Neuropeptide Y prohormone 1

Overview
NameNeuropeptide Y prohormone 1
Smed IDSMED30026988
Length (bp)351
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026988

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30026988 SmedASXL_080960SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30026988 dd_Smed_v6_8852_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30026988 OX_Smed_1.0.09490ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30026988 GU295175smed_ncbi_20240424PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30026988 GU295175smed_ncbi_20240424PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuropeptide Y prohormone 1 vs. UniProt/SwissProt
Match: sp|Q27441|NPY_APLCA (Pro-neuropeptide Y OS=Aplysia californica OX=6500 GN=NPY PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 2.535e-10
Identity = 24/55 (43.64%), Postives = 36/55 (65.45%), Query Frame = 2
Query:  104 CLTLVNVICSQKSLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKRFD 268
            C+ +++V      + + PP +PE F   + LR Y+  LNEY++I+GRPRFGKR D
Sbjct:   13 CMAVLSVRADNSEM-LAPPPRPEEFTSAQQLRQYLAALNEYYSIMGRPRFGKRGD 66          
BLAST of Neuropeptide Y prohormone 1 vs. UniProt/SwissProt
Match: sp|P0CJ22|NPY1_CONBE (Neuropeptide Y1-like conopeptide OS=Conus betulinus OX=89764 PE=1 SV=1)

HSP 1 Score: 46.595 bits (109), Expect = 3.939e-7
Identity = 21/34 (61.76%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  152 EPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRF 253
            +PPA+P  F   E L NY+++LN YFAIVGRPRF
Sbjct:    4 DPPARPAVFHSREELMNYVRELNRYFAIVGRPRF 37          
BLAST of Neuropeptide Y prohormone 1 vs. UniProt/SwissProt
Match: sp|P41321|NPF_CORAP (Neuropeptide F OS=Cornu aspersum OX=6535 PE=1 SV=1)

HSP 1 Score: 45.4394 bits (106), Expect = 1.185e-6
Identity = 19/38 (50.00%), Postives = 26/38 (68.42%), Query Frame = 2
Query:  140 SLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRF 253
            +  + PP +P  F  P  LR Y+K+LNEY+AI+GR RF
Sbjct:    2 TQMLSPPERPREFRHPNELRQYLKELNEYYAIMGRTRF 39          
BLAST of Neuropeptide Y prohormone 1 vs. UniProt/SwissProt
Match: sp|P0CJ23|NPY2_CONBE (Neuropeptide Y2-like conopeptide OS=Conus betulinus OX=89764 PE=1 SV=1)

HSP 1 Score: 44.669 bits (104), Expect = 1.834e-6
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  152 EPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRF 253
            +PPA+P  F   E L NY+++LN YFAIVGRPR+
Sbjct:    4 DPPARPAVFHSREELMNYVRELNLYFAIVGRPRY 37          
BLAST of Neuropeptide Y prohormone 1 vs. TrEMBL
Match: E3T7T7 (Neuropeptide Y prohormone 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.111e-40
Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 2
Query:   80 MTFIYGFLCLTLVNVICSQKSLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKRFDRGFS 280
            MTFIYGFLCLTLVNVICSQKSLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKRFDRGFS
Sbjct:    1 MTFIYGFLCLTLVNVICSQKSLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKRFDRGFS 67          
BLAST of Neuropeptide Y prohormone 1 vs. TrEMBL
Match: A0A3P7LY16 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS6882 PE=3 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.705e-9
Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 2
Query:  149 IEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFG 256
            ++PP KP  F +PE LRNYI+K+NEYFA++GRPRFG
Sbjct:   58 MQPPVKPPAFSNPEALRNYIRKVNEYFALIGRPRFG 93          
BLAST of Neuropeptide Y prohormone 1 vs. TrEMBL
Match: Q9U0S9 (Neuropeptide Y OS=Lymnaea stagnalis OX=6523 GN=NPY PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 2.006e-9
Identity = 28/51 (54.90%), Postives = 37/51 (72.55%), Query Frame = 2
Query:  110 TLVNVICSQKSLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKR 262
             ++ V+C++  L   PP +PE F +P  LR Y+K LNEY+AIVGRPRFGKR
Sbjct:   15 AVMEVLCTEAML--TPPQRPEEFKNPNELRKYLKALNEYYAIVGRPRFGKR 63          
BLAST of Neuropeptide Y prohormone 1 vs. TrEMBL
Match: A0A210PXD3 (Neuropeptide F OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04777 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 2.428e-9
Identity = 25/57 (43.86%), Postives = 42/57 (73.68%), Query Frame = 2
Query:  101 LCLTLVNVICSQKSLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKRFDR 271
            +C  LV+ +  Q+++ +EPP +P  F  P+ LR+Y++ LNEY++IVGRPRFG+  ++
Sbjct:   12 VCALLVSQVTCQEAM-LEPPDRPHSFRTPDQLRSYLRALNEYYSIVGRPRFGRSVNK 67          
BLAST of Neuropeptide Y prohormone 1 vs. TrEMBL
Match: G4LVY8 (Neuropeptide Y,putative OS=Schistosoma mansoni OX=6183 GN=Smp_159950 PE=3 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.719e-9
Identity = 26/46 (56.52%), Postives = 34/46 (73.91%), Query Frame = 2
Query:  125 ICSQKSLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKR 262
            I   +++ I PP +P  F+ PE LR Y+ KLNEYFAI+GRPRFG+R
Sbjct:   74 IIKTRAVEIVPPERPFIFETPEALRTYLHKLNEYFAIIGRPRFGRR 119          
BLAST of Neuropeptide Y prohormone 1 vs. Planmine SMEST
Match: SMESG000069090.1 (SMESG000069090.1)

HSP 1 Score: 137.887 bits (346), Expect = 5.871e-44
Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 2
Query:   80 MTFIYGFLCLTLVNVICSQKSLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKRFDRGFS 280
            MTFIYGFLCLTLVNVICSQKSLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKRFDRGFS
Sbjct:    1 MTFIYGFLCLTLVNVICSQKSLFIEPPAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKRFDRGFS 67          
BLAST of Neuropeptide Y prohormone 1 vs. Planmine SMEST
Match: SMESG000066803.1 (SMESG000066803.1)

HSP 1 Score: 44.669 bits (104), Expect = 3.663e-7
Identity = 22/54 (40.74%), Postives = 30/54 (55.56%), Query Frame = 2
Query:  104 CLTLVNVICSQKSLFIEP-PAKPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKR 262
            C  LV ++C    + +     K   FD  +  RNY++KLN  + I GRPRFGKR
Sbjct:    6 CYFLVFILCFMSFIHLNTCNQKRPMFDSADAFRNYLRKLNNEYMIAGRPRFGKR 59          
BLAST of Neuropeptide Y prohormone 1 vs. Planmine SMEST
Match: SMESG000048959.1 (SMESG000048959.1)

HSP 1 Score: 44.2838 bits (103), Expect = 4.112e-7
Identity = 18/33 (54.55%), Postives = 23/33 (69.70%), Query Frame = 2
Query:  164 KPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKR 262
            +   F  PE LR Y+ ++NEY AIV RPR+GKR
Sbjct:   21 RKSIFSSPEALRRYLLQMNEYLAIVARPRYGKR 53          
BLAST of Neuropeptide Y prohormone 1 vs. Planmine SMEST
Match: SMESG000048959.1 (SMESG000048959.1)

HSP 1 Score: 44.669 bits (104), Expect = 4.452e-7
Identity = 18/33 (54.55%), Postives = 23/33 (69.70%), Query Frame = 2
Query:  164 KPEFFDDPELLRNYIKKLNEYFAIVGRPRFGKR 262
            +   F  PE LR Y+ ++NEY AIV RPR+GKR
Sbjct:   35 RKSIFSSPEALRRYLLQMNEYLAIVARPRYGKR 67          
The following BLAST results are available for this feature:
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q27441|NPY_APLCA2.535e-1043.64Pro-neuropeptide Y OS=Aplysia californica OX=6500 ... [more]
sp|P0CJ22|NPY1_CONBE3.939e-761.76Neuropeptide Y1-like conopeptide OS=Conus betulinu... [more]
sp|P41321|NPF_CORAP1.185e-650.00Neuropeptide F OS=Cornu aspersum OX=6535 PE=1 SV=1[more]
sp|P0CJ23|NPY2_CONBE1.834e-658.82Neuropeptide Y2-like conopeptide OS=Conus betulinu... [more]
back to top
BLAST of Neuropeptide Y prohormone 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E3T7T72.111e-40100.00Neuropeptide Y prohormone 1 OS=Schmidtea mediterra... [more]
A0A3P7LY161.705e-966.67Uncharacterized protein OS=Dibothriocephalus latus... [more]
Q9U0S92.006e-954.90Neuropeptide Y OS=Lymnaea stagnalis OX=6523 GN=NPY... [more]
A0A210PXD32.428e-943.86Neuropeptide F OS=Mizuhopecten yessoensis OX=6573 ... [more]
G4LVY82.719e-956.52Neuropeptide Y,putative OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide Y prohormone 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000069090.15.871e-44100.00SMESG000069090.1[more]
SMESG000066803.13.663e-740.74SMESG000066803.1[more]
SMESG000048959.14.112e-754.55SMESG000048959.1[more]
SMESG000048959.14.452e-754.55SMESG000048959.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026988 ID=SMED30026988|Name=Neuropeptide Y prohormone 1|organism=Schmidtea mediterranea sexual|type=transcript|length=351bp
TAGGATAACTGTCAATTTCACCGGCAATTTTCCCCTATTTTAACTGTTCC
GATTTCNNGNNNTTNNANTNTNTTTTTCAATGACTTTCATTTACGGATTT
CTATGCTTGACTCTCGTCAATGTTATTTGTTCTCAGAAAAGTCTGTTCAT
AGAACCACCGGCAAAACCAGAATTTTTCGATGATCCTGAATTGTTGAGGA
ATTACATTAAAAAGCTGAATGAATATTTTGCCATAGTAGGTCGACCAAGA
TTCGGTAAACGTTTCGACAGGGGATTTTCATAAAAGAATGTTTGTTTGGT
TGGATTACAATAAAAAATGTATTTGGTTAATAAATTATCTGCTTGATCTT
A
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000418head
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR001955Pancreatic_hormone-like
IPR020392Pancreatic_hormone-like_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: molecular function
TermDefinition
GO:0005179hormone activity
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001955Pancreatic hormone-likeSMARTSM00309PAH_1coord: 23..58
e-value: 0.0017
score: 27.6
IPR001955Pancreatic hormone-likePFAMPF00159Hormone_3coord: 26..58
e-value: 9.1E-10
score: 38.4
IPR001955Pancreatic hormone-likePROSITEPS50276PANCREATIC_HORMONE_2coord: 23..58
score: 12.972
IPR020392Pancreatic hormone-like, conserved sitePROSITEPS00265PANCREATIC_HORMONE_1coord: 42..58
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.678