  +   ++  VI P        +  +++ +    CQ    + Y++F CR +S+WT+V+ ++ER + V  P+    ++CT+RN    +  LV+++   SI  +F FE    +KY    C+P  +     IL  ++ S+VP ++I +SN+++VL LR+R R S  +  + K  +++N IT +LL VS TF  LT+P  I+  IN+ +E   L  ++ G +A+ + ++F+LFT NFA NF LYC  G NFR AA+ ++      M
Sbjct:   50 LIPIIAILGVIGNTCSFIILKESATRVSSHFYLCCLSILDSLTLVSIVFSIWLA-VIMPGYYYVLYGQVAAWLRSVTSNCQVSQFRVYISFYCRMVSVWTVVILSVERCISVSSPLRWGTRLCTVRNGVWAIGGLVLLAAPFSIYAVFGFE--YSEKYR--TCRPNDHFFIGNILSNVLFSIVPWIVICISNLVLVLVLRKRNRRS--SQMDQKTLRQENSITTRLLVVSVTFLFLTLPLAITSAINSYYELQDLRTHKTGIVADLWMVSFVLFTANFASNFWLYCLTGRNFRRAAVALLTWHLDSM 349          
BLAST of GCR104 vs. Ensembl Cavefish
Match: wbp2nl (WW domain-binding protein 2 [Source:NCBI gene;Acc:103035995])

HSP 1 Score: 67.781 bits (164), Expect = 5.666e-12
Identity = 41/139 (29.50%), Postives = 67/139 (48.20%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQA 1941
            M++N +H   G G +I N E  L    ++EL     V +     +G   G +YLT +RM+F++ N K  L S   P+  + N  + + +     + G I+AEP G + G+  F   F  GG +E  + L  L   + +A
Sbjct:    1 MAMNRNHSQQG-GALIDNSESVLRDCKNVELSFS-DVTHKSDAFKGTKKGSVYLTPYRMVFVSSNMKERLCSFMFPYYLMKNCSIEQPVFAANYIQGIIKAEPGGGWEGQASFKLTFPSGGAIELGQHLFKLASNASRA 137          
BLAST of GCR104 vs. Ensembl Cavefish
Match: wbp2 (WW domain binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-050522-137])

HSP 1 Score: 60.4622 bits (145), Expect = 1.381e-9
Identity = 42/141 (29.79%), Postives = 71/141 (50.35%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAAR 1947
            M++N +H   G GVII N E  L+   ++EL    + +     ++    G +YLT +R+IF+T+  K  L S  MP   +   ++ + +     + G + AEP G + G   F  IF  GG +EF + +  +   + QA+R
Sbjct:    1 MTLNQNHSESG-GVIINNSESVLMSYENVELSFSDADRLPELFKKSK-KGSIYLTPYRVIFVTKG-KDALQSFMMPFYLMKGCEVKQPVLGANYIKGAVNAEPGGGWEGSATFKLIFIAGGAIEFGQYMMQV---AAQASR 135          
BLAST of GCR104 vs. Ensembl Cavefish
Match: gpr142 (probable G-protein coupled receptor 142 [Source:NCBI gene;Acc:103030394])

HSP 1 Score: 53.5286 bits (127), Expect = 5.578e-7
Identity = 39/124 (31.45%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  860 KKRDNKITIQLLAVSTTFTLLTIPQCISVI----INTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRN 1219
              R  K T  LLAV++ FT+L  P+   V+    +++ H   ++      HLA  Y L  +L  LN A+NF LYCF+   FR A  +++L R   +   R       S +  ++++S   TKR+
Sbjct:  234 AGRLGKTTAMLLAVTSVFTVLWAPRTAVVLYHLYVSSVHRDWRV------HLA--YDLANMLAMLNTAVNFFLYCFVSKPFRGAVRDVLLLRGAPLHPPRSFNHRHASTNISNSSLSS-GTKRS 348          
BLAST of GCR104 vs. Ensembl Sea Lamprey
Match: wbp2 (WW domain binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-050522-137])

HSP 1 Score: 47.7506 bits (112), Expect = 4.468e-6
Identity = 34/116 (29.31%), Postives = 54/116 (46.55%), Query Frame = 1
Query: 1579 GECNLLYV----PSIELKL-DYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEAL 1911
            G C+  YV     ++EL   D+ V     + +G   G +YLT  R+IF+T+  K  + S  MP   + N  + + +     + G I AE  G + G   F   F  GG +EF + +
Sbjct:    3 GTCDGFYVLVHYENVELSFSDFVV--TPDVFKGSKKGIIYLTPFRVIFVTKG-KDPMQSFMMPFYLMKNCDIKQPVFGANFIKGTINAEAGGGWEGSASFKLTFSSGGAIEFGQRM 115          
BLAST of GCR104 vs. Ensembl Medaka
Match: wbp2nl (WBP2 N-terminal like [Source:NCBI gene;Acc:101157540])

HSP 1 Score: 63.1586 bits (152), Expect = 2.782e-10
Identity = 39/139 (28.06%), Postives = 67/139 (48.20%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQA 1941
            M++N +H  +G G +I NGE  +    ++EL     V     + +G   G +YLT +R++F++ N K  L S   P+  +    + + +     + G + AEP G + G+  F   F  GG +E  + L  L   + QA
Sbjct:    1 MALNRNHSPNG-GALINNGESVVRQCKNVELSFS-DVTSKTDILKGTKKGTIYLTPYRLVFVSNNPKDCLGSAMFPYYLMKGCSLEQPVFGANYIKGTVRAEPGGYWEGQANFKMSFPSGGAIEVGQHLFKLATNASQA 137          
BLAST of GCR104 vs. Ensembl Medaka
Match: wbp2nl (WBP2 N-terminal like [Source:NCBI gene;Acc:101157540])

HSP 1 Score: 63.1586 bits (152), Expect = 3.216e-10
Identity = 39/139 (28.06%), Postives = 67/139 (48.20%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQA 1941
            M++N +H  +G G +I NGE  +    ++EL     V     + +G   G +YLT +R++F++ N K  L S   P+  +    + + +     + G + AEP G + G+  F   F  GG +E  + L  L   + QA
Sbjct:    1 MALNRNHSPNG-GALINNGESVVRQCKNVELSFS-DVTSKTDILKGTKKGTIYLTPYRLVFVSNNPKDCLGSAMFPYYLMKGCSLEQPVFGANYIKGTVRAEPGGYWEGQANFKMSFPSGGAIEVGQHLFKLATNASQA 137          
BLAST of GCR104 vs. Ensembl Medaka
Match: gpr142 (probable G-protein coupled receptor 142 [Source:NCBI gene;Acc:101163443])

HSP 1 Score: 53.5286 bits (127), Expect = 5.588e-7
Identity = 37/110 (33.64%), Postives = 58/110 (52.73%), Query Frame = 2
Query:  806 TLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVI----INTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCR 1123
            TLR R+R         +  +R  K T  LLA+++ F++L  P+   VI    +++ H   ++      HLA  Y L+ +L  LN A+NF LYCF+   FRN   +++L R
Sbjct:  213 TLRVRKRRQPCQKGH-RPAQRLGKTTAMLLAITSVFSVLWAPRTAVVIYHLYVSSVHSDWRV------HLA--YDLSNMLAMLNTAVNFFLYCFVSKPFRNVVRDVVLLR 313          
BLAST of GCR104 vs. Planmine SMEST
Match: SMESG000018212.1 (SMESG000018212.1)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 338/338 (100.00%), Postives = 338/338 (100.00%), Query Frame = 1
Query: 1525 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKPGALFTSHFPNRPLYAAPQKVYLDVFKDPQFKFVRKHVAFVYPQKNQIYMHRELVPYPGFFECVSTVNSLNLAVPLEPDPRGLSKAYRNPTIYNTYWTPCTKPVRPGFTCFDESDLIKHVQHYQGPYYSGPTAHKISGECECKELKWENPEHCLNKDICKPIVNGIPVLCDKYTMIRMCSANKPCHSNVYSKCE 2538
            MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKPGALFTSHFPNRPLYAAPQKVYLDVFKDPQFKFVRKHVAFVYPQKNQIYMHRELVPYPGFFECVSTVNSLNLAVPLEPDPRGLSKAYRNPTIYNTYWTPCTKPVRPGFTCFDESDLIKHVQHYQGPYYSGPTAHKISGECECKELKWENPEHCLNKDICKPIVNGIPVLCDKYTMIRMCSANKPCHSNVYSKCE
Sbjct:    1 MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPGGLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIEAEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKPGALFTSHFPNRPLYAAPQKVYLDVFKDPQFKFVRKHVAFVYPQKNQIYMHRELVPYPGFFECVSTVNSLNLAVPLEPDPRGLSKAYRNPTIYNTYWTPCTKPVRPGFTCFDESDLIKHVQHYQGPYYSGPTAHKISGECECKELKWENPEHCLNKDICKPIVNGIPVLCDKYTMIRMCSANKPCHSNVYSKCE 338          
BLAST of GCR104 vs. Planmine SMEST
Match: SMESG000018211.1 (SMESG000018211.1)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 367/368 (99.73%), Postives = 367/368 (99.73%), Query Frame = 2
Query:  209 MWVMAIFMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITXXXXXXXXXXXXXDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI 1312
            MW MAIFMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITVVILVIVSLLSSIDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALIIIVSNIIIVLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI
Sbjct:    1 MWFMAIFMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITVVILVIVSLLSSIDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALIIIVSNIIIVLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI 368          
BLAST of GCR104 vs. Planmine SMEST
Match: SMESG000018211.1 (SMESG000018211.1)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 365/365 (100.00%), Postives = 365/365 (100.00%), Query Frame = 2
Query:  218 MAIFMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITXXXXXXXXXXXXXDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI 1312
            MAIFMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITVVILVIVSLLSSIDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALIIIVSNIIIVLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI
Sbjct:    1 MAIFMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITVVILVIVSLLSSIDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALIIIVSNIIIVLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI 365          
BLAST of GCR104 vs. Planmine SMEST
Match: SMESG000018211.1 (SMESG000018211.1)

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 2
Query:  230 MPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITXXXXXXXXXXXXXDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI 1312
            MPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITVVILVIVSLLSSIDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALIIIVSNIIIVLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI
Sbjct:    1 MPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITVVILVIVSLLSSIDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALIIIVSNIIIVLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI 361          
BLAST of GCR104 vs. Planmine SMEST
Match: SMESG000045308.1 (SMESG000045308.1)

HSP 1 Score: 204.527 bits (519), Expect = 5.629e-58
Identity = 134/378 (35.45%), Postives = 217/378 (57.41%), Query Frame = 2
Query:  164 NCS-----DKIFSPIGTNCVMWVMAIFMPPVVIFGLLGNSLSFIILKDSSRKVSSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLIS-NERYRNISYIINQWGTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKITXXXXXXXXXXXXXDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLSVVPALXXXXXXXXXXLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVSTTFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAINFVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLSTKRNSQIYNSDHKYIPNNDLPKEK 1279
            NCS      K+F P+G + VMW   I +P + IFG++GN  SFIILK  + K  S  Y+ CL++ DS++++     FY  LV+ P+L+  +++   I   +  + TC  +T+ +FS R +S W IV+FT++R V V FP  S K+ TIRN  + +V  +I S L +I W+  ++K      N  +CK    +     +E++++S+VP+LII + N+ IVL LR+R++ S + Y + +  +++ +ITI+LL VST F  L  P  + +II T  +         G +A+ +H+   L+ LN +INF+LYC  G  FR AA N++ C   +M+  R+ I  + +++T  T      T+R S   +SD K +  N+ PK K
Sbjct:   11 NCSLPVKASKLFIPVGQDGVMWFQLIAIPLISIFGIVGNVFSFIILKSGASKTVSHLYLVCLSVTDSVTILTFQYSFYTNLVLQPILLKFDDKVTFIEEYLTNYRTCPFRTFTSFSMRLLSTWVIVIFTIDRFVVVAFPFHSRKISTIRNTILALVAALITSFLINIPWLVGYDKAPVPCTNRALCKGNDILFYMVFVEIILMSLVPSLIISICNVSIVLILRKRQKHSTL-YSKKEALQQEKRITIRLLLVSTAFVTLNFPSFVVIIIKTVGKIKYKNLYNSGPMADAFHIGTFLYLLNLSINFILYCLTGSTFRKAAWNLLQCNINKMKHYRKVILLSNTSETNVT-----YTRRRSSSVSSDKKRVVINNCPKLK 382          
The following BLAST results are available for this feature:
BLAST of GCR104 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WBP2NL1.561e-1131.91WBP2 N-terminal like [Source:HGNC Symbol;Acc:HGNC:... [more]
WBP2NL1.561e-1131.91WBP2 N-terminal like [Source:HGNC Symbol;Acc:HGNC:... [more]
WBP2NL1.561e-1131.91WBP2 N-terminal like [Source:HGNC Symbol;Acc:HGNC:... [more]
WBP2NL2.215e-1131.54WBP2 N-terminal like [Source:HGNC Symbol;Acc:HGNC:... [more]
WBP24.595e-826.92WW domain binding protein 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of GCR104 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
C18B2.43.298e-2230.80pep chromosome:WBcel235:X:3604291:3605741:-1 gene:... [more]
D2013.63.948e-1327.32pep chromosome:WBcel235:II:9329757:9331510:1 gene:... [more]
D2013.63.948e-1327.32pep chromosome:WBcel235:II:9329774:9331510:1 gene:... [more]
B0334.62.549e-624.25pep chromosome:WBcel235:II:11510673:11513890:1 gen... [more]
back to top
BLAST of GCR104 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wbp27.294e-1829.95gene:FBgn0036318 transcript:FBtr0332047[more]
Wbp22.129e-1730.10gene:FBgn0036318 transcript:FBtr0332045[more]
Wbp22.320e-1533.57gene:FBgn0036318 transcript:FBtr0332048[more]
Wbp23.226e-1533.57gene:FBgn0036318 transcript:FBtr0273240[more]
Wbp23.226e-1533.57gene:FBgn0036318 transcript:FBtr0273241[more]
back to top
BLAST of GCR104 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
wbp2nl3.709e-928.06WBP2 N-terminal like [Source:ZFIN;Acc:ZDB-GENE-030... [more]
gpr1421.028e-726.09G protein-coupled receptor 142 [Source:ZFIN;Acc:ZD... [more]
wbp24.308e-727.34WW domain binding protein 2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of GCR104 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cyp3a56.798e-1329.53cytochrome P450 family 3 subfamily A member 5 [Sou... [more]
back to top
BLAST of GCR104 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Wbp2nl3.659e-927.27WBP2 N-terminal like [Source:MGI Symbol;Acc:MGI:19... [more]
Wbp23.413e-725.50WW domain binding protein 2 [Source:MGI Symbol;Acc... [more]
Wbp27.639e-727.14WW domain binding protein 2 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of GCR104 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ICG8|WBP2L_HUMAN7.497e-1131.91Postacrosomal sheath WW domain-binding protein OS=... [more]
sp|Q4R3M1|WBP2L_MACFA8.386e-1133.33Postacrosomal sheath WW domain-binding protein OS=... [more]
sp|Q9D529|WBP2L_MOUSE2.560e-827.27Postacrosomal sheath WW domain-binding protein OS=... [more]
sp|Q969T9|WBP2_HUMAN2.300e-726.92WW domain-binding protein 2 OS=Homo sapiens OX=960... [more]
sp|A3KFF6|WBP2L_BOVIN7.897e-728.57Postacrosomal sheath WW domain-binding protein OS=... [more]
back to top
BLAST of GCR104 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUB90.000e+0100.00GCR104 OS=Schmidtea mediterranea OX=79327 GN=gcr10... [more]
A0A1I8I6Q06.183e-4336.27G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A267EIX81.462e-4236.16G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A1I8GTM11.659e-4135.95G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A267DP973.529e-4135.83G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
back to top
BLAST of GCR104 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
wbp2nl5.666e-1229.50WW domain-binding protein 2 [Source:NCBI gene;Acc:... [more]
wbp21.381e-929.79WW domain binding protein 2 [Source:ZFIN;Acc:ZDB-G... [more]
gpr1425.578e-731.45probable G-protein coupled receptor 142 [Source:NC... [more]
back to top
BLAST of GCR104 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wbp24.468e-629.31WW domain binding protein 2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of GCR104 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR104 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR104 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
wbp2nl2.782e-1028.06WBP2 N-terminal like [Source:NCBI gene;Acc:1011575... [more]
wbp2nl3.216e-1028.06WBP2 N-terminal like [Source:NCBI gene;Acc:1011575... [more]
gpr1425.588e-733.64probable G-protein coupled receptor 142 [Source:NC... [more]
back to top
BLAST of GCR104 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018212.10.000e+0100.00SMESG000018212.1[more]
SMESG000018211.10.000e+099.73SMESG000018211.1[more]
SMESG000018211.10.000e+0100.00SMESG000018211.1[more]
SMESG000018211.10.000e+0100.00SMESG000018211.1[more]
SMESG000045308.15.629e-5835.45SMESG000045308.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026993 ID=SMED30026993|Name=GCR104|organism=Schmidtea mediterranea sexual|type=transcript|length=2668bp
TTTTTTTTTCTAGTATGTTGTTTAAATATTTCACAATGAATAACTCTAAA
CGACATAATAATTCAATTTTGATTTTAAAGAGATACAGAAGCATTTTATT
GGAAATTATTTTACACTCTTTGTGAACTAAATGAAATTTTAATATTTATA
TCTAATAATGTCAAACTGTAGTGACAAAATTTTCTCTCCCATAGGAACAA
ATTGTGTCATGTGGGTTATGGCAATTTTTATGCCTCCTGTTGTCATCTTT
GGCTTATTAGGAAATTCGTTGTCATTCATAATTTTGAAAGACTCGTCTCG
AAAAGTGTCAAGTTTCTTTTATATCAGATGCTTAACAATATTTGATAGCC
TGTCTTTGATATTAACTATGTTGGGGTTTTACATGACGTTAGTAATCCAT
CCTATGCTTATAAGCAACGAGAGGTACAGGAACATTAGCTATATTATAAA
TCAGTGGGGTACTTGTCAAACAAAAACTTATTTGGCATTTAGTTGTAGAA
CAATGTCAATTTGGACTATTGTTGTGTTTACTCTTGAAAGATTAGTCTGT
GTGAAGTTCCCAATTATCAGTATGAAAGTATGCACAATTCGAAATGCCAA
AATCACCGTTGTTATTCTTGTAATTGTTTCATTACTTTCTAGTATAGACT
GGATCTTCAGTTTTGAAAAAGTTTTATGTAAAAAATATAATCTTTATGTC
TGTAAACCAAAACAAAACATGTTGAAGTTTAGAATTCTAGAAATGCTTAT
GCTATCTGTCGTTCCAGCGTTGATTATTATTGTATCTAACATAATAATTG
TTTTAACGTTACGACAACGACGACGATTGAGCCTTGTTGCATATGAAGAA
CCGAAAAACAAGAAGAGAGACAACAAAATCACAATTCAGTTATTAGCGGT
TTCGACAACCTTTACCTTATTAACTATCCCTCAATGCATCAGTGTCATCA
TCAATACAAGACATGAACAGCTGAAACTGACAGACAATCGACAAGGGCAC
TTGGCAAATTTTTATCATCTGACATTTCTTCTTTTTACTTTGAACTTTGC
GATAAATTTCGTCCTTTATTGCTTCATCGGCCATAATTTTCGGAATGCCG
CTCTGAATATTATTTTATGCCGATTCAGACAAATGCGACAACTGAGAAGG
GCAATATTCGAAACAGTTTCAAACGACACCCGACACACGACAGTGTCAAA
ATTGTCAACGAAACGCAACTCACAGATTTACAATTCTGATCACAAATACA
TCCCAAATAATGACTTGCCCAAAGAAAAGTTTCCTCCGTTAATTGAAAAT
GAATCCTATATTTGAAATTAAGTATAACTGAAAATTTCTTTATAAGTAAT
ATAAGAGTTTCTTTTTATTTTATCGTCATTTATTTTTAATAATCAAAACT
GAGTGTTTTTGTTGTATTTTTTATTTGAAATAGGATATTTGTGAATTGTT
AGTATTTAAATAAATGTTTGTTTAAATAGAGTTTATGTCATTAATAATTT
GTGCACGGAAAATTCAAAGTTTTGATGTCCATTAATACCAGCCACATTGG
AGATGGAATCGGAGTTATTATTTTCAATGGCGAATGTAACTTATTATACG
TGCCAAGCATAGAGTTGAAATTAGATTATAGTGTTCAGTACAATAGATCA
TTGGAGGAAGGATATTACCCCGGAGGCCTGTATCTTACTACGCATCGAAT
GATTTTTATTACAAGAAATAACAAAAGTAATTTGCTTTCATTGAATATGC
CTCATGTCTTTCTCCACAATCTAAAAATGGTGAAAAAGCTAGGAAAATAT
CCGACACTTATTGGTCAGATTGAAGCAGAACCAAATGGAAATTTTCATGG
ACGAATTCCTTTCACTTTTATATTTCAACAAGGTGGTGTAGTAGAATTCT
ATGAGGCTTTAGCAAGTTTAGGAATGAGATCTTGTCAAGCAGCTAGGTTA
TGGAAACCAGGTGCCTTGTTTACTTCTCATTTTCCGAATAGGCCATTATA
TGCTGCTCCTCAAAAAGTTTATTTAGATGTCTTTAAGGATCCACAGTTTA
AATTTGTCAGAAAGCATGTTGCATTTGTGTATCCGCAAAAAAATCAAATT
TATATGCACCGAGAATTGGTTCCATATCCAGGTTTCTTCGAATGTGTATC
TACAGTCAATTCTTTGAATTTGGCCGTTCCACTCGAACCTGATCCAAGAG
GTTTATCTAAAGCCTATAGAAATCCAACGATTTACAATACATATTGGACT
CCATGCACTAAACCTGTTAGGCCAGGTTTCACATGCTTTGATGAAAGTGA
TTTGATCAAGCATGTCCAACATTATCAAGGTCCATATTACTCAGGCCCTA
CTGCACATAAAATTTCAGGTGAATGTGAATGTAAAGAACTGAAATGGGAA
AATCCTGAGCATTGTCTTAACAAAGATATTTGCAAACCCATTGTCAATGG
TATTCCAGTTCTGTGTGACAAGTACACCATGATCAGAATGTGCTCTGCCA
ATAAGCCATGTCACAGCAATGTTTATTCAAAATGTGAATGAAAGATAAAA
TGAAAAAAAATTATAAACTTCTGGGAAATTATTTAAATTTCTATTATTAC
ATGTAAATCAGAAGGATTTATTTTTCAAAAAACAACTTTAAATAAAATTA
TATATTTTAATTTATTTT
back to top

protein sequence of SMED30026993-orf-1

>SMED30026993-orf-1 ID=SMED30026993-orf-1|Name=SMED30026993-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=339bp
MSINTSHIGDGIGVIIFNGECNLLYVPSIELKLDYSVQYNRSLEEGYYPG
GLYLTTHRMIFITRNNKSNLLSLNMPHVFLHNLKMVKKLGKYPTLIGQIE
AEPNGNFHGRIPFTFIFQQGGVVEFYEALASLGMRSCQAARLWKPGALFT
SHFPNRPLYAAPQKVYLDVFKDPQFKFVRKHVAFVYPQKNQIYMHRELVP
YPGFFECVSTVNSLNLAVPLEPDPRGLSKAYRNPTIYNTYWTPCTKPVRP
GFTCFDESDLIKHVQHYQGPYYSGPTAHKISGECECKELKWENPEHCLNK
DICKPIVNGIPVLCDKYTMIRMCSANKPCHSNVYSKCE*
back to top

protein sequence of SMED30026993-orf-2

>SMED30026993-orf-2 ID=SMED30026993-orf-2|Name=SMED30026993-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=386bp
MSNCSDKIFSPIGTNCVMWVMAIFMPPVVIFGLLGNSLSFIILKDSSRKV
SSFFYIRCLTIFDSLSLILTMLGFYMTLVIHPMLISNERYRNISYIINQW
GTCQTKTYLAFSCRTMSIWTIVVFTLERLVCVKFPIISMKVCTIRNAKIT
VVILVIVSLLSSIDWIFSFEKVLCKKYNLYVCKPKQNMLKFRILEMLMLS
VVPALIIIVSNIIIVLTLRQRRRLSLVAYEEPKNKKRDNKITIQLLAVST
TFTLLTIPQCISVIINTRHEQLKLTDNRQGHLANFYHLTFLLFTLNFAIN
FVLYCFIGHNFRNAALNIILCRFRQMRQLRRAIFETVSNDTRHTTVSKLS
TKRNSQIYNSDHKYIPNNDLPKEKFPPLIENESYI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
IPR011993PH-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 110..132
score: 20.23
coord: 286..312
score: 27.02
coord: 20..44
score: 21.91
coord: 192..215
score: 18.25
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 49..304
e-value: 9.3E-11
score: 41.5
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 14..334
e-value: 1.2E-42
score: 147.9
NoneNo IPR availablePANTHERPTHR46272FAMILY NOT NAMEDcoord: 18..223
NoneNo IPR availablePANTHERPTHR46272:SF2coord: 18..223
NoneNo IPR availablePANTHERPTHR46272FAMILY NOT NAMEDcoord: 234..352
NoneNo IPR availablePANTHERPTHR46272:SF2coord: 234..352
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 19..315
e-value: 2.57715E-30
score: 115.808
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 14..333
NoneNo IPR availableTMHMMTMhelixcoord: 149..168
NoneNo IPR availableTMHMMTMhelixcoord: 243..265
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 115..137
NoneNo IPR availableTMHMMTMhelixcoord: 196..218
NoneNo IPR availableTMHMMTMhelixcoord: 285..307
NoneNo IPR availableTMHMMTMhelixcoord: 54..76
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 35..304
score: 23.682