Transcription elongation factor 1 homolog

Overview
NameTranscription elongation factor 1 homolog
Smed IDSMED30026970
Length (bp)398
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription elongation factor 1 homolog (SMED30026970) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription elongation factor 1 homolog (SMED30026970) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription elongation factor 1 homolog (SMED30026970) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription elongation factor 1 homolog (SMED30026970) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026970

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026970 SmedASXL_019174SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Human
Match: ELOF1 (elongation factor 1 homolog [Source:HGNC Symbol;Acc:HGNC:28691])

HSP 1 Score: 87.0409 bits (214), Expect = 9.293e-23
Identity = 35/59 (59.32%), Postives = 43/59 (72.88%), Query Frame = 2
Query:  155 FKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   45 FTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 103          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Human
Match: ELOF1 (elongation factor 1 homolog [Source:HGNC Symbol;Acc:HGNC:28691])

HSP 1 Score: 86.2705 bits (212), Expect = 1.092e-22
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   27 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 89          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Human
Match: ELOF1 (elongation factor 1 homolog [Source:HGNC Symbol;Acc:HGNC:28691])

HSP 1 Score: 85.8853 bits (211), Expect = 1.773e-22
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Human
Match: ELOF1 (elongation factor 1 homolog [Source:HGNC Symbol;Acc:HGNC:28691])

HSP 1 Score: 85.8853 bits (211), Expect = 1.773e-22
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Human
Match: ELOF1 (elongation factor 1 homolog [Source:HGNC Symbol;Acc:HGNC:28691])

HSP 1 Score: 85.8853 bits (211), Expect = 1.773e-22
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Celegans
Match: Y54G11A.11 (Transcription elongation factor 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9XVZ8])

HSP 1 Score: 119.013 bits (297), Expect = 4.654e-36
Identity = 49/83 (59.04%), Postives = 64/83 (77.11%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEINN 334
            MG+R+S+RK P K K ++PL   F CPFCNH+  C V + RE+ +GYI C++C EDFQT INYLS+ IDVY+DW+DACE+ NN
Sbjct:    1 MGKRKSKRKAPTKAKAVMPLDTQFNCPFCNHERVCEVKMDREKNVGYISCRVCSEDFQTNINYLSEPIDVYSDWVDACEQANN 83          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Celegans
Match: Y54G11A.11 (Transcription elongation factor 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9XVZ8])

HSP 1 Score: 119.013 bits (297), Expect = 4.654e-36
Identity = 49/83 (59.04%), Postives = 64/83 (77.11%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEINN 334
            MG+R+S+RK P K K ++PL   F CPFCNH+  C V + RE+ +GYI C++C EDFQT INYLS+ IDVY+DW+DACE+ NN
Sbjct:    1 MGKRKSKRKAPTKAKAVMPLDTQFNCPFCNHERVCEVKMDREKNVGYISCRVCSEDFQTNINYLSEPIDVYSDWVDACEQANN 83          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Fly
Match: CG40228 (gene:FBgn0063670 transcript:FBtr0113841)

HSP 1 Score: 115.931 bits (289), Expect = 9.177e-35
Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRR+S+RKPPPK K I PL + F CPFCNH++SC V + +      I C++CLEDFQT IN+LS+ IDVYNDW+DACE  N
Sbjct:    1 MGRRKSKRKPPPKRKNIEPLDQQFNCPFCNHEKSCEVKMDKSRNTAKITCRVCLEDFQTGINFLSEPIDVYNDWVDACETAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Fly
Match: CG40228 (gene:FBgn0063670 transcript:FBtr0333870)

HSP 1 Score: 115.931 bits (289), Expect = 9.177e-35
Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRR+S+RKPPPK K I PL + F CPFCNH++SC V + +      I C++CLEDFQT IN+LS+ IDVYNDW+DACE  N
Sbjct:    1 MGRRKSKRKPPPKRKNIEPLDQQFNCPFCNHEKSCEVKMDKSRNTAKITCRVCLEDFQTGINFLSEPIDVYNDWVDACETAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Fly
Match: CG6244 (gene:FBgn0036531 transcript:FBtr0075502)

HSP 1 Score: 107.071 bits (266), Expect = 3.131e-31
Identity = 48/82 (58.54%), Postives = 60/82 (73.17%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRR+S+RK  P+ K I PL  +F CPFCNH +SC   L + ++IG I C +C E FQT INYL++ IDV+NDWIDACEE N
Sbjct:    1 MGRRKSKRKGAPRKKNIQPLPILFDCPFCNHKQSCEAKLDKAKKIGRITCTVCQEFFQTHINYLTEAIDVFNDWIDACEEEN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Fly
Match: CG40228 (gene:FBgn0063670 transcript:FBtr0333871)

HSP 1 Score: 105.145 bits (261), Expect = 1.433e-30
Identity = 48/82 (58.54%), Postives = 59/82 (71.95%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRR+S+RKPPPK K I PL + F CPFCNH++S      +      I C++CLEDFQT IN+LS+ IDVYNDW+DACE  N
Sbjct:    1 MGRRKSKRKPPPKRKNIEPLDQQFNCPFCNHEKS-----DKSRNTAKITCRVCLEDFQTGINFLSEPIDVYNDWVDACETAN 77          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Fly
Match: CG40228 (gene:FBgn0063670 transcript:FBtr0333872)

HSP 1 Score: 53.1434 bits (126), Expect = 1.690e-10
Identity = 23/34 (67.65%), Postives = 28/34 (82.35%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDES 187
            MGRR+S+RKPPPK K I PL + F CPFCNH++S
Sbjct:    1 MGRRKSKRKPPPKRKNIEPLDQQFNCPFCNHEKS 34          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Zebrafish
Match: elof1 (ELF1 homolog, elongation factor 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1385])

HSP 1 Score: 85.8853 bits (211), Expect = 1.045e-22
Identity = 36/63 (57.14%), Postives = 45/63 (71.43%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V ++R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LDTQFTCPFCNHEKSCDVKMERSRNTGIISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Xenopus
Match: irf10 (interferon regulatory factor 10 [Source:Xenbase;Acc:XB-GENE-1033046])

HSP 1 Score: 86.2705 bits (212), Expect = 9.220e-23
Identity = 49/84 (58.33%), Postives = 60/84 (71.43%), Query Frame = 2
Query:   80 SEMGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            +EMGRR+S+RKPPPK K    L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:    3 AEMGRRKSKRKPPPKKKMTGNLDTQFTCPFCNHEKSCDVKMDRSRNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 86          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Mouse
Match: Elof1 (ELF1 homolog, elongation factor 1 [Source:MGI Symbol;Acc:MGI:1913376])

HSP 1 Score: 85.8853 bits (211), Expect = 1.217e-22
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Mouse
Match: Elof1 (ELF1 homolog, elongation factor 1 [Source:MGI Symbol;Acc:MGI:1913376])

HSP 1 Score: 85.8853 bits (211), Expect = 1.217e-22
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Mouse
Match: Elof1 (ELF1 homolog, elongation factor 1 [Source:MGI Symbol;Acc:MGI:1913376])

HSP 1 Score: 85.8853 bits (211), Expect = 1.217e-22
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Mouse
Match: Elof1 (ELF1 homolog, elongation factor 1 [Source:MGI Symbol;Acc:MGI:1913376])

HSP 1 Score: 85.8853 bits (211), Expect = 1.217e-22
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Mouse
Match: Elof1 (ELF1 homolog, elongation factor 1 [Source:MGI Symbol;Acc:MGI:1913376])

HSP 1 Score: 85.8853 bits (211), Expect = 1.217e-22
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. UniProt/SwissProt
Match: sp|Q9XVZ8|ELOF1_CAEEL (Transcription elongation factor 1 homolog OS=Caenorhabditis elegans OX=6239 GN=Y54G11A.11 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 5.920e-35
Identity = 49/83 (59.04%), Postives = 64/83 (77.11%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEINN 334
            MG+R+S+RK P K K ++PL   F CPFCNH+  C V + RE+ +GYI C++C EDFQT INYLS+ IDVY+DW+DACE+ NN
Sbjct:    1 MGKRKSKRKAPTKAKAVMPLDTQFNCPFCNHERVCEVKMDREKNVGYISCRVCSEDFQTNINYLSEPIDVYSDWVDACEQANN 83          
BLAST of Transcription elongation factor 1 homolog vs. UniProt/SwissProt
Match: sp|Q8MQI6|ELOF1_DROME (Transcription elongation factor 1 homolog OS=Drosophila melanogaster OX=7227 GN=CG40228 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 9.199e-34
Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRR+S+RKPPPK K I PL + F CPFCNH++SC V + +      I C++CLEDFQT IN+LS+ IDVYNDW+DACE  N
Sbjct:    1 MGRRKSKRKPPPKRKNIEPLDQQFNCPFCNHEKSCEVKMDKSRNTAKITCRVCLEDFQTGINFLSEPIDVYNDWVDACETAN 82          
BLAST of Transcription elongation factor 1 homolog vs. UniProt/SwissProt
Match: sp|Q9U501|ELOF1_MANSE (Transcription elongation factor 1 homolog OS=Manduca sexta OX=7130 PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 7.848e-33
Identity = 49/82 (59.76%), Postives = 60/82 (73.17%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRR+S+RKPPPK K I PL + F CPFCNH++SC V + R +    I+C +CLEDF T  N LS+ IDVYNDW+DACE  N
Sbjct:    1 MGRRKSKRKPPPKRKAIEPLDQQFNCPFCNHEKSCEVKMDRAKNTAMIQCTVCLEDFHTTTNVLSEPIDVYNDWVDACESAN 82          
BLAST of Transcription elongation factor 1 homolog vs. UniProt/SwissProt
Match: sp|Q8LHP0|ELOF1_ORYSJ (Transcription elongation factor 1 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0631100 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.210e-23
Identity = 40/83 (48.19%), Postives = 55/83 (66.27%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEINN 334
            MG+R+S  KPPPK K++  L  VF CPFCNH  S    +  +  IG   C+IC E+F T +N L++ ID+Y++WID CE +NN
Sbjct:    1 MGKRKSAAKPPPK-KRMDKLDTVFSCPFCNHGSSVECRIDMKNLIGEASCRICQENFSTTVNALTEPIDIYSEWIDECERVNN 82          
BLAST of Transcription elongation factor 1 homolog vs. UniProt/SwissProt
Match: sp|P60003|ELOF1_MOUSE (Transcription elongation factor 1 homolog OS=Mus musculus OX=10090 GN=Elof1 PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 8.512e-22
Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V + R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. TrEMBL
Match: A0A095A366 (Transcription elongation factor 1 homolog OS=Schistosoma haematobium OX=6185 GN=MS3_09749 PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.495e-41
Identity = 66/82 (80.49%), Postives = 68/82 (82.93%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRRRS  KPPPK K I+PL KVF CPFCNH  SC V LQR+  IGYIKC ICLEDFQTKINYLSQEIDVYNDWIDACEE N
Sbjct:    1 MGRRRSSNKPPPKRKAIVPLDKVFNCPFCNHGRSCEVILQRDNNIGYIKCTICLEDFQTKINYLSQEIDVYNDWIDACEEAN 82          
BLAST of Transcription elongation factor 1 homolog vs. TrEMBL
Match: A0A430PYY9 (Transcription elongation factor 1 homolog OS=Schistosoma bovis OX=6184 GN=DC041_0007802 PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.495e-41
Identity = 66/82 (80.49%), Postives = 68/82 (82.93%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRRRS  KPPPK K I+PL KVF CPFCNH  SC V LQR+  IGYIKC ICLEDFQTKINYLSQEIDVYNDWIDACEE N
Sbjct:    1 MGRRRSSNKPPPKRKAIVPLDKVFNCPFCNHGRSCEVILQRDNNIGYIKCTICLEDFQTKINYLSQEIDVYNDWIDACEEAN 82          
BLAST of Transcription elongation factor 1 homolog vs. TrEMBL
Match: A0A183NHD6 (Transcription elongation factor 1 homolog OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS1522 PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.495e-41
Identity = 66/82 (80.49%), Postives = 68/82 (82.93%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRRRS  KPPPK K I+PL KVF CPFCNH  SC V LQR+  IGYIKC ICLEDFQTKINYLSQEIDVYNDWIDACEE N
Sbjct:    1 MGRRRSSNKPPPKRKAIVPLDKVFNCPFCNHGRSCEVILQRDNNIGYIKCTICLEDFQTKINYLSQEIDVYNDWIDACEEAN 82          
BLAST of Transcription elongation factor 1 homolog vs. TrEMBL
Match: A0A183MXN5 (Transcription elongation factor 1 homolog OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS20810 PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.495e-41
Identity = 66/82 (80.49%), Postives = 68/82 (82.93%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRRRS  KPPPK K I+PL KVF CPFCNH  SC V LQR+  IGYIKC ICLEDFQTKINYLSQEIDVYNDWIDACEE N
Sbjct:    1 MGRRRSSNKPPPKRKAIVPLDKVFNCPFCNHGRSCEVILQRDNNIGYIKCTICLEDFQTKINYLSQEIDVYNDWIDACEEAN 82          
BLAST of Transcription elongation factor 1 homolog vs. TrEMBL
Match: A0A504YTF9 (Transcription elongation factor 1 homolog OS=Fasciola gigantica OX=46835 GN=FGIG_06202 PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.316e-40
Identity = 65/82 (79.27%), Postives = 68/82 (82.93%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRRRS  KPPPK K I PL KVF CPFCNH+ SC V LQR+  IGYIKC ICLEDFQTKINYLSQE+DVYNDWIDACEE N
Sbjct:    1 MGRRRSSNKPPPKKKAIQPLEKVFNCPFCNHERSCEVVLQRDNNIGYIKCTICLEDFQTKINYLSQEVDVYNDWIDACEEAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Cavefish
Match: ELOF1 (elongation factor 1 homolog [Source:NCBI gene;Acc:103037562])

HSP 1 Score: 85.8853 bits (211), Expect = 8.116e-23
Identity = 36/63 (57.14%), Postives = 45/63 (71.43%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V ++R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LDTQFTCPFCNHEKSCDVKMERSRNTGIISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Yeast
Match: ELF1 (Transcription elongation factor with a conserved zinc finger domain; implicated in the maintenance of proper chromatin structure in actively transcribed regions; deletion inhibits Brome mosaic virus (BMV) gene expression [Source:SGD;Acc:S000001643])

HSP 1 Score: 84.7297 bits (208), Expect = 1.305e-22
Identity = 38/83 (45.78%), Postives = 55/83 (66.27%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEINN 334
            MG+R+   + P K + +  L   F C FCNH++S +  L ++  IG + CKIC + FQT+IN LSQ +DVY+DW DA EE+N+
Sbjct:    1 MGKRKKSTRKPTK-RLVQKLDTKFNCLFCNHEKSVSCTLDKKNSIGTLSCKICGQSFQTRINSLSQPVDVYSDWFDAVEEVNS 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Nematostella
Match: EDO43928 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXA0])

HSP 1 Score: 107.457 bits (267), Expect = 8.681e-32
Identity = 49/82 (59.76%), Postives = 62/82 (75.61%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRRRS+RKP P TK+  PL   F CPFCNH++SC V L R + +GYI C++CLE +Q+ I YLS+ +DVY+DWIDACE  N
Sbjct:    1 MGRRRSKRKPAP-TKRKDPLDVQFNCPFCNHEKSCEVKLDRVKNMGYISCRVCLETYQSSITYLSEPVDVYSDWIDACELAN 81          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Nematostella
Match: EDO26288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXA0])

HSP 1 Score: 107.457 bits (267), Expect = 8.681e-32
Identity = 49/82 (59.76%), Postives = 62/82 (75.61%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            MGRRRS+RKP P TK+  PL   F CPFCNH++SC V L R + +GYI C++CLE +Q+ I YLS+ +DVY+DWIDACE  N
Sbjct:    1 MGRRRSKRKPAP-TKRKDPLDVQFNCPFCNHEKSCEVKLDRVKNMGYISCRVCLETYQSSITYLSEPVDVYSDWIDACELAN 81          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Medaka
Match: ENSORLT00000004474.2 (transcription elongation factor 1 homolog [Source:NCBI gene;Acc:101173766])

HSP 1 Score: 86.2705 bits (212), Expect = 4.834e-23
Identity = 36/63 (57.14%), Postives = 45/63 (71.43%), Query Frame = 2
Query:  143 LAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            L   F CPFCNH++SC V ++R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   20 LESQFTCPFCNHEKSCDVKMERSRNTGIISCSVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 82          
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Medaka
Match: ELOF1 (transcription elongation factor 1 homolog [Source:NCBI gene;Acc:101167459])

HSP 1 Score: 86.6557 bits (213), Expect = 5.164e-23
Identity = 35/59 (59.32%), Postives = 44/59 (74.58%), Query Frame = 2
Query:  155 FKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEIN 331
            F CPFCNH++SC V ++R    G I C +CLE+FQT I YLS+ +DVY+DWIDACE  N
Sbjct:   34 FTCPFCNHEKSCDVKMERTRNTGIISCSVCLEEFQTPITYLSEPVDVYSDWIDACEAAN 92          
BLAST of Transcription elongation factor 1 homolog vs. Planmine SMEST
Match: SMESG000077094.1 (SMESG000077094.1)

HSP 1 Score: 174.481 bits (441), Expect = 7.171e-58
Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 2
Query:   86 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEINN 334
            MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEINN
Sbjct:    1 MGRRRSQRKPPPKTKQIIPLAKVFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYNDWIDACEEINN 83          
The following BLAST results are available for this feature:
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ELOF19.293e-2359.32elongation factor 1 homolog [Source:HGNC Symbol;Ac... [more]
ELOF11.092e-2257.14elongation factor 1 homolog [Source:HGNC Symbol;Ac... [more]
ELOF11.773e-2257.14elongation factor 1 homolog [Source:HGNC Symbol;Ac... [more]
ELOF11.773e-2257.14elongation factor 1 homolog [Source:HGNC Symbol;Ac... [more]
ELOF11.773e-2257.14elongation factor 1 homolog [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y54G11A.114.654e-3659.04Transcription elongation factor 1 homolog [Source... [more]
Y54G11A.114.654e-3659.04Transcription elongation factor 1 homolog [Source... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG402289.177e-3560.98gene:FBgn0063670 transcript:FBtr0113841[more]
CG402289.177e-3560.98gene:FBgn0063670 transcript:FBtr0333870[more]
CG62443.131e-3158.54gene:FBgn0036531 transcript:FBtr0075502[more]
CG402281.433e-3058.54gene:FBgn0063670 transcript:FBtr0333871[more]
CG402281.690e-1067.65gene:FBgn0063670 transcript:FBtr0333872[more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
elof11.045e-2257.14ELF1 homolog, elongation factor 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
irf109.220e-2358.33interferon regulatory factor 10 [Source:Xenbase;Ac... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Elof11.217e-2257.14ELF1 homolog, elongation factor 1 [Source:MGI Symb... [more]
Elof11.217e-2257.14ELF1 homolog, elongation factor 1 [Source:MGI Symb... [more]
Elof11.217e-2257.14ELF1 homolog, elongation factor 1 [Source:MGI Symb... [more]
Elof11.217e-2257.14ELF1 homolog, elongation factor 1 [Source:MGI Symb... [more]
Elof11.217e-2257.14ELF1 homolog, elongation factor 1 [Source:MGI Symb... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9XVZ8|ELOF1_CAEEL5.920e-3559.04Transcription elongation factor 1 homolog OS=Caeno... [more]
sp|Q8MQI6|ELOF1_DROME9.199e-3460.98Transcription elongation factor 1 homolog OS=Droso... [more]
sp|Q9U501|ELOF1_MANSE7.848e-3359.76Transcription elongation factor 1 homolog OS=Mandu... [more]
sp|Q8LHP0|ELOF1_ORYSJ3.210e-2348.19Transcription elongation factor 1 homolog OS=Oryza... [more]
sp|P60003|ELOF1_MOUSE8.512e-2257.14Transcription elongation factor 1 homolog OS=Mus m... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095A3663.495e-4180.49Transcription elongation factor 1 homolog OS=Schis... [more]
A0A430PYY93.495e-4180.49Transcription elongation factor 1 homolog OS=Schis... [more]
A0A183NHD63.495e-4180.49Transcription elongation factor 1 homolog OS=Schis... [more]
A0A183MXN53.495e-4180.49Transcription elongation factor 1 homolog OS=Schis... [more]
A0A504YTF91.316e-4079.27Transcription elongation factor 1 homolog OS=Fasci... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ELOF18.116e-2357.14elongation factor 1 homolog [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ELF11.305e-2245.78Transcription elongation factor with a conserved z... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO439288.681e-3259.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262888.681e-3259.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000004474.24.834e-2357.14transcription elongation factor 1 homolog [Source:... [more]
ELOF15.164e-2359.32transcription elongation factor 1 homolog [Source:... [more]
back to top
BLAST of Transcription elongation factor 1 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077094.17.171e-58100.00SMESG000077094.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026970 ID=SMED30026970|Name=Transcription elongation factor 1 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=398bp
CTGCACCGAGATCTGCACTCTATCCCGTCACAANNNTNTNNNNNTNNNNA
NAANTNAAAAAAACATTTTTCAAATAATTTCGGAAATGGGTCGCAGAAGA
TCACAAAGAAAGCCTCCACCTAAAACTAAACAGATTATTCCTTTGGCAAA
AGTTTTTAAATGTCCATTTTGTAATCACGATGAATCATGTACAGTTAATT
TGCAACGCGAAGAACGTATAGGGTATATCAAATGCAAAATATGTCTTGAA
GATTTTCAAACCAAAATTAATTATCTAAGTCAAGAAATTGATGTATATAA
TGACTGGATAGATGCCTGTGAAGAAATTAATAATTGAGCAGACTGTTTAT
TTATATTTTAATAAATGTGTATATAGTTCCAAAAAAAAAAAAAAAAAA
back to top

protein sequence of SMED30026970-orf-1

>SMED30026970-orf-1 ID=SMED30026970-orf-1|Name=SMED30026970-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
CTEICTLSRHXXXXXXXXXKNIFQIISEMGRRRSQRKPPPKTKQIIPLAK
VFKCPFCNHDESCTVNLQREERIGYIKCKICLEDFQTKINYLSQEIDVYN
DWIDACEEINN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003746translation elongation factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR038567T_Elf1_sf
IPR007808Elf1
Vocabulary: biological process
TermDefinition
GO:0006414translational elongation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038567Transcription elongation factor 1 superfamilyGENE3DG3DSA:2.20.25.190coord: 33..92
e-value: 2.9E-27
score: 96.3
IPR007808Transcription elongation factor 1PFAMPF05129Elf1coord: 11..89
e-value: 9.2E-29
score: 99.3
IPR007808Transcription elongation factor 1PANTHERPTHR20934UNCHARACTERIZEDcoord: 6..91
NoneNo IPR availableSUPERFAMILYSSF57783Zinc beta-ribboncoord: 10..91