SMED30026979

Overview
NameSMED30026979
Smed IDSMED30026979
Length (bp)543
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30026979 (SMED30026979) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30026979 (SMED30026979) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30026979 (SMED30026979) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30026979 (SMED30026979) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026979

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026979SMESG000076644.1 SmedASXL_003674SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v4_227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v4_227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v4_227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v4_227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v4_227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v4_227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v4_227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v4_227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v4_227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v4_227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v6_227_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30026979SMESG000076644.1 SMESG000076643.1 dd_Smed_v6_227_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30026979 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003243:30401..31040 +2651
Homology
BLAST of SMED30026979 vs. Ensembl Human
Match: RPS11 (ribosomal protein S11 [Source:HGNC Symbol;Acc:HGNC:10384])

HSP 1 Score: 189.119 bits (479), Expect = 1.963e-61
Identity = 90/139 (64.75%), Postives = 109/139 (78.42%), Query Frame = -1
Query:   70 QTERAYQKQE---------VRGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            QTERAYQKQ          + G+ G     RYYK+IGLG+KTP+EAI G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ +GD V VGECRPL+KTV FNVL
Sbjct:    5 QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVL 143          
BLAST of SMED30026979 vs. Ensembl Human
Match: RPS11 (ribosomal protein S11 [Source:HGNC Symbol;Acc:HGNC:10384])

HSP 1 Score: 148.288 bits (373), Expect = 5.421e-46
Identity = 72/114 (63.16%), Postives = 88/114 (77.19%), Query Frame = -1
Query:  145 QTERAYQKQE---------VRGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFR 453
            QTERAYQKQ          + G+ G     RYYK+IGLG+KTP+EAI G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FR
Sbjct:    5 QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFR 118          
BLAST of SMED30026979 vs. Ensembl Human
Match: RPS11 (ribosomal protein S11 [Source:HGNC Symbol;Acc:HGNC:10384])

HSP 1 Score: 111.309 bits (277), Expect = 5.989e-32
Identity = 48/64 (75.00%), Postives = 57/64 (89.06%), Query Frame = -1
Query:   70 LKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 261
            +KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ +GD V VGECRPL+KTV FNVL
Sbjct:    1 MKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVL 64          
BLAST of SMED30026979 vs. Ensembl Celegans
Match: rps-11 (Ribosomal Protein, Small subunit [Source:UniProtKB/TrEMBL;Acc:Q20206])

HSP 1 Score: 169.474 bits (428), Expect = 3.003e-54
Identity = 81/138 (58.70%), Postives = 102/138 (73.91%), Query Frame = -1
Query:   70 EQTERAYQKQ-------EVRGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 456
            EQTERA+ KQ       + R   GS+   RY + +GLG+K PR+A+ G YIDKKCP+  +V IRG ++TG+V+K KM RT V+RRDYLH++KKY R+EKRHKN+  H SPAFRDI  GD V +GECRPL+KTV FNVL
Sbjct:    3 EQTERAFLKQPTVNLNNKARILAGSKKTPRYIREVGLGFKAPRDAVEGTYIDKKCPWAGNVPIRGMILTGVVLKNKMTRTIVVRRDYLHYIKKYRRYEKRHKNVPAHCSPAFRDIHPGDLVTIGECRPLSKTVRFNVL 140          
BLAST of SMED30026979 vs. Ensembl Fly
Match: RpS11 (gene:FBgn0033699 transcript:FBtr0088006)

HSP 1 Score: 178.333 bits (451), Expect = 1.514e-57
Identity = 85/136 (62.50%), Postives = 107/136 (78.68%), Query Frame = -1
Query:   70 EQTERAYQKQE----VRGKKGS---RNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 456
            +QTER+++KQ     VR K  +   R R+Y+ IGLG++ P EAI+G YIDKKCP+T DV+IRG ++TG+V K KM RT VIRRDYLHFV+KY+RFEKRH+N+SVH SP FRD+  GD V +GECRPL+KTV FNVL
Sbjct:    4 QQTERSFRKQHAVVVVRRKSPNLKKRPRFYRQIGLGFRAPAEAIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVL 139          
BLAST of SMED30026979 vs. Ensembl Fly
Match: RpS11 (gene:FBgn0033699 transcript:FBtr0088007)

HSP 1 Score: 172.94 bits (437), Expect = 2.042e-55
Identity = 85/138 (61.59%), Postives = 104/138 (75.36%), Query Frame = -1
Query:   70 EQTERAYQKQ-----EVRGKKGSRN----RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 456
            +Q ERA+QKQ       + K G       R  + +GLG+KTPREAI+G YIDKKCP+T DV+IRG ++TG+V K KM RT VIRRDYLHFV+KY+RFEKRH+N+SVH SP FRD+  GD V +GECRPL+KTV FNVL
Sbjct:    3 DQNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVL 140          
BLAST of SMED30026979 vs. Ensembl Zebrafish
Match: rps11 (ribosomal protein S11 [Source:ZFIN;Acc:ZDB-GENE-040426-2701])

HSP 1 Score: 184.496 bits (467), Expect = 9.362e-60
Identity = 89/140 (63.57%), Postives = 109/140 (77.86%), Query Frame = -1
Query:   70 QTERAYQKQ--------EVRGKKGSRN----RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            Q ERAYQKQ         V   +GS      RY++++GLG+KTPREAI+G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ VGD V VGECRPL+KTV FNVL
Sbjct:    5 QNERAYQKQPTIFQNKKRVLAVEGSGKEKLPRYHRNVGLGFKTPREAIDGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVTVGDIVTVGECRPLSKTVRFNVL 144          
BLAST of SMED30026979 vs. Ensembl Zebrafish
Match: si:dkey-159f12.2 (si:dkey-159f12.2 [Source:ZFIN;Acc:ZDB-GENE-081105-168])

HSP 1 Score: 166.392 bits (420), Expect = 1.849e-52
Identity = 82/144 (56.94%), Postives = 105/144 (72.92%), Query Frame = -1
Query:   70 LNMEQTERAYQKQEV--RGKKG----------SRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 465
            + + Q  R YQKQ    + KKG             RY++++GLG+K PREAI+G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRD LH+++KYNRFEKRHKN+SVH+SP FRD+ VGD V VGE + L+KTV FNVL
Sbjct:    1 MAVTQNVRDYQKQPTIFQNKKGVLAVEGSGKEKLPRYHRNVGLGFKNPREAIDGTYIDKKCPFTGNVSIRGWILSGVVTKMKMQRTIVIRRDNLHYIRKYNRFEKRHKNMSVHLSPCFRDVTVGDIVTVGEWQTLSKTVRFNVL 144          
BLAST of SMED30026979 vs. Ensembl Zebrafish
Match: si:dkey-159f12.2 (si:dkey-159f12.2 [Source:ZFIN;Acc:ZDB-GENE-081105-168])

HSP 1 Score: 165.622 bits (418), Expect = 2.165e-52
Identity = 82/144 (56.94%), Postives = 105/144 (72.92%), Query Frame = -1
Query:   70 LNMEQTERAYQKQEV--RGKKG----------SRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 465
            + + Q  R YQKQ    + KKG             RY++++GLG+K PREAI+G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRD LH+++KYNRFEKRHKN+SVH+SP FRD+ VGD V VGE + L+KTV FNVL
Sbjct:    1 MAVTQNVRDYQKQPTIFQNKKGVLAVEGSGKEKLPRYHRNVGLGFKNPREAIDGTYIDKKCPFTGNVSIRGWILSGVVTKMKMQRTIVIRRDNLHYIRKYNRFEKRHKNMSVHLSPCFRDVTVGDIVTVGEWQTLSKTVRFNVL 144          
BLAST of SMED30026979 vs. Ensembl Xenopus
Match: rps11 (ribosomal protein S11 [Source:NCBI gene;Acc:448693])

HSP 1 Score: 154.836 bits (390), Expect = 2.245e-46
Identity = 71/114 (62.28%), Postives = 90/114 (78.95%), Query Frame = -1
Query:  145 QTERAYQKQE---------VRGKKGSR--NRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFR 453
            QTERAYQKQ          ++G+ G     RYY+++GLG+KTPREAI+G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FR
Sbjct:   49 QTERAYQKQPTIFQNKKRVLQGETGKEKLPRYYRNVGLGFKTPREAIDGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFR 162          
BLAST of SMED30026979 vs. Ensembl Mouse
Match: Rps11 (ribosomal protein S11 [Source:MGI Symbol;Acc:MGI:1351329])

HSP 1 Score: 189.119 bits (479), Expect = 1.348e-61
Identity = 90/139 (64.75%), Postives = 109/139 (78.42%), Query Frame = -1
Query:   70 QTERAYQKQE---------VRGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            QTERAYQKQ          + G+ G     RYYK+IGLG+KTP+EAI G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ +GD V VGECRPL+KTV FNVL
Sbjct:    5 QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVL 143          
BLAST of SMED30026979 vs. Ensembl Mouse
Match: Rps11 (ribosomal protein S11 [Source:MGI Symbol;Acc:MGI:1351329])

HSP 1 Score: 161.384 bits (407), Expect = 5.048e-51
Identity = 75/109 (68.81%), Postives = 88/109 (80.73%), Query Frame = -1
Query:   70 RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 396
            RYYK+IGLG+KTP+EAI G YIDKKCPFT           G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ +GD V VGECRPL+KTV FNVL
Sbjct:   23 RYYKNIGLGFKTPKEAIEGTYIDKKCPFT-----------GVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVL 120          
BLAST of SMED30026979 vs. Ensembl Mouse
Match: Rps11 (ribosomal protein S11 [Source:MGI Symbol;Acc:MGI:1351329])

HSP 1 Score: 149.443 bits (376), Expect = 2.042e-46
Identity = 72/115 (62.61%), Postives = 88/115 (76.52%), Query Frame = -1
Query:  142 QTERAYQKQE---------VRGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRD 453
            QTERAYQKQ          + G+ G     RYYK+IGLG+KTP+EAI G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FR 
Sbjct:    5 QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRS 119          
BLAST of SMED30026979 vs. UniProt/SwissProt
Match: sp|P41115|RS11_XENLA (40S ribosomal protein S11 OS=Xenopus laevis OX=8355 GN=rps11 PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 5.120e-63
Identity = 92/139 (66.19%), Postives = 111/139 (79.86%), Query Frame = -1
Query:   70 QTERAYQKQE---------VRGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            QTERAYQKQ          + G+ G     RYY+S+GLG+KTPREAI+G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ VGDTV VGECRPL+KTV FNVL
Sbjct:    5 QTERAYQKQPTIFQNKKRVLEGETGKEKLPRYYRSVGLGFKTPREAIDGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQVGDTVTVGECRPLSKTVRFNVL 143          
BLAST of SMED30026979 vs. UniProt/SwissProt
Match: sp|P62282|RS11_RAT (40S ribosomal protein S11 OS=Rattus norvegicus OX=10116 GN=Rps11 PE=1 SV=3)

HSP 1 Score: 189.119 bits (479), Expect = 9.428e-61
Identity = 90/139 (64.75%), Postives = 109/139 (78.42%), Query Frame = -1
Query:   70 QTERAYQKQE---------VRGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            QTERAYQKQ          + G+ G     RYYK+IGLG+KTP+EAI G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ +GD V VGECRPL+KTV FNVL
Sbjct:    5 QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVL 143          
BLAST of SMED30026979 vs. UniProt/SwissProt
Match: sp|P62281|RS11_MOUSE (40S ribosomal protein S11 OS=Mus musculus OX=10090 GN=Rps11 PE=1 SV=3)

HSP 1 Score: 189.119 bits (479), Expect = 9.428e-61
Identity = 90/139 (64.75%), Postives = 109/139 (78.42%), Query Frame = -1
Query:   70 QTERAYQKQE---------VRGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            QTERAYQKQ          + G+ G     RYYK+IGLG+KTP+EAI G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ +GD V VGECRPL+KTV FNVL
Sbjct:    5 QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVL 143          
BLAST of SMED30026979 vs. UniProt/SwissProt
Match: sp|P61270|RS11_MACFA (40S ribosomal protein S11 OS=Macaca fascicularis OX=9541 GN=RPS11 PE=2 SV=3)

HSP 1 Score: 189.119 bits (479), Expect = 9.428e-61
Identity = 90/139 (64.75%), Postives = 109/139 (78.42%), Query Frame = -1
Query:   70 QTERAYQKQE---------VRGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            QTERAYQKQ          + G+ G     RYYK+IGLG+KTP+EAI G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ +GD V VGECRPL+KTV FNVL
Sbjct:    5 QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVL 143          
BLAST of SMED30026979 vs. UniProt/SwissProt
Match: sp|P62280|RS11_HUMAN (40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3)

HSP 1 Score: 189.119 bits (479), Expect = 9.428e-61
Identity = 90/139 (64.75%), Postives = 109/139 (78.42%), Query Frame = -1
Query:   70 QTERAYQKQE---------VRGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            QTERAYQKQ          + G+ G     RYYK+IGLG+KTP+EAI G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ +GD V VGECRPL+KTV FNVL
Sbjct:    5 QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVL 143          
BLAST of SMED30026979 vs. TrEMBL
Match: A0A0R3W3Z7 (Ribosomal_S17_N domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4699 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 6.017e-66
Identity = 98/129 (75.97%), Postives = 113/129 (87.60%), Query Frame = -1
Query:   70 EQTERAYQKQEVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 456
            EQTERAYQKQ++ GKKGSR  YYKSIGLGYKTP+EAI G YIDKKCPFTSDV IRG ++TG V K+KMNRT VIRRDY+ +V+KY RFEKRHKN+SVH+SP FRD+ VGDTV  GECRPL+KTVS+NV+
Sbjct:    3 EQTERAYQKQKLLGKKGSR--YYKSIGLGYKTPKEAIFGTYIDKKCPFTSDVTIRGRILTGTVRKMKMNRTIVIRRDYMKYVRKYKRFEKRHKNMSVHMSPCFRDVQVGDTVTCGECRPLSKTVSYNVI 129          
BLAST of SMED30026979 vs. TrEMBL
Match: A0A068Y8A8 (40S ribosomal protein S11 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000861700 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 1.018e-65
Identity = 98/129 (75.97%), Postives = 112/129 (86.82%), Query Frame = -1
Query:   70 EQTERAYQKQEVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 456
            EQ ERAYQKQ++ GKKGSR  YYKSIGLGYKTP+EAI G YIDKKCPFTSDV IRG ++TG V K+KMNRT VIRRDY+ +VKKY RFEKRHKN+SVH+SP FRD+ VGDTV  GECRPL+KTVS+NV+
Sbjct:    3 EQIERAYQKQKLLGKKGSR--YYKSIGLGYKTPKEAIFGTYIDKKCPFTSDVTIRGRILTGTVQKMKMNRTIVIRRDYMKYVKKYKRFEKRHKNMSVHMSPCFRDVQVGDTVTCGECRPLSKTVSYNVI 129          
BLAST of SMED30026979 vs. TrEMBL
Match: A0A4S2LH29 (Ribosomal_S17_N domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007617 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.253e-65
Identity = 97/129 (75.19%), Postives = 114/129 (88.37%), Query Frame = -1
Query:   70 EQTERAYQKQEVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 456
            EQ E A+QKQEV+GKKG R  YYKSIGLGYKTP+EAI G YIDKKCPFT +V+IRG ++TG+V K+KMNRT VIRRDY+ +VKKYNR+EKRHKN+SVH+SP FRD+ VGDTV VGECRPL+KTVSFNV+
Sbjct:    3 EQKENAFQKQEVKGKKGGR--YYKSIGLGYKTPKEAIFGTYIDKKCPFTGNVRIRGRILTGVVRKMKMNRTIVIRRDYMKYVKKYNRYEKRHKNMSVHLSPCFRDVSVGDTVTVGECRPLSKTVSFNVI 129          
BLAST of SMED30026979 vs. TrEMBL
Match: A0A075ABJ9 (Ribosomal protein S17P OS=Opisthorchis viverrini OX=6198 GN=T265_07425 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.253e-65
Identity = 97/129 (75.19%), Postives = 114/129 (88.37%), Query Frame = -1
Query:   70 EQTERAYQKQEVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 456
            EQ E A+QKQEV+GKKG R  YYKSIGLGYKTP+EAI G YIDKKCPFT +V+IRG ++TG+V K+KMNRT VIRRDY+ +VKKYNR+EKRHKN+SVH+SP FRD+ VGDTV VGECRPL+KTVSFNV+
Sbjct:    3 EQKENAFQKQEVKGKKGGR--YYKSIGLGYKTPKEAIFGTYIDKKCPFTGNVRIRGRILTGVVRKMKMNRTIVIRRDYMKYVKKYNRYEKRHKNMSVHLSPCFRDVSVGDTVTVGECRPLSKTVSFNVI 129          
BLAST of SMED30026979 vs. TrEMBL
Match: U6J181 (40S ribosomal protein S11 OS=Echinococcus granulosus OX=6210 GN=EGR_01636 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 2.214e-65
Identity = 98/129 (75.97%), Postives = 112/129 (86.82%), Query Frame = -1
Query:   70 EQTERAYQKQEVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 456
            EQ ERAYQKQ++ GKKGSR  YYKSIGLGYKTP+EAI G YIDKKCPFTSDV IRG ++TG V K+KMNRT VIRRDY+ +VKKY RFEKRHKN+SVH+SP FRD+ VGDTV  GECRPL+KTVS+NV+
Sbjct:    3 EQIERAYQKQKLLGKKGSR--YYKSIGLGYKTPKEAIFGTYIDKKCPFTSDVTIRGRILTGTVRKMKMNRTIVIRRDYMKYVKKYKRFEKRHKNMSVHMSPCFRDVQVGDTVTCGECRPLSKTVSYNVI 129          
BLAST of SMED30026979 vs. Ensembl Cavefish
Match: si:dkey-159f12.2 (ribosomal protein S11 [Source:NCBI gene;Acc:103042701])

HSP 1 Score: 185.652 bits (470), Expect = 2.974e-60
Identity = 88/140 (62.86%), Postives = 105/140 (75.00%), Query Frame = -1
Query:   70 QTERAYQKQEV------------RGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            Q ERAYQ+Q               G K    RY+K++GLG+KTPREAI G YIDKKCPFT  V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ VGD V VGECRPL+KTV FNVL
Sbjct:   16 QNERAYQRQPTVFQNRKRVLVPEGGAKEKLPRYHKNVGLGFKTPREAIEGTYIDKKCPFTGSVSIRGRILSGVVTKIKMQRTIVIRRDYLHYIRKYNRFEKRHKNLSVHISPCFRDMAVGDIVTVGECRPLSKTVRFNVL 155          
BLAST of SMED30026979 vs. Ensembl Sea Lamprey
Match: si:dkey-159f12.2 (si:dkey-159f12.2 [Source:ZFIN;Acc:ZDB-GENE-081105-168])

HSP 1 Score: 197.208 bits (500), Expect = 1.382e-65
Identity = 93/139 (66.91%), Postives = 108/139 (77.70%), Query Frame = -1
Query:   70 QTERAYQKQEV-----------RGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            QTERAYQKQ               K+    RYYKS+GLG+KTPREAI G YIDKKCPFT +V IRG ++TG+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SPAFRD+ VGD V VGECRPL+KTV FNVL
Sbjct:    5 QTERAYQKQPTVFQNRKVLVSGSAKQKKVQRYYKSVGLGFKTPREAIEGTYIDKKCPFTGNVSIRGRILTGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPAFRDVQVGDIVTVGECRPLSKTVRFNVL 143          
BLAST of SMED30026979 vs. Ensembl Yeast
Match: RPS11A (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S11 and bacterial S17; N-terminally propionylated in vivo; RPS11A has a paralog, RPS11B, that arose from the whole genome duplication [Source:SGD;Acc:S000002432])

HSP 1 Score: 165.622 bits (418), Expect = 1.868e-53
Identity = 81/135 (60.00%), Postives = 104/135 (77.04%), Query Frame = -1
Query:   70 QTERAYQKQ-------EVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            Q+ERA+QKQ       +V+  K ++ R+YK+ GLG+KTP+ AI G YIDKKCPFT  V IRG ++TG V+  KM+RT VIRR YLH++ KYNR+EKRHKN+ VHVSPAFR + VGD V VG+CRP++KTV FNV+
Sbjct:    8 QSERAFQKQPHIFNNPKVKTSKRTK-RWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFR-VQVGDIVTVGQCRPISKTVRFNVV 140          
BLAST of SMED30026979 vs. Ensembl Yeast
Match: RPS11B (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S11 and bacterial S17; RPS11B has a paralog, RPS11A, that arose from the whole genome duplication [Source:SGD;Acc:S000000252])

HSP 1 Score: 165.622 bits (418), Expect = 1.868e-53
Identity = 81/135 (60.00%), Postives = 104/135 (77.04%), Query Frame = -1
Query:   70 QTERAYQKQ-------EVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            Q+ERA+QKQ       +V+  K ++ R+YK+ GLG+KTP+ AI G YIDKKCPFT  V IRG ++TG V+  KM+RT VIRR YLH++ KYNR+EKRHKN+ VHVSPAFR + VGD V VG+CRP++KTV FNV+
Sbjct:    8 QSERAFQKQPHIFNNPKVKTSKRTK-RWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFR-VQVGDIVTVGQCRPISKTVRFNVV 140          
BLAST of SMED30026979 vs. Ensembl Nematostella
Match: EDO47816 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL80])

HSP 1 Score: 177.178 bits (448), Expect = 1.585e-57
Identity = 83/139 (59.71%), Postives = 105/139 (75.54%), Query Frame = -1
Query:   70 EQTERAYQKQ--------EVRGK--KGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 456
            EQTERAYQKQ         V G+  K    R+ +++GLG+KTP++AI G YIDKKCPFT +V IRG ++TG+   +KM RT +IRRDYLH++KKYNRFEKRHKN++ H SP FRDI +GD + VG+CRPL+KTV FNVL
Sbjct:    3 EQTERAYQKQAPIFQNRKRVLGQVTKKKDLRFVRNVGLGFKTPKDAIEGTYIDKKCPFTGNVSIRGRILTGICRSMKMKRTIIIRRDYLHYIKKYNRFEKRHKNLAAHCSPCFRDIALGDLITVGQCRPLSKTVRFNVL 141          
BLAST of SMED30026979 vs. Ensembl Medaka
Match: si:dkey-159f12.2 (ribosomal protein S11 [Source:NCBI gene;Acc:101168463])

HSP 1 Score: 187.578 bits (475), Expect = 4.072e-61
Identity = 90/142 (63.38%), Postives = 109/142 (76.76%), Query Frame = -1
Query:   70 QTERAYQKQEV------------RGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 453
            QTER+YQKQ               GK+G     RY+KS+GLG+KTPR+AI G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ VGD V VGECRPL+KTV FNVL
Sbjct:    5 QTERSYQKQPTIFQNKKRVLLTDGGKEGKEKLPRYHKSVGLGFKTPRDAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNLSVHLSPCFRDVTVGDIVTVGECRPLSKTVRFNVL 146          
BLAST of SMED30026979 vs. Ensembl Medaka
Match: si:dkey-159f12.2 (ribosomal protein S11 [Source:NCBI gene;Acc:101168463])

HSP 1 Score: 185.652 bits (470), Expect = 3.134e-60
Identity = 89/141 (63.12%), Postives = 108/141 (76.60%), Query Frame = -1
Query:   70 TERAYQKQEV------------RGKKGSRN--RYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 450
            TER+YQKQ               GK+G     RY+KS+GLG+KTPR+AI G YIDKKCPFT +V IRG +++G+V K+KM RT VIRRDYLH+++KYNRFEKRHKN+SVH+SP FRD+ VGD V VGECRPL+KTV FNVL
Sbjct:   10 TERSYQKQPTIFQNKKRVLLTDGGKEGKEKLPRYHKSVGLGFKTPRDAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNLSVHLSPCFRDVTVGDIVTVGECRPLSKTVRFNVL 150          
BLAST of SMED30026979 vs. Planmine SMEST
Match: SMESG000076644.1 (SMESG000076644.1)

HSP 1 Score: 271.552 bits (693), Expect = 1.303e-94
Identity = 130/130 (100.00%), Postives = 130/130 (100.00%), Query Frame = -1
Query:   70 MEQTERAYQKQEVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 459
            MEQTERAYQKQEVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL
Sbjct:    1 MEQTERAYQKQEVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFTSDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHVSPAFRDIGVGDTVIVGECRPLAKTVSFNVL 130          
The following BLAST results are available for this feature:
BLAST of SMED30026979 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RPS111.963e-6164.75ribosomal protein S11 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS115.421e-4663.16ribosomal protein S11 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS115.989e-3275.00ribosomal protein S11 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of SMED30026979 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps-113.003e-5458.70Ribosomal Protein, Small subunit [Source:UniProtK... [more]
back to top
BLAST of SMED30026979 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RpS111.514e-5762.50gene:FBgn0033699 transcript:FBtr0088006[more]
RpS112.042e-5561.59gene:FBgn0033699 transcript:FBtr0088007[more]
back to top
BLAST of SMED30026979 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rps119.362e-6063.57ribosomal protein S11 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
si:dkey-159f12.21.849e-5256.94si:dkey-159f12.2 [Source:ZFIN;Acc:ZDB-GENE-081105-... [more]
si:dkey-159f12.22.165e-5256.94si:dkey-159f12.2 [Source:ZFIN;Acc:ZDB-GENE-081105-... [more]
back to top
BLAST of SMED30026979 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps112.245e-4662.28ribosomal protein S11 [Source:NCBI gene;Acc:448693... [more]
back to top
BLAST of SMED30026979 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rps111.348e-6164.75ribosomal protein S11 [Source:MGI Symbol;Acc:MGI:1... [more]
Rps115.048e-5168.81ribosomal protein S11 [Source:MGI Symbol;Acc:MGI:1... [more]
Rps112.042e-4662.61ribosomal protein S11 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of SMED30026979 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41115|RS11_XENLA5.120e-6366.1940S ribosomal protein S11 OS=Xenopus laevis OX=835... [more]
sp|P62282|RS11_RAT9.428e-6164.7540S ribosomal protein S11 OS=Rattus norvegicus OX=... [more]
sp|P62281|RS11_MOUSE9.428e-6164.7540S ribosomal protein S11 OS=Mus musculus OX=10090... [more]
sp|P61270|RS11_MACFA9.428e-6164.7540S ribosomal protein S11 OS=Macaca fascicularis O... [more]
sp|P62280|RS11_HUMAN9.428e-6164.7540S ribosomal protein S11 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of SMED30026979 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3W3Z76.017e-6675.97Ribosomal_S17_N domain-containing protein OS=Taeni... [more]
A0A068Y8A81.018e-6575.9740S ribosomal protein S11 OS=Echinococcus multiloc... [more]
A0A4S2LH291.253e-6575.19Ribosomal_S17_N domain-containing protein OS=Opist... [more]
A0A075ABJ91.253e-6575.19Ribosomal protein S17P OS=Opisthorchis viverrini O... [more]
U6J1812.214e-6575.9740S ribosomal protein S11 OS=Echinococcus granulos... [more]
back to top
BLAST of SMED30026979 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-159f12.22.974e-6062.86ribosomal protein S11 [Source:NCBI gene;Acc:103042... [more]
back to top
BLAST of SMED30026979 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-159f12.21.382e-6566.91si:dkey-159f12.2 [Source:ZFIN;Acc:ZDB-GENE-081105-... [more]
back to top
BLAST of SMED30026979 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPS11A1.868e-5360.00Protein component of the small (40S) ribosomal sub... [more]
RPS11B1.868e-5360.00Protein component of the small (40S) ribosomal sub... [more]
back to top
BLAST of SMED30026979 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO478161.585e-5759.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30026979 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-159f12.24.072e-6163.38ribosomal protein S11 [Source:NCBI gene;Acc:101168... [more]
si:dkey-159f12.23.134e-6063.12ribosomal protein S11 [Source:NCBI gene;Acc:101168... [more]
back to top
BLAST of SMED30026979 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000076644.11.303e-94100.00SMESG000076644.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026979 ID=SMED30026979|Name=SMED30026979|organism=Schmidtea mediterranea sexual|type=transcript|length=543bp
AATATCCAAATTTTTATTGTTAAATTATGCGCTCTTCTTTGATTTATCAG
AAGAAGCCTTTGATATTTTCAAAACATTGAAGCTAACAGTTTTGGCCAAT
GGTCTGCATTCTCCAACGATAACGGTATCTCCAACTCCGATATCCCTGAA
AGCTGGTGAAACATGGACAGAAATATTCTTGTGTCTTTTTTCAAATCTGT
TATATTTTTTAACAAAGTGCAAATAATCTCGTCGAATAACTGCAGTTCTG
TTCATTTTCAATTTCATAACAAGACCAGTAATGACATGTCCTCTGATTTT
AACATCAGATGTGAATGGGCATTTCTTATCGATGTAATGACCATTTATTG
CTTCCCTTGGAGTTTTATATCCCAAACCAATACTTTTATAGTAACGGTTT
CTCGAACCCTTTTTACCTCTAACTTCTTGTTTTTGATAAGCTCTTTCAGT
TTGCTCCATATTAAGATTTAAAAATATTATGTTCGCTTTAAACAGATTAT
TTAAACAATAATAGTGTATTAAAAAAATTGATATAAAAATTTA
back to top

protein sequence of SMED30026979-orf-1

>SMED30026979-orf-1 ID=SMED30026979-orf-1|Name=SMED30026979-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MEQTERAYQKQEVRGKKGSRNRYYKSIGLGYKTPREAINGHYIDKKCPFT
SDVKIRGHVITGLVMKLKMNRTAVIRRDYLHFVKKYNRFEKRHKNISVHV
SPAFRDIGVGDTVIVGECRPLAKTVSFNVLKISKASSDKSKKSA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000266Ribosomal_S17/S11
IPR012340NA-bd_OB-fold
IPR032440Ribosomal_S11_N
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation