TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30026987
Length (bp)781
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30026987) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30026987) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30026987) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30026987) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026987

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30026987SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026987SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026987SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026987SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026987SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026987SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30026987SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026987SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026987SMESG000027280.1 SMESG000027263.1 SMESG000026967.1 SMESG000026956.1 SMESG000026954.1 SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025794.1 SMESG000025583.1 SMESG000025517.1 SMESG000025934.1 SMESG000025926.1 SMESG000025797.1 Contig3847GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30026987SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 99.3673 bits (246), Expect = 4.149e-23
Identity = 45/98 (45.92%), Postives = 65/98 (66.33%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D +MA+ ++K+LEM A+     +G F+WK+  F  K  +A  G    I+S +F T + G+KMCLR+  +GDG G+GTHLS+FF +MKG  D +L WPF
Sbjct:  332 DLAMADLEQKVLEMEAST---YDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPF 426          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 88.5817 bits (218), Expect = 2.089e-19
Identity = 39/89 (43.82%), Postives = 57/89 (64.04%), Query Frame = 2
Query:  242 KLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  324 QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 407          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 88.5817 bits (218), Expect = 2.398e-19
Identity = 39/89 (43.82%), Postives = 57/89 (64.04%), Query Frame = 2
Query:  242 KLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  382 QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 465          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 88.5817 bits (218), Expect = 2.398e-19
Identity = 39/89 (43.82%), Postives = 57/89 (64.04%), Query Frame = 2
Query:  242 KLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  382 QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 465          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 88.5817 bits (218), Expect = 2.429e-19
Identity = 39/89 (43.82%), Postives = 57/89 (64.04%), Query Frame = 2
Query:  242 KLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  407 QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 490          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 75.0998 bits (183), Expect = 3.087e-15
Identity = 36/111 (32.43%), Postives = 57/111 (51.35%), Query Frame = 2
Query:  176 TSRKNLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            T  K   E+  +   S  +   ++L  A    +    + +WK+DK   +  +AK G +  I+S  F++H+ G+KM       GDG   G  +S++  L+KGEFD  LEWPF
Sbjct:  227 TDLKGTYELMERDMGSFNDRQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPF 337          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 67.781 bits (164), Expect = 6.087e-13
Identity = 38/115 (33.04%), Postives = 61/115 (53.04%), Query Frame = 2
Query:  185 KNLTEISNKID-KSMANADR-----KLLEMAANQNQRINGEFVWKLDKFTDKMADAKKG-INAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++L  I  KI+ +  A  D+     + + +A +  ++   +  +++ K    +  A K   +  IYS+ F +H  G+KM     P GDG+    + SVF CLMKGE+D ILEWPF
Sbjct:  119 QSLNPIRTKINIQQSAYVDKYVGMLQYMSIAESAFEKYGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPF 233          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 66.6254 bits (161), Expect = 2.471e-12
Identity = 28/78 (35.90%), Postives = 49/78 (62.82%), Query Frame = 2
Query:  281 NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
             G  +WK+  ++ KMA+A+      + S  F T + G+K+   +  +G+G G+ TH+SV+  ++ GE+D +L+WPFSH
Sbjct:  330 TGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSH 407          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 66.6254 bits (161), Expect = 2.759e-12
Identity = 28/78 (35.90%), Postives = 49/78 (62.82%), Query Frame = 2
Query:  281 NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
             G  +WK+  ++ KMA+A+      + S  F T + G+K+   +  +G+G G+ TH+SV+  ++ GE+D +L+WPFSH
Sbjct:  321 TGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSH 398          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 50.8322 bits (120), Expect = 4.017e-7
Identity = 26/102 (25.49%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  212 IDKSMANADRKLLEMAANQN----QRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWP 505
            + ++M N      +MA  Q     Q I G  +W++  ++ K+ ++K+  + I++S  F     G+ + L +  +G G  KG ++     ++ GE+D +L WP
Sbjct:  227 LHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWP 327          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 50.8322 bits (120), Expect = 4.017e-7
Identity = 26/102 (25.49%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  212 IDKSMANADRKLLEMAANQN----QRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWP 505
            + ++M N      +MA  Q     Q I G  +W++  ++ K+ ++K+  + I++S  F     G+ + L +  +G G  KG ++     ++ GE+D +L WP
Sbjct:  227 LHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWP 327          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0334036)

HSP 1 Score: 50.8322 bits (120), Expect = 4.017e-7
Identity = 26/102 (25.49%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  212 IDKSMANADRKLLEMAANQN----QRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWP 505
            + ++M N      +MA  Q     Q I G  +W++  ++ K+ ++K+  + I++S  F     G+ + L +  +G G  KG ++     ++ GE+D +L WP
Sbjct:  227 LHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWP 327          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 97.8265 bits (242), Expect = 7.984e-24
Identity = 44/98 (44.90%), Postives = 63/98 (64.29%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D S+   + K+ EM+A      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  106 DLSIVEMEAKMREMSAAT---YDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 200          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 97.8265 bits (242), Expect = 7.984e-24
Identity = 44/98 (44.90%), Postives = 63/98 (64.29%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D S+   + K+ EM+A      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  106 DLSIVEMEAKMREMSAAT---YDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 200          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 97.8265 bits (242), Expect = 8.095e-24
Identity = 46/110 (41.82%), Postives = 70/110 (63.64%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH----ICIDQS 532
            D ++A  + +L EM+A      +G F+W++  FT K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF+     + +DQS
Sbjct:  112 DLTVAEMEGRLREMSATT---FDGVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQS 218          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 97.0561 bits (240), Expect = 1.832e-22
Identity = 44/98 (44.90%), Postives = 63/98 (64.29%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D S+   + K+ EM+A      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  406 DLSIVEMEAKMREMSAAT---YDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 500          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 95.9005 bits (237), Expect = 4.019e-22
Identity = 42/114 (36.84%), Postives = 73/114 (64.04%), Query Frame = 2
Query:  185 KNLTEISNKIDKSMANADRKLLEMAAN----QNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            +NL+    ++++++   D +L E   +    Q    +G F+WK+ +F+ +  DA  G    ++S +F + K G+KMCLR+  +GDG G+G+HLS+FF +MKG++D +L+WPFS 
Sbjct:  346 ENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQ 459          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 98.2117 bits (243), Expect = 3.484e-23
Identity = 44/91 (48.35%), Postives = 60/91 (65.93%), Query Frame = 2
Query:  248 LEM--AANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            LEM  A  +    +G F+WK+   T+K  DA  G    +YS +F T K G+K+CLR+  +GDG GKGTH+S+FF +MKGE+D +L WPF H
Sbjct:  216 LEMRSACLEQTSYDGVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKH 306          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 80.8777 bits (198), Expect = 1.135e-21
Identity = 34/76 (44.74%), Postives = 50/76 (65.79%), Query Frame = 2
Query:  281 NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            NG+ +WK+  +  K  +A +G    I+S+ F T   G+++C R   +GDG GKG+ LS++F +MKGEFD IL WPF
Sbjct:  383 NGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPF 458          

HSP 2 Score: 41.5874 bits (96), Expect = 1.135e-21
Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  510 VTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDE-NIGVGSPQFVSHEELS--SNPDLMRNNQIFIKCSVDI 722
            VT  L++Q  +  H+++  + AD PN  ++ +P  E NI  G P+F SH +L    N   ++++ +FIK  VD+
Sbjct:  462 VTLMLLDQSGKKNHITDVFR-AD-PNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVDL 533          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 80.8777 bits (198), Expect = 1.184e-21
Identity = 34/76 (44.74%), Postives = 50/76 (65.79%), Query Frame = 2
Query:  281 NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            NG+ +WK+  +  K  +A +G    I+S+ F T   G+++C R   +GDG GKG+ LS++F +MKGEFD IL WPF
Sbjct:  332 NGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPF 407          

HSP 2 Score: 41.5874 bits (96), Expect = 1.184e-21
Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  510 VTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDE-NIGVGSPQFVSHEELS--SNPDLMRNNQIFIKCSVDI 722
            VT  L++Q  +  H+++  + AD PN  ++ +P  E NI  G P+F SH +L    N   ++++ +FIK  VD+
Sbjct:  411 VTLMLLDQSGKKNHITDVFR-AD-PNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVDL 482          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 80.8777 bits (198), Expect = 1.252e-21
Identity = 34/76 (44.74%), Postives = 50/76 (65.79%), Query Frame = 2
Query:  281 NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            NG+ +WK+  +  K  +A +G    I+S+ F T   G+++C R   +GDG GKG+ LS++F +MKGEFD IL WPF
Sbjct:  382 NGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPF 457          

HSP 2 Score: 41.5874 bits (96), Expect = 1.252e-21
Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  510 VTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDE-NIGVGSPQFVSHEELS--SNPDLMRNNQIFIKCSVDI 722
            VT  L++Q  +  H+++  + AD PN  ++ +P  E NI  G P+F SH +L    N   ++++ +FIK  VD+
Sbjct:  461 VTLMLLDQSGKKNHITDVFR-AD-PNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVDL 532          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 89.3521 bits (220), Expect = 1.248e-19
Identity = 41/105 (39.05%), Postives = 63/105 (60.00%), Query Frame = 2
Query:  206 NKIDKSMANADRKLLEM----AANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            N+ D+ ++  D +L +M       +    NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  379 NRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 483          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 98.9821 bits (245), Expect = 2.173e-23
Identity = 44/98 (44.90%), Postives = 65/98 (66.33%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D +MA+ ++K+ E+  +     +G F+WK+  FT K  +A  G    I+S +F T + G+KMCLRV  +GDG G+GTHLS+FF +MKG  D +L+WPF
Sbjct:  339 DLAMADLEQKVSELEVST---YDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPF 433          

HSP 2 Score: 28.8758 bits (63), Expect = 2.173e-23
Identity = 13/38 (34.21%), Postives = 21/38 (55.26%), Query Frame = 3
Query:  609 TDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVDI 722
            +D NI  G P F    ++ +    +R++ IFIK  VD+
Sbjct:  468 SDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 505          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 98.9821 bits (245), Expect = 2.399e-23
Identity = 44/98 (44.90%), Postives = 65/98 (66.33%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D +MA+ ++K+ E+  +     +G F+WK+  FT K  +A  G    I+S +F T + G+KMCLRV  +GDG G+GTHLS+FF +MKG  D +L+WPF
Sbjct:  332 DLAMADLEQKVSELEVST---YDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPF 426          

HSP 2 Score: 28.8758 bits (63), Expect = 2.399e-23
Identity = 13/38 (34.21%), Postives = 21/38 (55.26%), Query Frame = 3
Query:  609 TDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVDI 722
            +D NI  G P F    ++ +    +R++ IFIK  VD+
Sbjct:  461 SDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 498          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 87.8113 bits (216), Expect = 3.236e-20
Identity = 44/149 (29.53%), Postives = 80/149 (53.69%), Query Frame = 2
Query:  122 RKCADQVEEIKLLNLEMPTSRKNLTEISNKIDKSMANADRKLLEMAANQNQR-------INGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH----ICIDQSA 535
            R   D V+ +K    ++  S + L  +  +  K  A+ +    ++  N+ +         +G+ +WK+  +  K  +A +G    ++S+ F T + G+++C R   +GDG GKGTHLS++F +M+GEFD +L+WPF      + +DQS 
Sbjct:   35 RSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG 183          

HSP 2 Score: 47.7506 bits (112), Expect = 4.176e-6
Identity = 45/158 (28.48%), Postives = 77/158 (48.73%), Query Frame = 3
Query:  282 MENLC--GSSTNSLTKWQTQKRESTQSFIANHFSRIKMVSKC---VCVWILMEM-VLARALICLCSFV**RA---SLMAFWNGHSVTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDE-NIGVGSPQFVSHEEL-SSNPDLMRNNQIFIKCSVDI 722
            +E  C  G     +T ++ +KRE+ +    + FS+    S+C   +C    +      +       FV  R    SL+ +     VT  L++Q  +  H+ ET K AD PN  ++ +P  E NI  G P+FVSH  L +S    ++++ +F+K +VD+
Sbjct:   89 LEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFK-AD-PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 244          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 87.8113 bits (216), Expect = 3.236e-20
Identity = 44/149 (29.53%), Postives = 80/149 (53.69%), Query Frame = 2
Query:  122 RKCADQVEEIKLLNLEMPTSRKNLTEISNKIDKSMANADRKLLEMAANQNQR-------INGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH----ICIDQSA 535
            R   D V+ +K    ++  S + L  +  +  K  A+ +    ++  N+ +         +G+ +WK+  +  K  +A +G    ++S+ F T + G+++C R   +GDG GKGTHLS++F +M+GEFD +L+WPF      + +DQS 
Sbjct:   35 RSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG 183          

HSP 2 Score: 47.7506 bits (112), Expect = 4.176e-6
Identity = 45/158 (28.48%), Postives = 77/158 (48.73%), Query Frame = 3
Query:  282 MENLC--GSSTNSLTKWQTQKRESTQSFIANHFSRIKMVSKC---VCVWILMEM-VLARALICLCSFV**RA---SLMAFWNGHSVTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDE-NIGVGSPQFVSHEEL-SSNPDLMRNNQIFIKCSVDI 722
            +E  C  G     +T ++ +KRE+ +    + FS+    S+C   +C    +      +       FV  R    SL+ +     VT  L++Q  +  H+ ET K AD PN  ++ +P  E NI  G P+FVSH  L +S    ++++ +F+K +VD+
Sbjct:   89 LEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFK-AD-PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 244          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 89.7373 bits (221), Expect = 5.756e-20
Identity = 61/201 (30.35%), Postives = 98/201 (48.76%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQVEEIKLLNLEMPTSRKN-----------------LTEISNKIDKSMANADRK--LLEMAANQNQRI-----------------------NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            L N+I   +++ +R++        +I  LQR    Q E++K L+ E+   R+N                 +TE+ + +DKS   A R   LLE   +++ ++                       NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  290 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 489          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.396e-22
Identity = 44/98 (44.90%), Postives = 65/98 (66.33%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D +MA+ ++K+ E+  +     +G F+WK+  FT K  +A  G    I+S +F T + G+KMCLRV  +GDG G+GTHLS+FF +MKG  D +L+WPF
Sbjct:  332 DLAMADLEQKVSELEVST---YDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPF 426          

HSP 2 Score: 28.8758 bits (63), Expect = 1.396e-22
Identity = 13/38 (34.21%), Postives = 21/38 (55.26%), Query Frame = 3
Query:  609 TDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVDI 722
            +D NI  G P F    ++ +    +R++ IFIK  VD+
Sbjct:  461 SDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 498          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.992e-22
Identity = 45/98 (45.92%), Postives = 65/98 (66.33%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D +MA+ ++K+LEM A+     +G F+WK+  F  K  +A  G    I+S +F T + G+KMCLR+  +GDG G+GTHLS+FF +MKG  D +L WPF
Sbjct:  332 DLAMADLEQKVLEMEAST---YDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPF 426          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 4.026e-19
Identity = 61/201 (30.35%), Postives = 98/201 (48.76%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQVEEIKLLNLEMPTSRKN-----------------LTEISNKIDKSMANADRK--LLEMAANQNQRI-----------------------NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            L N+I   +++ +R++        +I  LQR    Q E++K L+ E+   R+N                 +TE+ + +DKS   A R   LLE   +++ ++                       NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  290 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 489          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 1.166e-18
Identity = 39/89 (43.82%), Postives = 57/89 (64.04%), Query Frame = 2
Query:  242 KLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++LE A+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  407 QVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 490          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 3.458e-18
Identity = 33/76 (43.42%), Postives = 53/76 (69.74%), Query Frame = 2
Query:  281 NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            NG+ +WK+  +  K  +A  G    I+S+SF T + G+++C R   +GDG G+G+HLS++F +M+GEFD +L+WPF
Sbjct:  403 NGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPF 478          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.048e-25
Identity = 54/72 (75.00%), Postives = 62/72 (86.11%), Query Frame = 2
Query:    2 MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQVEEIKLLNLEMPTSRKNLTEISNKID 217
            MEMLKANNNGLS VNELLRNEINELKLDGDRRRVEIGDLQRKCA+Q EEI+LLN ++P  R     +S+++D
Sbjct:  104 MEMLKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLD 175          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DF65 (TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.022e-24
Identity = 55/160 (34.38%), Postives = 93/160 (58.13%), Query Frame = 2
Query:   50 LLRNEINELKLD----GDRRRVEIGDLQRKCADQVEEIKLLNLEMPTSRKNLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSHI 517
            LLR E  +L +      +R   EI +L+ K +  + EI+    ++ T  K    +  K++      +R L + + ++ +   GE+ WK++   +K+ DAKKG+N  I SESF +   G++MCL++ P+GDG   G +LSV+F LMKG++D  ++WPF+ I
Sbjct:  250 LLRKEHQDLSVSVSVQNERNSAEIKELKEKLSSLLTEIE----DLKTKLKQFQSMYEKLEN-----ERNLAKCSLSETKERYGEYTWKVENIMEKVNDAKKGVNTQILSESFYSSNPGYRMCLKIYPNGDGSAFGNYLSVYFVLMKGKYDDQIQWPFNSI 400          

HSP 2 Score: 37.3502 bits (85), Expect = 2.022e-24
Identity = 16/45 (35.56%), Postives = 29/45 (64.44%), Query Frame = 3
Query:  585 NDEAYIQPTDE-NIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSV 716
            ND+ Y +P +E N+  G P+FVSH +L +  D +++  I ++ +V
Sbjct:  424 NDQCYGRPKEEHNLAAGQPKFVSHLQLVNEDDFIKDGAIILRVNV 468          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1X7UQ34 (MATH domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.298e-23
Identity = 44/116 (37.93%), Postives = 74/116 (63.79%), Query Frame = 2
Query:  167 EMPTSRKNLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            ++ T +  + ++   +   M+  + +   ++  +N   +G  VWK+ +F+ +M DA+ G    I+S  F + + G+KMCLR+   GDG+GKGTH+S+FF +MKGEFD IL+WPF+H
Sbjct:  158 QIHTLQDKVAQLETTLSTKMSENEDRDFRLSLMENSNFDGSMVWKIPQFSQRMDDARTGKYTSIFSLPFYSSRYGYKMCLRLYILGDGIGKGTHMSLFFVVMKGEFDNILQWPFTH 273          

HSP 2 Score: 32.7278 bits (73), Expect = 1.298e-23
Identity = 25/73 (34.25%), Postives = 39/73 (53.42%), Query Frame = 3
Query:  504 HSVTFALINQRTRLPHVSETVKCADYPNDEAYIQP-TDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVD 719
            H VTF LINQ      + +  +    P   ++ +P +D N+  G P+FVS +EL  +  ++  + IFIK  VD
Sbjct:  273 HKVTFKLINQ-CGARDIMDIFQPD--PLSSSFQKPKSDMNVASGCPRFVSMDELMLDGFIL-GDTIFIKAEVD 341          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1X7T9H5 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.015e-23
Identity = 45/116 (38.79%), Postives = 74/116 (63.79%), Query Frame = 2
Query:  167 EMPTSRKNLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            ++ T +  + ++   +   M+  + +   ++  +N   +G  VWK+ +F+ +M DA+ G  A I+S  F   + G+KMCLR+   GDG+GKGTH+S+FF +MKGEFD IL+WPF+H
Sbjct:  522 QIHTLQDKVAQLETTLSTKMSENEDRDFRLSLMENSNFDGSMVWKIPQFSQRMDDARTGKYASIFSLPFYFSRYGYKMCLRLYILGDGIGKGTHMSLFFVVMKGEFDNILQWPFTH 637          

HSP 2 Score: 31.9574 bits (71), Expect = 2.015e-23
Identity = 26/73 (35.62%), Postives = 37/73 (50.68%), Query Frame = 3
Query:  504 HSVTFALINQRTRLPHVSETVKCADYPNDEAYIQP-TDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVD 719
            H VTF LINQ      +   +   D P   ++ +P +D N+  G P+FVS  EL      + ++ IFIK  VD
Sbjct:  637 HKVTFKLINQCGARDIID--IFQPD-PLSSSFQKPKSDMNVASGCPRFVSMNELMQG-GFIVDDTIFIKVKVD 705          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3M6T4H2 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00003859 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.618e-23
Identity = 36/76 (47.37%), Postives = 54/76 (71.05%), Query Frame = 2
Query:  281 NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            NG + WK+D+++ +  +A  G    IYS  F   + G+K+C R+ P+GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  330 NGTYFWKIDRYSQRFQEAVSGKTLSIYSPPFYVGRFGYKVCARLYPNGDGIGKGTHLSMFFVVMRGEYDALLPWPF 405          

HSP 2 Score: 39.6614 bits (91), Expect = 2.618e-23
Identity = 21/47 (44.68%), Postives = 29/47 (61.70%), Query Frame = 3
Query:  582 PNDEAYIQPT-DENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVD 719
            PN  ++ +PT D NI  G P F+SH EL      +RN+ +FIK +VD
Sbjct:  430 PNSSSFKRPTSDMNIASGCPTFISHIELRQG-GYIRNDTMFIKITVD 475          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 96.2857 bits (238), Expect = 1.882e-22
Identity = 44/98 (44.90%), Postives = 63/98 (64.29%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D S+   + K+ EM+A      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  290 DLSIVEMEGKMREMSAAT---YDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 384          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 96.6709 bits (239), Expect = 2.000e-22
Identity = 44/98 (44.90%), Postives = 63/98 (64.29%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D S+   + K+ EM+A      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  403 DLSIVEMEGKMREMSAAT---YDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 497          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 95.9005 bits (237), Expect = 4.116e-22
Identity = 50/138 (36.23%), Postives = 81/138 (58.70%), Query Frame = 2
Query:  146 EIKLLNLEMPTSRKNLTE-----ISNKI----------DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            E  +L LE  T ++ L +     +SNK+          D  +A +++ L E+   Q    +G FVWK+  F+ +  DA  G    ++S +F + K G+KMCLR+  +GDG G+G+HLS+FF +M+G++D +L+WPFS 
Sbjct:  324 ERTVLRLEALTRQQQLDQEKIENLSNKVRQLERTLTMRDLQLAESEQALREL---QFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQ 458          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 93.2041 bits (230), Expect = 3.044e-21
Identity = 37/85 (43.53%), Postives = 59/85 (69.41%), Query Frame = 2
Query:  254 MAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++A Q+   +G F+W++   + K+ +A  G  +  YS +F T + GFK+C+R+   GDGVGKGTH+S+FF +MKG++D +L WPF
Sbjct:  359 ISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPF 443          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 93.2041 bits (230), Expect = 3.110e-21
Identity = 37/85 (43.53%), Postives = 59/85 (69.41%), Query Frame = 2
Query:  254 MAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++A Q+   +G F+W++   + K+ +A  G  +  YS +F T + GFK+C+R+   GDGVGKGTH+S+FF +MKG++D +L WPF
Sbjct:  382 ISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPF 466          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 4.596e-26
Identity = 44/116 (37.93%), Postives = 64/116 (55.17%), Query Frame = 2
Query:  173 PTSRKNLTEISNKIDKSMANADRKLLEM----AANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            PT    L    ++ D  +   D +L EM       +    NG+ VWK+  +  +  DA  G    +YS+ F T   G++MC R   +GDGVG+GTHLS+FF +M+GE+D +L WPF
Sbjct:  284 PTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPF 399          

HSP 2 Score: 38.5058 bits (88), Expect = 4.596e-26
Identity = 27/71 (38.03%), Postives = 38/71 (53.52%), Query Frame = 3
Query:  510 VTFALINQRTRLPHVSETVKCADYPNDEAYIQPT-DENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVD 719
            VT  L++Q      +S+T K    P   ++ +PT D NI  G P FVSH  L S    ++++ IFIK  VD
Sbjct:  403 VTLTLLDQGAARRQLSDTFK--PDPASSSFRRPTSDMNIASGCPLFVSHVALES-ASYLQDDTIFIKVVVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 8.272e-24
Identity = 42/95 (44.21%), Postives = 60/95 (63.16%), Query Frame = 2
Query:  230 NADRKL--LEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
             A+R+L  LE A       +G+ VWK+  +  +  +A  G    +YS+ F T   G+KMC R   +GDGVG+GTHLS+FF +M+GE+D +LEWPF
Sbjct:  253 TAERRLQVLETAG-----YSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPF 342          

HSP 2 Score: 33.113 bits (74), Expect = 8.272e-24
Identity = 22/71 (30.99%), Postives = 38/71 (53.52%), Query Frame = 3
Query:  510 VTFALINQRTRLPHVSETVKCADYPNDEAYIQP-TDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVD 719
            VT +L++Q     H+S+T      P   ++ +P  D N+  G P FVSH  L  +  L+ ++ +F++  VD
Sbjct:  346 VTLSLLDQGAARRHLSDTF--TPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLV-DDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 54.6842 bits (130), Expect = 6.477e-9
Identity = 37/137 (27.01%), Postives = 68/137 (49.64%), Query Frame = 2
Query:  188 NLTEISNKIDKS---MANADR--KLLE--MAANQNQRINGEFVWKLDKFTDKMAD------AKKGIN----AIIYSESFLTHKNGFKMCLRVD-------PDGDG------VGKGTHLSVFFCLMKGEFDGILEWPF 508
             + E+S K D     +A A R  + LE  +A ++++   G F W++++F+  +        A  G++    A+++S  F T   G+++CLR+        P G         G+  HL++F  L++G++D  L WPF
Sbjct:  354 QIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPF 490          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 4.596e-8
Identity = 28/103 (27.18%), Postives = 51/103 (49.51%), Query Frame = 2
Query:  206 NKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGIN--AIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
             + ++S+    R+L E+   +N   NG F+WK+    +++ +A  G      I S +F T + G+++ LR+         G H+S +  L  G +D  L WP+
Sbjct:  302 QETERSILGLTRRLAEL---ENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRL------CRSGEHVSAYAMLGPGPYDATLAWPY 395          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 101.293 bits (251), Expect = 1.926e-24
Identity = 43/108 (39.81%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  185 KNLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            + L+++ + I        ++ L +   Q    +G F+WK+DKFT++ A+AK G    IYS  F TH+ G+K+C R+ P+GDG  +  +LS+F  LM+GE+D IL WPF
Sbjct:  347 RRLSQLESSITIHKTKLFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPF 454          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 100.138 bits (248), Expect = 4.482e-24
Identity = 43/98 (43.88%), Postives = 61/98 (62.24%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D  +A  D KL  + A      +G ++WK+D++T +  +   G    IYS  F   + G+K C RV P+GDG+GKG+HLS+FF LM+GEFD +L WPF
Sbjct:  358 DIQLAEHDLKLQMLEATS---YDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPF 452          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 87.4261 bits (215), Expect = 9.198e-20
Identity = 51/152 (33.55%), Postives = 87/152 (57.24%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRRVEIGDLQRKCADQVEEIKLLNLEMPTSRKNLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++ E++ L   GD  R  +  L+RK    VE++K       +S + + E+++K+ +     + + +E+   + +  NG F+WKLD F      +  G+ A I+S  F T   G+KMCLR++ +G   G G H+S+F  +M+G++DGILEWPF
Sbjct:  272 MQREVDMLGSRGDEYRQFLAYLERK----VEDVKT------SSDRRIAELTHKLMR----LETREIEL---EGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPF 406          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 86.6557 bits (213), Expect = 1.924e-19
Identity = 36/92 (39.13%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  281 NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH----ICIDQSAHPT 544
            + + +W+++ +T KM +AK G    ++S +F T K+G+++C  V  +GDG GKGTH+SVF  ++KG FD +L+WPF +    + +DQ+  P 
Sbjct:  301 HSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPA 392          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 73.559 bits (179), Expect = 1.195e-18
Identity = 49/133 (36.84%), Postives = 67/133 (50.38%), Query Frame = 2
Query:  167 EMPTSRKNLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAK--------KGINA-----------IIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++ T +K L   S  I K   N D+      A + Q  +G FVW++  + DK   A         KG N+           I+ S  F T + G+KM L+  P+G G GKGTHLS+   +MKGE+D ILEWPF
Sbjct:  284 QLDTLKKELGIASETIRK---NRDQIAKLSTACKTQYTDGTFVWRICNYKDKYKKAVAFATNQEVKGGNSDSDDDISMAGDIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPF 413          

HSP 2 Score: 36.1946 bits (82), Expect = 1.195e-18
Identity = 27/74 (36.49%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  507 SVTFALINQRTRLPHVSETVKCADYPND------EAYIQPTD-ENIGVGSPQFVSHEELSSNPDLMRNNQIFIK 707
             +T +LINQ  +    SETV+   YP+D        + +P + EN+G G   F+SH EL+S  D ++++ IFI+
Sbjct:  416 KITLSLINQSEQWR--SETVEI--YPDDATPDKKHKFERPIENENVGCGYSCFISHMELNSG-DYIKDDVIFIE 484          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 96.2857 bits (238), Expect = 3.011e-22
Identity = 43/98 (43.88%), Postives = 63/98 (64.29%), Query Frame = 2
Query:  215 DKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            D ++A  + +L EMAA      +G F+W++  F  K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  427 DLTVAEMEGRLREMAATT---FDGVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPF 521          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 95.9005 bits (237), Expect = 3.409e-22
Identity = 49/139 (35.25%), Postives = 80/139 (57.55%), Query Frame = 2
Query:  113 DLQRKCADQVEEIKLLNLEMPTSRKNLTEISNKI---DKSMANADRKLLEMAANQN----QRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            +L+R CA     ++  N +    +  +  +SNK+   +++++  D  ++EM            +G F+WK+  FT K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  360 ELERSCAT----MEAYNRQHRLDQDKIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 494          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 91.2781 bits (225), Expect = 1.303e-20
Identity = 42/114 (36.84%), Postives = 70/114 (61.40%), Query Frame = 2
Query:  185 KNLTEISNKIDKSMANADRKLLEMAAN----QNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            +NL+    ++++S+   D +L E        Q    +G FVWK+  F+ +  +A  G    ++S +F + K G+KMCLR+  +GDG G+GTHLS+FF +M+ ++D +L+WPFS 
Sbjct:  330 ENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQ 443          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 91.2781 bits (225), Expect = 1.455e-20
Identity = 42/114 (36.84%), Postives = 70/114 (61.40%), Query Frame = 2
Query:  185 KNLTEISNKIDKSMANADRKLLEMAAN----QNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            +NL+    ++++S+   D +L E        Q    +G FVWK+  F+ +  +A  G    ++S +F + K G+KMCLR+  +GDG G+GTHLS+FF +M+ ++D +L+WPFS 
Sbjct:  337 ENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQ 450          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 90.1225 bits (222), Expect = 2.801e-20
Identity = 40/89 (44.94%), Postives = 57/89 (64.04%), Query Frame = 2
Query:  242 KLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 508
            ++LE A+      NG  +WK+  +  +  DA  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  289 QVLETAS-----YNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPF 372          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025558.1 (SMESG000025558.1)

HSP 1 Score: 296.975 bits (759), Expect = 1.463e-114
Identity = 156/206 (75.73%), Postives = 159/206 (77.18%), Query Frame = 2
Query:    2 MEMLKANNNGLSAVNELLRNEINELKLDGDRRR-----------------------------------VEIGDLQRKCADQVEEIKLLNLEMPTSRKNLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            MEMLKANNNGLSAV ELLRNEIN+LKLDG+RRR                                   VEIGDLQRKCADQVEEIKLLNLEMPTSRKNLTEISNKIDKSM N DRKLLEMAANQNQRINGEFVWKLDKFTDKMADAK GINAIIYSESFLTHKNGFKMCL V PDG   GKGTHL V+F LMKGEFDGILEWPF H
Sbjct:  169 MEMLKANNNGLSAVIELLRNEINDLKLDGERRREEIAELQVNIICLNGENVAMRENVDKLISDGERNQVEIGDLQRKCADQVEEIKLLNLEMPTSRKNLTEISNKIDKSMDNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLCVYPDGFSDGKGTHLPVYFHLMKGEFDGILEWPFRH 374          

HSP 2 Score: 135.191 bits (339), Expect = 1.463e-114
Identity = 64/75 (85.33%), Postives = 68/75 (90.67%), Query Frame = 3
Query:  504 HSVTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVDIDS 728
            HSVTFALINQRTRLPHVS+TVKCA+ PN+EA+IQPTD N G G  QFVSHEEL SNPDLMRNNQIFIKCSVDIDS
Sbjct:  374 HSVTFALINQRTRLPHVSKTVKCANNPNNEAFIQPTDRNTGWGFHQFVSHEELLSNPDLMRNNQIFIKCSVDIDS 448          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025794.1 (SMESG000025794.1)

HSP 1 Score: 283.493 bits (724), Expect = 4.846e-113
Identity = 147/207 (71.01%), Postives = 155/207 (74.88%), Query Frame = 2
Query:    2 MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQVEEIKLLNLEMPTSRK------------------------------------NLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            MEMLKANNNGLSAVNELLRNEINELKLDG+RRRVEI DLQRKCADQ EEI+LLN ++P  R                                     +LTE+SNKIDK   N DRKLLEMAANQNQRINGEF+WKLDKFTDKMADAK GIN  IYSESFLTHKNGFKMCLRVDPDG+G GKGTHLSVFF LMKGEFDGILEWPF H
Sbjct:  171 MEMLKANNNGLSAVNELLRNEINELKLDGERRRVEIADLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKNGINTRIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFHLMKGEFDGILEWPFRH 377          

HSP 2 Score: 143.665 bits (361), Expect = 4.846e-113
Identity = 66/75 (88.00%), Postives = 71/75 (94.67%), Query Frame = 3
Query:  504 HSVTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVDIDS 728
            HSVTFALINQRTRLPHVS+TVKCA+YPND+A IQPTD N G+G P+FVSHEELSSNPDLMRNNQIFIKCSVDIDS
Sbjct:  377 HSVTFALINQRTRLPHVSKTVKCANYPNDKALIQPTDRNAGLGFPKFVSHEELSSNPDLMRNNQIFIKCSVDIDS 451          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025982.1 (SMESG000025982.1)

HSP 1 Score: 283.108 bits (723), Expect = 4.141e-109
Identity = 147/207 (71.01%), Postives = 154/207 (74.40%), Query Frame = 2
Query:    2 MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQVEEIKLLNLEMPTSRK------------------------------------NLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            ME+LKANNNGLS VNELLRNEINELKLDGDRRRVEIGDLQRKCA+Q EEI+LLN ++P  R                                     +LTE+SNKIDK   N DRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINA IYSESFLTHKNGFKMCL V PDGDG GKG HLSVFF LMKGEFDGILEWPF H
Sbjct:  171 MEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAFIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRH 377          

HSP 2 Score: 130.954 bits (328), Expect = 4.141e-109
Identity = 60/75 (80.00%), Postives = 67/75 (89.33%), Query Frame = 3
Query:  504 HSVTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVDIDS 728
            HSVTFALINQRTRLPHVS+  +CA+YPN++ +IQPTD N G G  +FVSHEELSSNPDLMRNNQIFIKCSVDIDS
Sbjct:  377 HSVTFALINQRTRLPHVSKITECANYPNNKEFIQPTDRNAGRGFARFVSHEELSSNPDLMRNNQIFIKCSVDIDS 451          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025998.1 (SMESG000025998.1)

HSP 1 Score: 283.493 bits (724), Expect = 4.769e-109
Identity = 145/207 (70.05%), Postives = 155/207 (74.88%), Query Frame = 2
Query:    2 MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQVEEIKLLNLEMPTSRK------------------------------------NLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            MEMLKANNNGLSAVNELLRNEINELKLDG+RRR EI +LQ+KCADQ EEI+LLN ++P  R                                     +LTE+SNKIDK   N DRKLLEMAANQNQRINGEFVWKLDKFTDKMADAK G NAIIYSESFLTHKNG+KMCL VDPDG+G GKGTHLSVFFCLMKGEFDGILEWPF H
Sbjct:  171 MEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQKKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGTNAIIYSESFLTHKNGYKMCLLVDPDGNGGGKGTHLSVFFCLMKGEFDGILEWPFGH 377          

HSP 2 Score: 130.183 bits (326), Expect = 4.769e-109
Identity = 61/76 (80.26%), Postives = 67/76 (88.16%), Query Frame = 3
Query:  501 GHSVTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVDIDS 728
            GHSVTFALINQRTRLPHVS T K +DY N++A+IQPTD N G G  +FVSHEELSSNPDLMRNN+IFIKCSVDIDS
Sbjct:  376 GHSVTFALINQRTRLPHVSGTAKRSDYINNKAFIQPTDRNAGWGYAKFVSHEELSSNPDLMRNNEIFIKCSVDIDS 451          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025963.1 (SMESG000025963.1)

HSP 1 Score: 278.485 bits (711), Expect = 5.321e-109
Identity = 145/207 (70.05%), Postives = 153/207 (73.91%), Query Frame = 2
Query:    2 MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQVEEIKLLNLEMPTSRK------------------------------------NLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 514
            MEMLKANNNGLSAVNELLRNEINELKLDG+RRR EI +LQRKCADQ EEI+LLN ++P  R                                     +LTE+SNKIDK   N DRKLLEMAANQNQ   GEFVWKLDKFTDKMADAKKGIN  IYSESFLTHKNGFKMCLRVDPDG+G GKGTHLSVFFCLMKGEFDGILEWPF H
Sbjct:   58 MEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKKGINTDIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFCLMKGEFDGILEWPFRH 264          

HSP 2 Score: 135.191 bits (339), Expect = 5.321e-109
Identity = 65/75 (86.67%), Postives = 67/75 (89.33%), Query Frame = 3
Query:  504 HSVTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDENIGVGSPQFVSHEELSSNPDLMRNNQIFIKCSVDIDS 728
            HSVTFALINQRTRLPHVS+TVK A+ PN EA IQPTD N G G PQFVSHEELSSNPDLMRNNQIFIKCSVDIDS
Sbjct:  264 HSVTFALINQRTRLPHVSKTVKYANNPNSEALIQPTDRNAGWGFPQFVSHEELSSNPDLMRNNQIFIKCSVDIDS 338          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF24.149e-2345.92TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF32.089e-1943.82TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.398e-1943.82TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.398e-1943.82TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.429e-1943.82TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-13.087e-1532.43TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-26.087e-1333.04TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf42.471e-1235.90gene:FBgn0026319 transcript:FBtr0077429[more]
Traf42.759e-1235.90gene:FBgn0026319 transcript:FBtr0334401[more]
Traf-like4.017e-725.49gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like4.017e-725.49gene:FBgn0030748 transcript:FBtr0074274[more]
Traf-like4.017e-725.49gene:FBgn0030748 transcript:FBtr0334036[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX901915.17.984e-2444.90pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.17.984e-2444.90pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
unm_sa8088.095e-2441.82un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
traf2a1.832e-2244.90Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
traf2b4.019e-2236.84Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspb63.484e-2348.35heat shock protein family B (small) member 6 [Sour... [more]
slc12a11.135e-2144.74solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.184e-2144.74solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.252e-2144.74solute carrier family 12 member 1 [Source:Xenbase;... [more]
ssh21.248e-1939.05slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf22.173e-2344.90TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf22.399e-2344.90TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf53.236e-2029.53TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf53.236e-2029.53TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf35.756e-2030.35TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE1.396e-2244.90TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN1.992e-2245.92TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE4.026e-1930.35TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN1.166e-1843.82TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|O00463|TRAF5_HUMAN3.458e-1843.42TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GWW35.048e-2575.00TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
T1DF652.022e-2434.38TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A1X7UQ341.298e-2337.93MATH domain-containing protein OS=Amphimedon queen... [more]
A0A1X7T9H52.015e-2338.79Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A3M6T4H22.618e-2347.37Uncharacterized protein OS=Pocillopora damicornis ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a1.882e-2244.90TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a2.000e-2244.90TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b4.116e-2236.23TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf13.044e-2143.53TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf13.110e-2143.53TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.14.596e-2637.93pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.18.272e-2444.21pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf66.477e-927.01TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.14.596e-827.18pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352371.926e-2439.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494644.482e-2443.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487739.198e-2033.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328511.924e-1939.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483941.195e-1836.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unm_sa8083.011e-2243.88TNF receptor-associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.23.409e-2235.25TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf2b1.303e-2036.84TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.455e-2036.84TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf32.801e-2044.94TNF receptor associated factor 3 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025558.11.463e-11475.73SMESG000025558.1[more]
SMESG000025794.14.846e-11371.01SMESG000025794.1[more]
SMESG000025982.14.141e-10971.01SMESG000025982.1[more]
SMESG000025998.14.769e-10970.05SMESG000025998.1[more]
SMESG000025963.15.321e-10970.05SMESG000025963.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026987 ID=SMED30026987|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=781bp
AATGGAGATGTTGAAGGCCAATAATAACGGATTGAGCGCAGTGAATGAAT
TATTGCGAAATGAAATCAACGAATTGAAATTGGATGGCGACAGGAGACGA
GTTGAAATTGGAGATTTGCAGAGGAAATGTGCCGATCAAGTTGAGGAAAT
AAAATTACTAAATTTAGAAATGCCAACATCTAGAAAAAATCTCACAGAAA
TTTCAAATAAAATCGATAAATCAATGGCAAATGCTGACAGGAAATTATTG
GAAATGGCAGCCAATCAAAATCAGCGGATAAATGGAGAATTTGTGTGGAA
GCTCGACAAATTCACTGACAAAATGGCAGACGCAAAAAAGGGAATCAACG
CAATCATTTATAGCGAATCATTTCTCACGCATAAAAATGGTTTCAAAATG
TGTTTGCGTGTGGATCCTGATGGAGATGGTGTTGGCAAGGGCACTCATTT
GTCTGTGTTCTTTTGTTTGATGAAGGGCGAGTTTGATGGCATTTTGGAAT
GGCCATTCAGTCACATTTGCATTGATCAATCAGCGCACCCGACTGCCTCA
TGTTAGTGAGACTGTGAAATGTGCAGATTATCCAAATGATGAAGCATATA
TCCAGCCAACAGATGAAAATATTGGAGTGGGATCTCCCCAATTTGTAAGC
CATGAAGAATTATCGAGCAATCCAGATCTGATGCGTAACAATCAGATATT
TATTAAATGCTCCGTTGACATTGACTCGTGATTGAATTATATTTTTATTG
TTATCAATAAATTTGCTCATTTAAAAAAAAA
back to top

protein sequence of SMED30026987-orf-1

>SMED30026987-orf-1 ID=SMED30026987-orf-1|Name=SMED30026987-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=185bp
MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQVEEI
KLLNLEMPTSRKNLTEISNKIDKSMANADRKLLEMAANQNQRINGEFVWK
LDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHL
SVFFCLMKGEFDGILEWPFSHICIDQSAHPTASC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 36..56
NoneNo IPR availableCOILSCoilCoilcoord: 1..28
NoneNo IPR availablePANTHERPTHR10131:SF132coord: 11..183
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 40..187
e-value: 1.5E-37
score: 131.1
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 94..183
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 11..183
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 94..187
score: 15.226