Retinol dehydrogenase 13

Overview
NameRetinol dehydrogenase 13
Smed IDSMED30026959
Length (bp)1196
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retinol dehydrogenase 13 (SMED30026959) t-SNE clustered cells

Violin plots show distribution of expression levels for Retinol dehydrogenase 13 (SMED30026959) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retinol dehydrogenase 13 (SMED30026959) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retinol dehydrogenase 13 (SMED30026959) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026959

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026959SMESG000010198.1 SmedASXL_008309SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retinol dehydrogenase 13 vs. Ensembl Human
Match: RDH13 (retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:HGNC:19978])

HSP 1 Score: 110.538 bits (275), Expect = 9.258e-27
Identity = 81/291 (27.84%), Postives = 141/291 (48.45%), Query Frame = 3
Query:  102 RDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARAT--YNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLES 965
            +  + GK  ++TG  +GIG + A  LA++   ++L CR+++ C     +I  +T N ++    L+L S KSI  F  ++    ++VDIL+NNAG         T +  E Q  VN +G +LLT  L+  L AS  +R++ +       G I+ DD+N    KYN   A+ QS+L   L  K  ++    + +T NA +PG   T    R T  +  TF       +  L+++ P ++ +       ++ +  +SGK +  +++    PE    E+     +   +L  LE+
Sbjct:   33 KATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWT-TEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTEL-GRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGLEA 321          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Human
Match: RDH13 (retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:HGNC:19978])

HSP 1 Score: 110.538 bits (275), Expect = 9.258e-27
Identity = 81/291 (27.84%), Postives = 141/291 (48.45%), Query Frame = 3
Query:  102 RDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARAT--YNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLES 965
            +  + GK  ++TG  +GIG + A  LA++   ++L CR+++ C     +I  +T N ++    L+L S KSI  F  ++    ++VDIL+NNAG         T +  E Q  VN +G +LLT  L+  L AS  +R++ +       G I+ DD+N    KYN   A+ QS+L   L  K  ++    + +T NA +PG   T    R T  +  TF       +  L+++ P ++ +       ++ +  +SGK +  +++    PE    E+     +   +L  LE+
Sbjct:   33 KATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWT-TEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTEL-GRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGLEA 321          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Human
Match: DHRS12 (dehydrogenase/reductase 12 [Source:HGNC Symbol;Acc:HGNC:25832])

HSP 1 Score: 104.375 bits (259), Expect = 1.252e-24
Identity = 67/215 (31.16%), Postives = 112/215 (52.09%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLE-KYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNT--------AFHAR 725
             + G+V ++TGG SGIG   A  +A++   V L CR+     D R EI+ ++ NQNIF   ++L   K I  FVE       K+ +L+NNAG   +++ ELT + +EK  A N +G Y+LT  LIP+L      RV+ +      +  +NT+D+ S    ++    + Q++  + +  + + + +    I F++ +PG  +T         FHAR
Sbjct:   37 QIPGRVFLVTGGNSGIGKATALEIAKRGGTVHLVCRDQAPAEDARGEIIRESGNQNIFLHIVDLSDPKQIWKFVENFKQEH-KLHVLINNAGCMVNKR-ELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWAQGHPA--IHFSSMHPGWADTPGVRQAMPGFHAR 247          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Human
Match: RDH12 (retinol dehydrogenase 12 [Source:HGNC Symbol;Acc:HGNC:19977])

HSP 1 Score: 99.7525 bits (247), Expect = 5.662e-23
Identity = 76/264 (28.79%), Postives = 121/264 (45.83%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPE 899
             L GKV VITG  +GIG E A  LA + A V + CR++        EI   T+N  +   KL+L  +KSI  F E       ++ IL+NNAG         T +  E  L VN +G +LLT  L+  L  S  ARVV +      +G I   D+ S ++Y++  A+  S+L   L  +   K      +T  A +PG   +     ++     ++ F  +     ++      +T + C  ++G+  +SGK + D +   + P 
Sbjct:   36 QLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMC-PYSKTADGFETHLGVNHLGHFLLTYLLLERLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPF-----VKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPR 293          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Human
Match: RDH12 (retinol dehydrogenase 12 [Source:HGNC Symbol;Acc:HGNC:19977])

HSP 1 Score: 99.7525 bits (247), Expect = 5.662e-23
Identity = 76/264 (28.79%), Postives = 121/264 (45.83%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPE 899
             L GKV VITG  +GIG E A  LA + A V + CR++        EI   T+N  +   KL+L  +KSI  F E       ++ IL+NNAG         T +  E  L VN +G +LLT  L+  L  S  ARVV +      +G I   D+ S ++Y++  A+  S+L   L  +   K      +T  A +PG   +     ++     ++ F  +     ++      +T + C  ++G+  +SGK + D +   + P 
Sbjct:   36 QLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMC-PYSKTADGFETHLGVNHLGHFLLTYLLLERLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPF-----VKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPR 293          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Celegans
Match: dhs-22 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:Q9XVS9])

HSP 1 Score: 100.138 bits (248), Expect = 2.077e-23
Identity = 81/298 (27.18%), Postives = 132/298 (44.30%), Query Frame = 3
Query:   60 FLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIM----DKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARV------VYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTN---KITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPE 914
            F  + +    +++ER +  G VAV+TG   GIG E    L  + A V + CR+ +  ++ +  ++    D TR   I C   + ES +      E L +  D +DIL+NNAG     K E T +  EK    N +GP+LLT+  +P +  S  AR+      +++   + ++ T+  DD  S      YR   QS+L   +  +  TKE   +    +T N+ +PG  NT        N    K         +M+      +T +     K + GISGK + D +  +  P  L  +
Sbjct:   27 FFTRRYFKGGQFNERVSAKGLVAVVTGSNCGIGFETVRELNLRKADVYMLCRSEEKANEAKRMLVRQGCDATRLHFIECDLTDFESVRRAAK--ETLEST-DTIDILINNAGIMFQSKHEQTKDGHEKTWQSNHLGPFLLTELFLPAVKKSSYARIINVSSRIHLKSEKINLATV--DDKKSFGMMKSYR---QSKLANVMHARALTKELRKDGAEHVTVNSLHPGVVNTELARNTILNTPGIKQITAVFRWFLMKTSRDGAQTSIFLALGKKIGGISGKYFADCKLTQENPLALDDQ 316          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Celegans
Match: dhs-22 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:Q9XVS9])

HSP 1 Score: 100.138 bits (248), Expect = 2.077e-23
Identity = 81/298 (27.18%), Postives = 132/298 (44.30%), Query Frame = 3
Query:   60 FLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIM----DKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARV------VYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTN---KITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPE 914
            F  + +    +++ER +  G VAV+TG   GIG E    L  + A V + CR+ +  ++ +  ++    D TR   I C   + ES +      E L +  D +DIL+NNAG     K E T +  EK    N +GP+LLT+  +P +  S  AR+      +++   + ++ T+  DD  S      YR   QS+L   +  +  TKE   +    +T N+ +PG  NT        N    K         +M+      +T +     K + GISGK + D +  +  P  L  +
Sbjct:   27 FFTRRYFKGGQFNERVSAKGLVAVVTGSNCGIGFETVRELNLRKADVYMLCRSEEKANEAKRMLVRQGCDATRLHFIECDLTDFESVRRAAK--ETLEST-DTIDILINNAGIMFQSKHEQTKDGHEKTWQSNHLGPFLLTELFLPAVKKSSYARIINVSSRIHLKSEKINLATV--DDKKSFGMMKSYR---QSKLANVMHARALTKELRKDGAEHVTVNSLHPGVVNTELARNTILNTPGIKQITAVFRWFLMKTSRDGAQTSIFLALGKKIGGISGKYFADCKLTQENPLALDDQ 316          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Celegans
Match: dhs-24 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:Q9U1Y6])

HSP 1 Score: 99.3673 bits (246), Expect = 7.979e-23
Identity = 70/232 (30.17%), Postives = 122/232 (52.59%), Query Frame = 3
Query:   54 GYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSN---RFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKS-ARVVYM----ICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHAR 725
            GY ++       KY   ++L+GK  ++TG  SGIG   A  LA+++A V++ CRN + C   R +I+  TRN+ ++C + +LE   SI  FV++LS      D++D +V+NA    S +  +  + IEK +A N +G +LLT  L+  L A  +  R+V++    I  +  +   + +  N+ +K++ Y  +  S+L   L  K  ++  S   I     +PG T +   A+
Sbjct:   27 GYHVWDSTQSGTKYDLHEDLAGKTYIVTGATSGIGQATAEELAKRNARVIMACRNREKCVQVRRDIVLNTRNKQVYCRQCDLEDFDSIRTFVQKLSKGKFELDRIDGIVHNAAMMQSER-AVNKDGIEKTIATNHLGSFLLTGLLLDKLLAQPNPVRIVFLNSNIIDRKCDLNLADFNSENAGKKFDGYEIYKHSKLASALFTKELSERLSDTNIHVLMADPGRTKSNLSAQ 257          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Celegans
Match: dhs-24 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:Q9U1Y6])

HSP 1 Score: 99.3673 bits (246), Expect = 7.979e-23
Identity = 70/232 (30.17%), Postives = 122/232 (52.59%), Query Frame = 3
Query:   54 GYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSN---RFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKS-ARVVYM----ICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHAR 725
            GY ++       KY   ++L+GK  ++TG  SGIG   A  LA+++A V++ CRN + C   R +I+  TRN+ ++C + +LE   SI  FV++LS      D++D +V+NA    S +  +  + IEK +A N +G +LLT  L+  L A  +  R+V++    I  +  +   + +  N+ +K++ Y  +  S+L   L  K  ++  S   I     +PG T +   A+
Sbjct:   27 GYHVWDSTQSGTKYDLHEDLAGKTYIVTGATSGIGQATAEELAKRNARVIMACRNREKCVQVRRDIVLNTRNKQVYCRQCDLEDFDSIRTFVQKLSKGKFELDRIDGIVHNAAMMQSER-AVNKDGIEKTIATNHLGSFLLTGLLLDKLLAQPNPVRIVFLNSNIIDRKCDLNLADFNSENAGKKFDGYEIYKHSKLASALFTKELSERLSDTNIHVLMADPGRTKSNLSAQ 257          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Celegans
Match: dhs-7 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:Q19062])

HSP 1 Score: 68.9366 bits (167), Expect = 9.230e-13
Identity = 70/289 (24.22%), Postives = 134/289 (46.37%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYM---------ICPEFSM-GTINTDDINSLEKYNKYRAFFQSQLMRFL-SMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDM---EEVEIQPELLKPELIESAI 932
            NL+GK  V+TG  SGIG+E A  L+   A VV+  RN+++    + +I+++  +  I   + +L S  S+    E   ++   +  L+ NAG  G+   + T + +E   A+N +  +LL + L+P++  S  +R+V +         + PE S+   +      S    + +R + +S++   L + K    EY  N I+  + +PG         + + D++       L     ++ S    T V C     +  +SGK Y+D    +E  +  E+ + E ++ A+
Sbjct:   25 NLAGKTFVVTGTTSGIGIETARSLSLNGAHVVMLNRNLEESEKLKKKIVEEMNDAEIDIIECDLNSLHSVKKAAEVYISKKWSIHCLILNAGVFGTAS-KTTVDGLESHFAINHLSHFLLIQELLPIVRQSIPSRIVLVSSSVHATCGVSPEMSIEEKLKILCPESSSDASWFRLYSRSKMCNMLVAFKLHRDEYH-NGISTYSVHPGNGVRT----SIFRDSWLVSIASILSTPFTKNISQGASTTVYCAGHPEVANVSGK-YWDSNWDDEKGLYEEVARDEQLQDAL 306          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Fly
Match: CG2070 (gene:FBgn0033203 transcript:FBtr0088921)

HSP 1 Score: 136.732 bits (343), Expect = 1.165e-36
Identity = 82/223 (36.77%), Postives = 127/223 (56.95%), Query Frame = 3
Query:   42 VAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNT 710
            ++  G +L + ++   +++ + N +G+VA++TG   GIG E    LA++ A V + CR++K C + R EI+  T NQNIF  +L+L S KSI NF        +K+ IL+NNAG     K+ LT +  E Q+ VN +G +LLT  L+ +L +S  +RVV +       G I  DD+NS + Y++  A+ QS+L   L  +   K  S   +T NA +PG  NT
Sbjct:   18 LSAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKM-LTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPGVVNT 239          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Fly
Match: CG2070 (gene:FBgn0033203 transcript:FBtr0336999)

HSP 1 Score: 136.732 bits (343), Expect = 1.165e-36
Identity = 82/223 (36.77%), Postives = 127/223 (56.95%), Query Frame = 3
Query:   42 VAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNT 710
            ++  G +L + ++   +++ + N +G+VA++TG   GIG E    LA++ A V + CR++K C + R EI+  T NQNIF  +L+L S KSI NF        +K+ IL+NNAG     K+ LT +  E Q+ VN +G +LLT  L+ +L +S  +RVV +       G I  DD+NS + Y++  A+ QS+L   L  +   K  S   +T NA +PG  NT
Sbjct:   18 LSAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKM-LTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPGVVNT 239          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Fly
Match: CG30491 (gene:FBgn0050491 transcript:FBtr0088919)

HSP 1 Score: 132.109 bits (331), Expect = 6.771e-35
Identity = 88/299 (29.43%), Postives = 155/299 (51.84%), Query Frame = 3
Query:   60 FLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTA-FHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLT 953
            F  K  +   ++++  N +GKV ++TG  +GIG E    +A++   V + CRN+K C + R EI+ +T+N+ ++C + +L S +SI +FV       + + +L+NNAG     +  LT++ IE QL VN +G +LLT  L+ LL  S  +R+V +     + G INT D+NS + Y++ +A+ QS+L   L  +   K      +T NA +PG  +T        +N+ F   F K L    ++ P    +T +       +  ++G+ + D +  E+ P     +  +   ++ EK T
Sbjct:   26 FFVKDLMQGGQFTKETNETGKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQESIRHFVAAFKREQEHLHVLINNAGVMRCPR-SLTSDGIELQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRLEGTNVTANALHPGVVDTEIIRHMGFFNNFFAGLFVKPLFWPFVKTPRNGAQTSLYVALDPELEKVTGQYFSDCKLKEMAPAATDTQTAKWLWAVSEKWT 323          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Fly
Match: CG30491 (gene:FBgn0050491 transcript:FBtr0336997)

HSP 1 Score: 132.109 bits (331), Expect = 6.771e-35
Identity = 88/299 (29.43%), Postives = 155/299 (51.84%), Query Frame = 3
Query:   60 FLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTA-FHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLT 953
            F  K  +   ++++  N +GKV ++TG  +GIG E    +A++   V + CRN+K C + R EI+ +T+N+ ++C + +L S +SI +FV       + + +L+NNAG     +  LT++ IE QL VN +G +LLT  L+ LL  S  +R+V +     + G INT D+NS + Y++ +A+ QS+L   L  +   K      +T NA +PG  +T        +N+ F   F K L    ++ P    +T +       +  ++G+ + D +  E+ P     +  +   ++ EK T
Sbjct:   26 FFVKDLMQGGQFTKETNETGKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQESIRHFVAAFKREQEHLHVLINNAGVMRCPR-SLTSDGIELQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRLEGTNVTANALHPGVVDTEIIRHMGFFNNFFAGLFVKPLFWPFVKTPRNGAQTSLYVALDPELEKVTGQYFSDCKLKEMAPAATDTQTAKWLWAVSEKWT 323          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Fly
Match: CG2064 (gene:FBgn0033205 transcript:FBtr0088923)

HSP 1 Score: 131.724 bits (330), Expect = 7.127e-35
Identity = 94/307 (30.62%), Postives = 156/307 (50.81%), Query Frame = 3
Query:   48 GFGYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHAR--ATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLE 962
            G G +  K ++   K+++  + +GKV ++TG  +GIG E A  +A++   V L CR++  C   R +I+ +T NQNIF  +L+L S  SI  FV+       K+ +L+NNAG     K  LT +  E QL VN +G +LLT  L+ +L  S  +R+V +     + G+IN  D+NS + Y++  A+ QS+L   L  +   K    + +T NA +PG  +T   AR  A +     K F K +   +++ P    +T +       +  ISG  + D +   +    L  ++ +   +  EK T L+
Sbjct:   20 GVGIYFLKEYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPK-TLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNALHPGVVDTEL-ARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSDCKPKPVASGALDDKVAKFLWAESEKWTGLD 324          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Zebrafish
Match: si:ch211-107o10.3 (si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131-4716])

HSP 1 Score: 117.087 bits (292), Expect = 2.694e-29
Identity = 84/289 (29.07%), Postives = 140/289 (48.44%), Query Frame = 3
Query:   42 VAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDV---LIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPE 899
            + G G F ++  L       +  L GK  +ITGG +GIG E A  +A++ A V+L CR++   H    EI  ++ N+N+    L+L S +S+ + V+ +     ++DIL+NNAG     K   T+E  E Q+ VN +G +LLT  L+ LL  S  +R+V +       G IN +DIN  + Y+ Y+++++S+L   L  +    +     +T  A +PG   T           F   +RK + +      ++P    +T + C   + +   SG  Y D    E  P+
Sbjct:   24 ITGVGLFGFRRWLAGGVCRSKARLDGKTVLITGGNTGIGKETAVDMAKRGARVILACRDMSRAHKAAEEIRKRSGNENVTVKMLDLASLQSVRDLVKDVQQSEQRLDILINNAGVMMCPKWH-TDEGFEMQIGVNHLGHFLLTNLLLDLLKKSAPSRIVNVASVAHERGKINFNDINMDKDYDPYQSYYRSKLANVLFTRELAIKLRDTGVTTYALHPGVIRTELG-----RHVFSNLWRKLIILPFYFFFKNPWQGAQTTIYCAVDESLKHSSGLYYSDCAPKETAPQ 306          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Zebrafish
Match: si:ch211-107o10.3 (si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131-4716])

HSP 1 Score: 117.087 bits (292), Expect = 2.694e-29
Identity = 84/289 (29.07%), Postives = 140/289 (48.44%), Query Frame = 3
Query:   42 VAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDV---LIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPE 899
            + G G F ++  L       +  L GK  +ITGG +GIG E A  +A++ A V+L CR++   H    EI  ++ N+N+    L+L S +S+ + V+ +     ++DIL+NNAG     K   T+E  E Q+ VN +G +LLT  L+ LL  S  +R+V +       G IN +DIN  + Y+ Y+++++S+L   L  +    +     +T  A +PG   T           F   +RK + +      ++P    +T + C   + +   SG  Y D    E  P+
Sbjct:   24 ITGVGLFGFRRWLAGGVCRSKARLDGKTVLITGGNTGIGKETAVDMAKRGARVILACRDMSRAHKAAEEIRKRSGNENVTVKMLDLASLQSVRDLVKDVQQSEQRLDILINNAGVMMCPKWH-TDEGFEMQIGVNHLGHFLLTNLLLDLLKKSAPSRIVNVASVAHERGKINFNDINMDKDYDPYQSYYRSKLANVLFTRELAIKLRDTGVTTYALHPGVIRTELG-----RHVFSNLWRKLIILPFYFFFKNPWQGAQTTIYCAVDESLKHSSGLYYSDCAPKETAPQ 306          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Zebrafish
Match: si:ch211-107o10.3 (si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131-4716])

HSP 1 Score: 115.931 bits (289), Expect = 7.617e-29
Identity = 84/289 (29.07%), Postives = 140/289 (48.44%), Query Frame = 3
Query:   42 VAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDV---LIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPE 899
            + G G F  +  L       +  L+GK  +ITGG +GIG E A  +A++ A V+L CR++   H    EI  ++ N+N+    L+L S +S+ + V+ +     ++DIL+NNAG     K   T+E  E Q+ VN +G +LLT  L+ LL  S  +R+V +       G IN +DIN  + Y+ Y+++++S+L   L  +    +     +T  A +PG   T           F   +RK + +      ++P    +T + C   + +   SG  Y D    E  P+
Sbjct:   24 ITGVGLFGLRRWLAGGVCRSKARLNGKTVLITGGNTGIGKETAVDMAKRGARVILACRDMSRAHKAAEEIRKRSGNENVTVKMLDLASLQSVRDLVKDVQQSEQRLDILINNAGVMMCPKWH-TDEGFEMQIGVNHLGHFLLTNLLLDLLKKSAPSRIVNVASVAHERGKINFNDINMDKDYDPYQSYYRSKLANVLFTRELAIKLRDTGVTTYALHPGVIRTELG-----RHVFSNLWRKLIILPFYFFFKNPWQGAQTTIYCAVDESLKHSSGLYYSDCAPKETAPQ 306          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Zebrafish
Match: si:dkey-73n8.3 (si:dkey-73n8.3 [Source:ZFIN;Acc:ZDB-GENE-141219-27])

HSP 1 Score: 110.153 bits (274), Expect = 3.547e-27
Identity = 69/211 (32.70%), Postives = 104/211 (49.29%), Query Frame = 3
Query:   78 LGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNT 710
            L + ++S    L GK A++TG  +GIG E A  LA + A V+L CR++        +I     N N+   KL+L  +KSI  F E + N    + +L+NNAG         T +  E Q  VN +G + LT  LI LL  S  +RV+ +      MG I+ +D+NS + Y+  +A+ QS+L   L  +          +   A +PG  NT
Sbjct:   27 LIIKRWSSDVRLDGKTAIVTGANTGIGKETAKDLANRGARVILACRDLVKAEQAASDISRDVENANVVVRKLDLADTKSICEFAELIYNTEKSLHLLINNAGVAIC-PYSTTVDGFETQFGVNHLGHFFLTFLLIDLLKHSAPSRVINVSSLVHPMGKIHFEDLNSEKNYHPVKAYVQSKLANILFTRELASRVEELGVRVYAVDPGLVNT 236          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Zebrafish
Match: si:dkey-73n8.3 (si:dkey-73n8.3 [Source:ZFIN;Acc:ZDB-GENE-141219-27])

HSP 1 Score: 110.153 bits (274), Expect = 5.437e-27
Identity = 69/211 (32.70%), Postives = 104/211 (49.29%), Query Frame = 3
Query:   78 LGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNT 710
            L + ++S    L GK A++TG  +GIG E A  LA + A V+L CR++        +I     N N+   KL+L  +KSI  F E + N    + +L+NNAG         T +  E Q  VN +G + LT  LI LL  S  +RV+ +      MG I+ +D+NS + Y+  +A+ QS+L   L  +          +   A +PG  NT
Sbjct:    7 LIIKRWSSDVRLDGKTAIVTGANTGIGKETAKDLANRGARVILACRDLVKAEQAASDISRDVENANVVVRKLDLADTKSICEFAELIYNTEKSLHLLINNAGVAIC-PYSTTVDGFETQFGVNHLGHFFLTFLLIDLLKHSAPSRVINVSSLVHPMGKIHFEDLNSEKNYHPVKAYVQSKLANILFTRELASRVEELGVRVYAVDPGLVNT 216          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Xenopus
Match: rdh13 (cystatin-like [Source:Xenbase;Acc:XB-GENE-990109])

HSP 1 Score: 137.887 bits (346), Expect = 1.734e-36
Identity = 91/311 (29.26%), Postives = 151/311 (48.55%), Query Frame = 3
Query:   54 GYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARAT--YNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLESQLNE 977
            G  L K + G      + ++ G+  ++TG  +GIG E A  LA++   +++ CR++  C +   +I  KT N N+F   L+L SSKSI  F + + N  ++VD+L+NNA        + T +  E Q  VN +G +LLT  L+  +  S+++R++ +       G I+ DD+N   +KYN   A+ QS+L   L      K     K+T N+ +PG  +T    R T  +   F       L   +++ P  + +  V    ++ + G+SGK +  ++E E  P+ L  E          KL  LE  L E
Sbjct:   17 GAILLKDYTGGGNCPSKASIIGQTVIVTGANTGIGKETALELAKRGGRIIMACRDMGKCENAARDIRGKTLNHNVFARHLDLASSKSIKEFAKTIINEEERVDVLINNAAVMRCPHWK-TEDNFEMQFGVNHLGHFLLTNLLLEKMKRSENSRIINVSSLAHIAGDIDFDDLNWEKKKYNTKAAYCQSKLANVLFTNELAKRLQGTKLTANSLHPGVADTEL-GRHTGMHQSAFSSTILAPLFWFLVKSPKQAAQPSVYLAVAENLQGVSGKYFNALKEKEPAPQALDEESARKLWEESAKLVHLEEALTE 325          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Xenopus
Match: stat3.1 (signal transducer and activator of transcription 3, gene 1 [Source:Xenbase;Acc:XB-GENE-481047])

HSP 1 Score: 90.1225 bits (222), Expect = 1.565e-19
Identity = 76/284 (26.76%), Postives = 130/284 (45.77%), Query Frame = 3
Query:  111 LSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQN-IFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDL 959
            + GK  +ITG   GIG   A  L +Q+A V+L CR+     +   E+  +   +  I   +L+L S +S+  F + +     ++D+L+NNAG       + T +  E Q  VN +G +LLT  L+ LL +S  +R+V +    +  G IN DD+NS + Y++   + +S+L   L  +          +T NA +PG   T    R        K     +     + P    +T +   SS  + G+SG  + + +E E+ P+ +   +      I E +  L
Sbjct:   40 MRGKTVIITGANCGIGKATAAELVKQEARVILACRDQGRAEEAAAELRREAGERGEIVIKQLDLGSLQSVRRFCQEVLKEEPRLDVLINNAGVFQCPYTK-TEDGFEMQFGVNHLGHFLLTHHLLGLLKSSAPSRIVVVSSKLYKYGEINFDDLNSEKSYSRSFGYSRSKLANILFTRELASRLEGTGVTVNALHPGIVRTNL-GRHINIPILIKPLFNVVSWAFFKSPEEGAQTSIYLASSPEVEGVSGSYFGNSKEEELLPKAMDDLVARKLWDISEVMVGL 321          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Xenopus
Match: runx1 (RUNX family transcription factor 1 [Source:Xenbase;Acc:XB-GENE-483164])

HSP 1 Score: 86.2705 bits (212), Expect = 5.564e-18
Identity = 64/242 (26.45%), Postives = 117/242 (48.35%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSL-------IPLLTASKSARVVYMICPEFSMGTINTDDINSLEK-YNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDT-FYKHFRKYLDVLIMRHPSVSV 806
            +LSGKV ++TG  +GIG E A  LA    +V+L CRN++  ++ + +I+++     +    L+L S +S+ +F E   +R   + +L+ NA Y G    +LT + +E    VN +G + L   L       IP      S+        + S G ++ + ++ L+K Y    A+ +S+L   L  K   +  S + +T NA +PG    +   R  +  T  +   R +   + +++P V +
Sbjct:  121 DLSGKVVIVTGANTGIGFETARSLALHGTLVILACRNLQKGNEAKHKILEEWHKAKVEVMSLDLASLRSVQSFAEAFKSRNLALHVLICNAAYLGG-PWQLTEDGLEMTFQVNHLGHFYLVSLLQDVLQRSIPSRVVVVSSESHRFTEIKDSSGKLDLNLLSPLKKDYWAMLAYNRSKLCNILFSKELNRRLSPHGVTSNAVHPGNMMYSSIHRNWWGYTLLFALVRPFTKSMCIKYPDVHI 361          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Xenopus
Match: dhrs12 (dehydrogenase/reductase (SDR family) member 12 [Source:NCBI gene;Acc:780002])

HSP 1 Score: 84.7297 bits (208), Expect = 1.121e-17
Identity = 58/222 (26.13%), Postives = 113/222 (50.90%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYL 770
            ++ G+  +ITG  SGIG   A  +A++   + L CRN +   + + E+   + N++I    L++   K I  F E+      K+++L+NNAG   +++ ELT + +EK  A N +G Y+LT +L+P L   +  RV+ +      +  +N  D+      ++   A+ Q++  + +  + + K  +   + F+  +PG  +T    R++  D FY+  +  L
Sbjct:   42 DVRGRSYMITGANSGIGKAAALVIAKKGGTIHLVCRNKERAEEAQRELKANSGNEDISVHLLDMSDPKQIWEFAEKFKTEH-KLNVLINNAGCMVNKR-ELTEDGLEKNFATNTLGTYILTTALLPSLEKEEDPRVITVSSGGMLVQKLNVSDLQFETGTFDGTMAYAQNKRQQVILTEQWAK--ANPNVHFSVMHPGWADTP-AVRSSMPD-FYEKMKNRL 257          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Xenopus
Match: dhrs12 (dehydrogenase/reductase (SDR family) member 12 [Source:NCBI gene;Acc:780002])

HSP 1 Score: 84.3445 bits (207), Expect = 1.321e-17
Identity = 58/222 (26.13%), Postives = 113/222 (50.90%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYL 770
            ++ G+  +ITG  SGIG   A  +A++   + L CRN +   + + E+   + N++I    L++   K I  F E+      K+++L+NNAG   +++ ELT + +EK  A N +G Y+LT +L+P L   +  RV+ +      +  +N  D+      ++   A+ Q++  + +  + + K  +   + F+  +PG  +T    R++  D FY+  +  L
Sbjct:   29 DVRGRSYMITGANSGIGKAAALVIAKKGGTIHLVCRNKERAEEAQRELKANSGNEDISVHLLDMSDPKQIWEFAEKFKTEH-KLNVLINNAGCMVNKR-ELTEDGLEKNFATNTLGTYILTTALLPSLEKEEDPRVITVSSGGMLVQKLNVSDLQFETGTFDGTMAYAQNKRQQVILTEQWAK--ANPNVHFSVMHPGWADTP-AVRSSMPD-FYEKMKNRL 244          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Mouse
Match: Rdh13 (retinol dehydrogenase 13 (all-trans and 9-cis) [Source:MGI Symbol;Acc:MGI:1918732])

HSP 1 Score: 105.916 bits (263), Expect = 3.475e-25
Identity = 83/305 (27.21%), Postives = 141/305 (46.23%), Query Frame = 3
Query:   54 GYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARAT--YNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDL 959
            G  L K ++       +  + GK  ++TG  +GIG + A  LA++   V+L CR+++ C     +I  +T N  +   +L+L S KSI  F  ++    ++VDILVNNA          T +  E Q  VN +G +LLT  L+  L AS  +R++ +       G I+ +D+N  ++KY+   A+ QS+L   L  K  +     + +T NA +PG   T    R T  +N  F          L+ + P ++ +       ++ +  +SGK +  + E    PE    E+     +   +L  L
Sbjct:   17 GTVLLKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAKDIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWT-TEDGFEMQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFEDLNWQMKKYDTKAAYCQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTEL-GRHTGMHNSAFSGFMLGPFFWLLFKSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAPSPEAEDEEVARRLWTESARLVGL 319          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Mouse
Match: Dhrs13 (dehydrogenase/reductase (SDR family) member 13 [Source:MGI Symbol;Acc:MGI:1917701])

HSP 1 Score: 95.1301 bits (235), Expect = 3.188e-21
Identity = 77/302 (25.50%), Postives = 135/302 (44.70%), Query Frame = 3
Query:   60 FLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTD--DINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDL 959
             +Y + +  P      +L G+  V+TG  SGIG   A  LA++ A VVL CR+ +       ++  ++ N  +    L+L S  S+  F     +   ++D+L++NAG     +   T E     L VN VGP+LLT  L+P L +   +RVV +       G ++    D   +    + RA+  S+L   L  +    +     +T  A +PGP N+    R  +   + +   + L  L++R P    +TP+ C   +G+  +SG+ + +    E+ P     +  +      +KL  L
Sbjct:   17 LVYYNLVKAPSCGGIGSLRGRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLASVQAFATAFLSSEPRLDVLIHNAGISSCGR---TRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQQELRAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLR--HLPGWLRPILRPLAWLVLRAPQGGAQTPLYCALQEGIEPLSGRYFANCHVEEVSPAARDDQAAQRLWKATKKLAGL 313          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Mouse
Match: Rdh12 (retinol dehydrogenase 12 [Source:MGI Symbol;Acc:MGI:1925224])

HSP 1 Score: 93.9745 bits (232), Expect = 4.583e-21
Identity = 74/261 (28.35%), Postives = 119/261 (45.59%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEI 890
             + GKV VITG  +GIG E A  LA++ A V + CR++        EI   T+N  +   KL+L  +KSI  F ER      K+ IL+NNAG       + T+ + E    VN +G +LLT  L+  L  S  ARVV +      +G I   D+   ++Y    A+  S+L   L  +   K      +T  A +PG   +     +      ++ F  +      +  S   +T + C  ++ +  +SGK + D + + +
Sbjct:   36 QIPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPYSKTTDGF-ETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLIGKIRFHDLQGQKRYCSAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITRNSYLLCLLWRLFSPFF-----KSTSQGAQTSLHCALAEDLEPLSGKYFSDCKRMWV 290          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Mouse
Match: Rdh14 (retinol dehydrogenase 14 (all-trans and 9-cis) [Source:MGI Symbol;Acc:MGI:1920402])

HSP 1 Score: 92.4337 bits (228), Expect = 1.981e-20
Identity = 80/302 (26.49%), Postives = 137/302 (45.36%), Query Frame = 3
Query:  111 LSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIM-----------DKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPG--PTNTAFH------ARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDL 959
            + GK  +ITG  SG+G   A  L +  A V++GCR+     +   ++            D T  Q +   +L+L S +S+  F + L     ++D+L+NNAG       + T +  E Q  VN +G +LLT  L+ LL +S  +R+V +    +  G IN +D+NS + YNK   + +S+L   L  +   +      +T N  +PG   TN   H      AR  +N   +  F+  L+           +T +    S  + G+SG+ + D +E E+ P+ +   +      I E +  +
Sbjct:   42 MHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGTDGQ-LVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFHCPYTK-TEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGEINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLARPLFNLVSWAFFKTPLE---------GAQTSIYLACSPDVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 332          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Mouse
Match: Rdh11 (retinol dehydrogenase 11 [Source:MGI Symbol;Acc:MGI:102581])

HSP 1 Score: 90.5077 bits (223), Expect = 5.325e-20
Identity = 73/257 (28.40%), Postives = 119/257 (46.30%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDME 878
             L GKVA++TG  +GIG E A  LAQ+ A V L CR++        EI   T N  +F  KL+L  +KSI  F +        + +L+NNAG         T +  E  + VN +G +LLT  L+  L  S  +R+V +      +G I+  ++   + Y+   A+  S+L   L  K   K    + +T  + +PG      H+  T   +  +   +   V I + P    +T + C  ++G+  +SG  + D +
Sbjct:   19 QLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAREIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMC-PYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFHNLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTV----HSELTRYSSIMRWLWQLFFVFI-KTPQEGAQTSLYCALTEGLESLSGSHFSDCQ 269          
BLAST of Retinol dehydrogenase 13 vs. UniProt/SwissProt
Match: sp|Q8NBN7|RDH13_HUMAN (Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 GN=RDH13 PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 4.446e-26
Identity = 81/291 (27.84%), Postives = 141/291 (48.45%), Query Frame = 3
Query:  102 RDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARAT--YNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLES 965
            +  + GK  ++TG  +GIG + A  LA++   ++L CR+++ C     +I  +T N ++    L+L S KSI  F  ++    ++VDIL+NNAG         T +  E Q  VN +G +LLT  L+  L AS  +R++ +       G I+ DD+N    KYN   A+ QS+L   L  K  ++    + +T NA +PG   T    R T  +  TF       +  L+++ P ++ +       ++ +  +SGK +  +++    PE    E+     +   +L  LE+
Sbjct:   33 KATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWT-TEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTEL-GRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGLEA 321          
BLAST of Retinol dehydrogenase 13 vs. UniProt/SwissProt
Match: sp|Q8CEE7|RDH13_MOUSE (Retinol dehydrogenase 13 OS=Mus musculus OX=10090 GN=Rdh13 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.430e-24
Identity = 83/305 (27.21%), Postives = 141/305 (46.23%), Query Frame = 3
Query:   54 GYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARAT--YNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDL 959
            G  L K ++       +  + GK  ++TG  +GIG + A  LA++   V+L CR+++ C     +I  +T N  +   +L+L S KSI  F  ++    ++VDILVNNA          T +  E Q  VN +G +LLT  L+  L AS  +R++ +       G I+ +D+N  ++KY+   A+ QS+L   L  K  +     + +T NA +PG   T    R T  +N  F          L+ + P ++ +       ++ +  +SGK +  + E    PE    E+     +   +L  L
Sbjct:   17 GTVLLKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAKDIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWT-TEDGFEMQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFEDLNWQMKKYDTKAAYCQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTEL-GRHTGMHNSAFSGFMLGPFFWLLFKSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAPSPEAEDEEVARRLWTESARLVGL 319          
BLAST of Retinol dehydrogenase 13 vs. UniProt/SwissProt
Match: sp|A0PJE2|DHR12_HUMAN (Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens OX=9606 GN=DHRS12 PE=2 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 6.013e-24
Identity = 67/215 (31.16%), Postives = 112/215 (52.09%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLE-KYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNT--------AFHAR 725
             + G+V ++TGG SGIG   A  +A++   V L CR+     D R EI+ ++ NQNIF   ++L   K I  FVE       K+ +L+NNAG   +++ ELT + +EK  A N +G Y+LT  LIP+L      RV+ +      +  +NT+D+ S    ++    + Q++  + +  + + + +    I F++ +PG  +T         FHAR
Sbjct:   37 QIPGRVFLVTGGNSGIGKATALEIAKRGGTVHLVCRDQAPAEDARGEIIRESGNQNIFLHIVDLSDPKQIWKFVENFKQEH-KLHVLINNAGCMVNKR-ELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWAQGHPA--IHFSSMHPGWADTPGVRQAMPGFHAR 247          
BLAST of Retinol dehydrogenase 13 vs. UniProt/SwissProt
Match: sp|Q96NR8|RDH12_HUMAN (Retinol dehydrogenase 12 OS=Homo sapiens OX=9606 GN=RDH12 PE=1 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 2.719e-22
Identity = 76/264 (28.79%), Postives = 121/264 (45.83%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPE 899
             L GKV VITG  +GIG E A  LA + A V + CR++        EI   T+N  +   KL+L  +KSI  F E       ++ IL+NNAG         T +  E  L VN +G +LLT  L+  L  S  ARVV +      +G I   D+ S ++Y++  A+  S+L   L  +   K      +T  A +PG   +     ++     ++ F  +     ++      +T + C  ++G+  +SGK + D +   + P 
Sbjct:   36 QLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMC-PYSKTADGFETHLGVNHLGHFLLTYLLLERLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPF-----VKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPR 293          
BLAST of Retinol dehydrogenase 13 vs. UniProt/SwissProt
Match: sp|P59837|RDH12_BOVIN (Retinol dehydrogenase 12 OS=Bos taurus OX=9913 GN=RDH12 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 5.975e-22
Identity = 78/264 (29.55%), Postives = 120/264 (45.45%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPE 899
             L GKV VITG  +GIG E A  LA++ A V + CR++        EI   T+N  +   KL+L  +KSI  F E       ++ IL+NNAG         T +  E  LAVN +G +LLT  L+  L  S  ARVV +      +G I   D+   + YN   A+  S+L   L  +   K      +T  A +PG   +     +      ++ F  +L     +      +T + C  ++G+  +SGK + D ++  + P 
Sbjct:   36 QLFGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIQADTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMLC-PYSKTADGFETHLAVNHLGHFLLTHLLLGRLKESAPARVVNLSSVAHHLGKIRFHDLQGDKYYNLGFAYCHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKLVRHSFLLCLLWRLFSPFL-----KTTWEGAQTSLHCALAEGLEPLSGKYFSDCKKTWVSPR 293          
BLAST of Retinol dehydrogenase 13 vs. TrEMBL
Match: E2AR14 (Retinol dehydrogenase 13 OS=Camponotus floridanus OX=104421 GN=EAG_08262 PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 1.727e-46
Identity = 109/311 (35.05%), Postives = 169/311 (54.34%), Query Frame = 3
Query:   60 FLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYST----NKITFNACNPG--PTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEV-EIQPELLKPELIESAISIMEKLTDLESQL 971
            +L K ++G  KY   +NL+ K+ ++TG  +GIG E+A  LA++DA V++ CR++K C + R  I+  TRN+ ++C K +L S +SI  FVE+    FDK+ IL+NNAG     K   T E IE QL VN +G +LLT   + +L AS  +R+V +       G IN  D+NS ++Y+  +A+ QS+    L++ +FT+E +       +T NA +PG   TN   H    YN+ F + F K      +R P    +T +       +  +SG  YFD  E+ E+  E     L +    + E+ T L+ QL
Sbjct:   23 YLTKDYMGGTKYMGTENLNNKIVIVTGANTGIGREIASELAKRDAKVIMACRDMKKCEEARQSIVIDTRNKYVYCRKCDLASQESIRTFVEQFKKEFDKLHILINNAGVMRCPK-SYTKEGIEMQLGVNHIGHFLLTNLFLDVLKASAPSRIVNVSSAAHRRGQINMTDLNSDKEYDAGKAYAQSK----LAIIFFTRELANRLKGTNVTVNAVHPGIVDTNITRHL-FVYNNFFTRIFLKPFAWPFIRAPFQGAQTILYAALDTSLANVSG-CYFDNCEIKEVSDEAKNDNLGKWLWKVSERWTKLDMQL 326          
BLAST of Retinol dehydrogenase 13 vs. TrEMBL
Match: A0A1S3D6F9 (retinol dehydrogenase 13 OS=Diaphorina citri OX=121845 GN=LOC103511567 PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 6.420e-43
Identity = 100/301 (33.22%), Postives = 157/301 (52.16%), Query Frame = 3
Query:   54 GYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKH-FRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLT 953
            G  L K  LG  KY+E  +  GK+ ++TG  +GIG  +A  LA++ A V++ CR++  C   R E++ +++N+ + C K +L S +SI  F E +     K+++L+NNAG  G RK+ LT E IE QL VN +G +LLT  L+  L  S  +R++ +       GTIN +D+NS   Y+  +A+ QS+L   L  +   K      IT NA +PG  NT     ++Y D++      K L  L ++ P    +T V       +  +SGK + +  E E  P+     L +    + EK T
Sbjct:   24 GTLLLKDVLGGAKYTEETSARGKIVIVTGANTGIGKAIARELAKRKAKVIMACRDLDKCEKARKEVVLESKNKYVLCRKCDLASQESIRAFAEEVKKENKKINVLINNAGVSGCRKM-LTEEKIELQLGVNHMGHFLLTMLLLDKLQESAPSRIINVSSVAHKRGTINKEDLNSENSYDPTQAYNQSKLANVLFTRELAKRLEGTGITVNAVHPGIVNTDILRHSSYYDSWLSTVVLKPLVWLFIKSPRQGAQTIVYASLDPSLENVSGKYFAECREAETSPDAQDDGLAKWLWMVSEKWT 323          
BLAST of Retinol dehydrogenase 13 vs. TrEMBL
Match: A0A433TV80 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006762 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 4.401e-42
Identity = 91/282 (32.27%), Postives = 152/282 (53.90%), Query Frame = 3
Query:   63 LYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKH-FRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELL 905
            + K ++G  +Y   + ++GK  ++TGG SGIG E A  LA++   +++GCR+I  C   R EI+ +T N+NI C KL+L S  SI  F + ++     +DIL+NNAG     K +LT +  E QL VN +G +LLT  L+  L +S  +R++ +     + G++N  D+NS + YNK  A+ QS+L   L  K   K    + +T N+ +PG   T       ++++++     K L  ++M+ P    +T +       +  ++GK + D +E E  P  L
Sbjct:   22 ILKDYMGGERYKGEERIAGKTVIVTGGNSGIGKETARELARRGGRIIMGCRDIDKCELVRKEIIVETANRNIECRKLDLASLGSIRAFCKSINASEKHIDILINNAGVMMCPK-QLTEDGFELQLGVNHLGHFLLTYLLMDKLKSSAPSRIIIVSSRIHTQGSMNFSDLNSAKNYNKVDAYAQSKLANLLHQKELVKHLEGSNVTVNSLHPGVVATELGRHLPWSNSYFSSILLKPLKFILMKTPVQGAQTTLYLALDPSLENVTGKYFSDCKETETAPNAL 302          
BLAST of Retinol dehydrogenase 13 vs. TrEMBL
Match: A0A293M3J9 (Dehydrogenase (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 2.188e-41
Identity = 92/277 (33.21%), Postives = 149/277 (53.79%), Query Frame = 3
Query:   69 KHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKH-FRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQP 896
            K ++G  +Y+ ++ + GK  ++TG  +GIG E+A   +++ A V++ CRNI  C   R E+M +T+N+NI+C +L+L S +S+ +F ER+     KV ILVNNAG     ++ LT E  E QL VN +G +LLT  L+  L A+  +R+V +       G IN DD+NS + Y+   A+ QS+L   L     ++      +T  A +PG  NT       + ++F    F K L  +  + P    +  + C  ++G+   SG+ + D E  E  P
Sbjct:   27 KEYVGGCRYTGKEQMEGKNVIVTGANTGIGKEVAKDFSKRGARVIMACRNIDKCRRARKELMLETKNKNIYCEQLDLASLQSVRDFAERMKKNVKKVHILVNNAGLMRCPRM-LTKEGFEMQLGVNHMGHFLLTMQLLDTLKAATPSRIVNVSSTAHLRGDINFDDLNSEKAYDPAAAYNQSKLANVLFTAELSRVLKDTGVTTYAVHPGIVNTEITRHMGFANSFVATLFVKPLLWIFSKTPRQGAQPVIHCALAEGIEEHSGQYFSDCEVAEANP 302          
BLAST of Retinol dehydrogenase 13 vs. TrEMBL
Match: A0A0L8GQG5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22029782mg PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.798e-40
Identity = 97/301 (32.23%), Postives = 158/301 (52.49%), Query Frame = 3
Query:   63 LYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKY-LDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLE 962
            L K +LG  KY  ++ ++GK  VITG  SGIG  +A  LA +   ++L CR+++ C + + EI+ +T N NI C KL+L S KSI  F +  +   +++DIL+NNAG   S K  LT +  E+QL VN +G +LLT  L+  L  S  +R++ +    F  G++N  D+NS +KY+   AF+QS L + L     ++    + +T NA  PG TNT        N ++      + +  ++++ P    +T + C     +  +SG  + + +E+E     L  E       I EK   ++
Sbjct:   28 LLKDYLGGSKYEGKEKIAGKTVVITGANSGIGKAVATGLAYKRGRIILACRDMERCAEAQKEIIHQTANLNIHCRKLDLASIKSIKAFADAFNKTENRLDILINNAGVMCSPK-SLTEDGFEQQLGVNYLGHFLLTVLLLDKLKKSAPSRILNICSHSFKNGSMNWQDLNSAQKYDNREAFYQSHLAKVLFTTELSRRLQGSGVTVNAVYPGVTNTNLGNHLGINKSYISSILLWPIKWILLKTPMQGAQTALFCSVDPSLETVSGHYFCNNKEMEFPTNALDTEAATRLWLISEKWMGIK 327          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Cavefish
Match: rdh12l (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:103044420])

HSP 1 Score: 124.02 bits (310), Expect = 2.844e-32
Identity = 84/266 (31.58%), Postives = 133/266 (50.00%), Query Frame = 3
Query:   93 YSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHF-RKYLDVLIMRHP----SV-SVETPVMCCSSKGMFGISGKLYFD 872
            +S    L GK  +ITG  +GIG E A  LA++ A +++ CR+++       E+++ + NQ++   KL+L  +KSI  F + +++   +V+IL+NNAG         T +  E Q+ VN +G +LLT  L+ L+  S  AR+V +       GTIN DDINS + Y+K +A+ QS+L   L  +   K      +T    +PG   T            ++H  R    V+ M  P    SV   +T + C  +  +   SGK Y D
Sbjct:   11 WSSSAKLDGKTVLITGANTGIGKETAIDLAKRGARIIMACRDMEKADGALKEVIEASGNQDVVTKKLDLADTKSIREFAQMINSEEKQVNILINNAGVMVC-PYGKTADGFEMQIGVNHMGHFLLTFLLMDLIKKSSPARIVNVSSMAHKWGTINIDDINSEKSYDKSKAYSQSKLANVLFTRCLAKHLDGTGVTVYVLHPGVVQT----------ELWRHLNRAQQGVMWMVKPFTKTSVQGAQTTIYCAVAPELETESGKYYSD 265          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Cavefish
Match: si:dkey-73n8.3 (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:103038897])

HSP 1 Score: 113.62 bits (283), Expect = 2.392e-28
Identity = 75/246 (30.49%), Postives = 121/246 (49.19%), Query Frame = 3
Query:   78 LGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETP 815
            L +  +S    L G+ A++TG  SGIG E A  LA++ A V+L CR++        EI+ +    ++   KL+L  ++SI  F E + N    + +L+NNAG   S+     + Y E Q  VN +G + LT  L+ LL  S  +RV+ +      MG I  +D+NS + Y+  +A+ QS+L   L  +   K      +T  A +PG  NTA            +H +K    L+ +  +  ++TP
Sbjct:    7 LFIKSWSSDIRLDGQTAIVTGANSGIGKETARDLAKRGARVILACRDMVKAEQAASEIIREVGVSSVVPRKLDLADTRSICEFAELIYNTEKSLHLLINNAGVAFSQYATTEDGY-EMQFGVNHLGHFFLTFLLMDLLKHSAPSRVITVASLAHFMGKIEFEDLNSEKNYHPVKAYVQSKLANVLFTRELAKRVEDLGVTVCAVDPGMVNTA----------IIRHMKKSFQFLV-KSFAFMIQTP 240          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Cavefish
Match: rdh12 (retinol dehydrogenase 11 [Source:NCBI gene;Acc:103041043])

HSP 1 Score: 112.464 bits (280), Expect = 1.020e-27
Identity = 90/301 (29.90%), Postives = 142/301 (47.18%), Query Frame = 3
Query:   42 VAGFGYF-----LYKHHL----------GVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPE 899
            VAGFG+      L   H+          GV   + R  L GK A+ITG  SGIG E A  LA + A V+L CR+++   D   EI  +     +   +L+L  ++SI  F +R     + + IL+NNAG      ++ T +  E QL VN +G +LLT  LI LL  S  ARV+ +       G I   D++S   YN   A+ QS+L   L  +  ++  + + +T N+ +PG   +     +T     +  F  +L     + P    +T + C +++ +  ISGK + D     + P+
Sbjct:    6 VAGFGFVAIVLRLLSSHIRFVCRKYAAGGVCLSTAR--LDGKTALITGANSGIGKETAVDLALRGARVILACRDMEKGEDTAAEIRRRVGGAKVEVRELDLADTRSIRVFAQRFLREVNHLHILINNAGVMMCPYMK-TADGFEMQLGVNHLGHFLLTYLLIGLLKRSSPARVIVVSSLAHYFGWIRFHDLHSQGSYNSGLAYCQSKLANVLFTRELSRRLTGSNVTVNSVHPGTVKSELVRHSTVMSLLFTLFSMFL-----KTPREGAQTSIYCATAEELQSISGKHFSDCAPASVAPQ 298          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Cavefish
Match: si:dkey-94e7.2 (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:103035184])

HSP 1 Score: 111.694 bits (278), Expect = 1.341e-27
Identity = 73/209 (34.93%), Postives = 110/209 (52.63%), Query Frame = 3
Query:   90 KYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAF 716
            ++S    L GK  +ITG  +GIG E    LA++ A +++ CR+I      + EI++ + NQNI   KL+L  +KSI  F E ++N   ++ IL+NNAG         T +  E Q+ VN +G +LLT  LI LL  S  +R++ +     S GTI  DDINS + Y+  R + QS+L   L  +   +      +T  A +PG   T  
Sbjct:   14 EWSSDVRLDGKTVIITGANTGIGKETTRDLAKRGARIIMACRDIPKAEVTQREIIEDSGNQNIVIRKLDLSDTKSIREFAEIINNEEKQLHILINNAGVMMC-PYSKTADGFEMQIGVNHLGHFLLTFLLIDLLKKSAPSRIILLSSMAHSWGTIKLDDINSEKSYHSRRVYGQSKLANILCTRSLGRRLKDTGVTVYAVHPGIVRTEL 221          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Cavefish
Match: zgc:112332 (zgc:112332 [Source:ZFIN;Acc:ZDB-GENE-050522-387])

HSP 1 Score: 111.309 bits (277), Expect = 1.997e-27
Identity = 72/217 (33.18%), Postives = 117/217 (53.92%), Query Frame = 3
Query:   51 FGYFLYKHHLGVPK-YSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPG 698
            F + +  H   +P+ ++    L GK  +ITG  +GIG E A  LA++ A V+L CR+++     R E+++ + N NI   +++L  +KSI  F + ++    +++IL+NNAG      L+ T +  E Q  VN +G +LLT  L+ LL  S  AR+V +     + G+I  DDINS + Y   RA+ QS+L   L  +   K      +T  + +PG
Sbjct:    4 FQWVMLLHRCFLPRVWASSVRLDGKTVIITGANTGIGKETARDLAKRGARVILACRDVEKAEAARKELVEDSGNPNIVAKEMDLSDTKSIKEFADIINTEEKQLNILINNAGIMMCPYLK-TADGFEMQFGVNHLGHFLLTYLLLDLLKRSAPARIVNVASVAHTWGSIRLDDINSEKSYAPRRAYGQSKLANILFTRSLAKRLKGTGVTVYSLHPG 219          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Sea Lamprey
Match: dhrsx (dehydrogenase/reductase (SDR family) X-linked [Source:ZFIN;Acc:ZDB-GENE-060620-2])

HSP 1 Score: 110.153 bits (274), Expect = 9.593e-28
Identity = 75/213 (35.21%), Postives = 110/213 (51.64%), Query Frame = 3
Query:   99 ERDNL---SGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARA 728
            ER +L   +G+VAV+TGGG GIGLE   RLA+  A V+L   N K+  +    +   T N  +    L+L S  S+ +FV R  +R   + ILVNNAG      L L+ + +E+ LAVN VGP+LLT  L          RVV +       G +   DIN  E+Y+ Y A+ +S+L   L  +    E   +++T  A +PG  ++  +  A
Sbjct:   22 ERGSLPRQTGRVAVVTGGGRGIGLETGRRLAELGAHVILASNNEKEGSEAAQALRSDTGNDKVDFMHLDLRSLSSVRDFVNRFRSRKLPLHILVNNAGVM-LVPLRLSADALEEHLAVNCVGPFLLTALLTGASEGPTPLRVVCVSSATHRAGCLLFHDINCSERYSSYAAYARSKLALTLWSRQL-HEQGGDRVTSVAVDPGVVDSELYRHA 232          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Sea Lamprey
Match: rdh14b (retinol dehydrogenase 14b [Source:ZFIN;Acc:ZDB-GENE-030131-6605])

HSP 1 Score: 94.3597 bits (233), Expect = 6.670e-22
Identity = 83/296 (28.04%), Postives = 130/296 (43.92%), Query Frame = 3
Query:  108 NLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDK--TRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPG--PTNTAFH------ARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLES 965
            ++ GK  V+TG   G+G      LA+  A V+L  R+     +  VE+  +  +    +   +L+L S  S+  F  RL    +++D+LVNNAG        LT +  E Q  VN +G +LLT  L+PLL  S  +RVV +    +  G IN DD+ S   Y+   A+ +S+L   +  +   +      +T NA +PG   TN   H      AR  +N   +  FR          P     T V   +S  +  +SG  + D  + E+ P      +      + E+L  L S
Sbjct:   50 SMRGKTVVVTGANCGLGRATTLALARLGARVILAVRDSARGEEAAVELRRELGSEEAELVVRELDLASLASVRRFCARLEREEERLDVLVNNAGVFRC-PYALTEDGFETQFGVNHLGHFLLTALLLPLLGRSAPSRVVVVSSALYKQGRINFDDLASERSYDPAAAYGRSKLANVMFARELARRLRGQGVTANALHPGVVRTNLGRHVSMPALARPLFNLLAWAAFRT---------PEQGARTAVFLAASPDVADVSGAYFGDCRQEELLPVATDDAVAAKLWEVSERLVGLRS 335          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Sea Lamprey
Match: RDH13 (retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:HGNC:19978])

HSP 1 Score: 73.9442 bits (180), Expect = 5.436e-15
Identity = 75/271 (27.68%), Postives = 123/271 (45.39%), Query Frame = 3
Query:  153 IGLELAHRLA-QQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARAT--YNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVE----IQPELLKPELIESAISIM 941
            +G E A  LA +  A V+L CR+   C D   EI  +T N  +   +L+L S +S+ +F   ++   + V ILVNNA          T +  E Q  VN +G +LLT  L+  L AS  +RVV +         ++  D+N    KY+   A+  S+L   L     +K      +T N+ NPG  NT+   R T  +   F          L++R P +  +  +    S+ +  +SG+ +  M +V+       E L  +L E++  ++
Sbjct:   48 VGFEGACVLAVRAGARVILACRDEAACEDAAREIRGETLNPRV-ARRLDLASLESVRDFAAHINQDEENVHILVNNAAVMRCPH-STTADGFEMQFGVNHLGHFLLTNLLLDKLRASAPSRVVTVSSLAQVAACLDLSDLNWERRKYDPKLAYCDSKLANVLFSLELSKRLQGTGVTANSVNPGVCNTSL-GRHTGMHKSAFSSSVLGPFFWLVVRSPRLGAQPSINLAVSEELRDVSGRYFDGMRQVDPGTKANDEELARQLWEASARLV 315          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Sea Lamprey
Match: dhrs4 (dehydrogenase/reductase (SDR family) member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1498])

HSP 1 Score: 61.6178 bits (148), Expect = 5.368e-11
Identity = 60/229 (26.20%), Postives = 92/229 (40.17%), Query Frame = 3
Query:   96 SERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRN-QNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAG---YKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKY---NKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFR 761
            ++   L+GK+AV+TG   GIGL +A RLAQ  A VV+  R  +       E+  +  N   I C   ++  +      ++   ++   +DILV NA    Y G   L  T E  +K L VN   P+L  K   P +       VV+               I+S+  Y        +  S+       K  ++  +   I  N   PG   T F A  T ++   + FR
Sbjct:   25 AKHQPLAGKIAVVTGSTYGIGLAIARRLAQHGAHVVVSSRTEEHVAHAAEELHAEGLNVTGIVC---HVGDADQRTKLIKETVSKLGGLDILVLNAAVNPYVGPL-LNATAEVWDKVLDVNLKAPFLFVKEAAPHMKERGEGAVVF---------------ISSVTAYFPNEDIGPYCVSKTALLGLTKALSRPLAAMNIRVNNVAPGLIETGFSAGLTKDEKMMQMFR 234          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Sea Lamprey
Match: si:dkey-221h15.4 (si:dkey-221h15.4 [Source:ZFIN;Acc:ZDB-GENE-041014-340])

HSP 1 Score: 56.225 bits (134), Expect = 4.432e-9
Identity = 51/216 (23.61%), Postives = 100/216 (46.30%), Query Frame = 3
Query:   99 ERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKT--------RNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRK-LELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKY--NKYRA--FFQSQLMRFLSMKYFTKE------YSTNKITFNAC 689
             R +++G+V ++TG GSG+G  +A  LA+  A +V+   N +  +++  +++ +         R  ++    ++      +    + +      +DILVNNAG    RK ++  +E ++K + VN +  +   K+ +P + A+    +V +     S G I    +N L  Y  +K+ A  F +S  +  L++  F  +      Y  N   FN C
Sbjct:   34 RRKSVAGQVVLVTGAGSGLGRLVALSLARLGATLVIWDVN-RAANEETAQLIREEGDGVEGNGRKPSVHAYSVDCSRRDDVYRVADLVMRDVGDIDILVNNAGIVTGRKFIDSPDELLQKTMDVNIMAHFWTYKAFLPAMVANDHGHLVSIAS---SAGLIG---VNGLADYCASKFAAVGFAESVALEMLALGKFGVKTTIVCPYFINTGMFNGC 242          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Yeast
Match: YMR226C (NADP(+)-dependent serine dehydrogenase and carbonyl reductase; acts on serine, L-allo-threonine, and other 3-hydroxy acids; green fluorescent protein fusion protein localizes to the cytoplasm and nucleus; may interact with ribosomes, based on co-purification experiments [Source:SGD;Acc:S000004839])

HSP 1 Score: 58.9214 bits (141), Expect = 2.099e-10
Identity = 41/150 (27.33%), Postives = 75/150 (50.00%), Query Frame = 3
Query:   90 KYSERDNLSGKVAVITGGGSGIGLELAHR---LAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYK-GSRKL-ELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYM 524
            K +ER  L+ K  +ITG  +GIG   A      +  D  ++L  R ++   + +  I  +  N  +  ++L++  ++ I  F+E L   F  +DILVNNAG   GS ++ ++  E I+     N      +T++++P+  A  S  +V +
Sbjct:    6 KAAER--LAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALINITQAVLPIFQAKNSGDIVNL 153          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Yeast
Match: ENV9 (Protein proposed to be involved in vacuolar functions; mutant shows defect in CPY processing and defects in vacuolar morphology; has similarity to oxidoreductases, found in lipid particles; required for replication of Brome mosaic virus in S. cerevisiae, a model system for studying replication of positive-strand RNA viruses in their natural hosts [Source:SGD;Acc:S000005772])

HSP 1 Score: 47.7506 bits (112), Expect = 1.316e-6
Identity = 38/146 (26.03%), Postives = 62/146 (42.47%), Query Frame = 3
Query:  120 KVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQ----------------------NIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLL 491
            K+AV+TGG +GIG      L     +V +  RN         EI+ + + +                      ++    L+L   K +     ++    D +D+LVNNAG   +  LE+T +  E QL  N +  ++ T  L+PLL
Sbjct:   17 KIAVVTGGNTGIGWYTVLHLYLHGFVVYICGRNSHKISKAIQEILAEAKKRCHEDDDGSSPGAGPGPSIQRLGSLHYIHLDLTDLKCVERAALKILKLEDHIDVLVNNAGIM-AVPLEMTKDGFEVQLQTNYISHFIFTMRLLPLL 161          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Yeast
Match: AYR1 (Bifunctional triacylglycerol lipase and 1-acyl DHAP reductase; NADPH-dependent 1-acyl dihydroxyacetone phosphate reductase involved in phosphatidic acid biosynthesis; lipid droplet triacylglycerol lipase involved in the mobilization of non-polar lipids; found in lipid particles, the endoplasmic reticulum and the mitochondrial outer membrane; required for spore germination; role in cell wall biosynthesis; capable of metabolizing steroid hormones; oleic acid inducible [Source:SGD;Acc:S000001386])

HSP 1 Score: 46.2098 bits (108), Expect = 4.445e-6
Identity = 41/143 (28.67%), Postives = 67/143 (46.85%), Query Frame = 3
Query:   96 SERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERL-SNRFD-KVDILVNNAGYKGS-RKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARV 515
            SE  +   K+AV+TG   GIG E+   LA+   +V    R ++      ++      N +I   KL++   + I+ F   L +N  D K+D+L NNAG   +   L+ T+  +E+   VN  G   + + L   L  +K   V
Sbjct:    2 SELQSQPKKIAVVTGASGGIGYEVTKELARNGYLVYACARRLEPMAQLAIQF----GNDSIKPYKLDISKPEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAAVEQCFKVNVFGHINMCRELSEFLIKAKGTIV 140          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Yeast
Match: YKL107W_mRNA (Putative short-chain dehydrogenase/reductase; proposed to be a palmitoylated membrane protein [Source:SGD;Acc:S000001590])

HSP 1 Score: 45.4394 bits (106), Expect = 7.731e-6
Identity = 58/276 (21.01%), Postives = 121/276 (43.84%), Query Frame = 3
Query:  123 VAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLN-LESSKSIINFVERLSNR----FDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSAR----VVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIE 923
            VA+I GG  G+G  ++  LAQ++A               RV ++ +T        K+N +++  S+++  +R+S+     ++++  L+   G   SR+ + T+E +EK +AV+ +  Y++   +   L  S++ +     V++     +    + DD+NS EK     A   + +    S+    K+  TN  TF   NPG   T        +DT+     +++     +      +T     +S  +   SG ++ +  +  +    L  +++E
Sbjct:   26 VAII-GGTGGLGRAISRELAQRNA---------------RVTVVGQTFRDEDLKDKINFVKADLSLVSECKRISHSDEIPYEELTHLIFTTGIFASRQRQATSEGLEKDMAVSYLSRYIIFHDVAKRLGISRTKKDDLPKVFIAGFPGNGQVGDPDDLNSDEKKYSAYATHMNTVAANESLVIDAKDRYTNIDTF-GLNPGLIKTNIRNNLLGSDTYLSRITEWIISWTCQSAETYAKTICTLIASPAIESRSGTMFSNKGDAILPSPGLTKDVVE 284          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Nematostella
Match: EDO46815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNX1])

HSP 1 Score: 114.775 bits (286), Expect = 2.195e-29
Identity = 74/257 (28.79%), Postives = 130/257 (50.58%), Query Frame = 3
Query:  120 KVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTF-YKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVE 887
            K  +ITG  SGIG+E+A  LA + A V++ CR++        EI+    N ++   KL+L S  SI  F + ++    +VD+L+NNAGY GS+K   T + +E  L VN +GP+LLT  L+  L  S  +R++ +   +    +I+ D++   + Y ++ A+ +S+L   L  K    + +  K+T NA +PG   T       +   +  +     +     + P    +T + C  +  +  ++GK + D +E E
Sbjct:    2 KTVIITGANSGIGMEVARDLAWRKARVIMACRDVHKGMKAAAEIVQSAGNMDVEVKKLDLASFASIREFAKEVNEEESRVDVLINNAGYLGSQK--KTVDKLEYTLQVNYLGPFLLTNLLLGKLKTSSPSRIINVSSHQHKKASIDFDNLQGEKSYGRFAAYSRSKLALMLFTKQLANKLAGYKVTVNALHPGLVCTNLFRNLRFLRIWAIRPIYWLVQYFFFKTPIQGAQTTIHCAVAPELADVTGKYFVDCQEAE 256          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Nematostella
Match: EDO32533 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS7])

HSP 1 Score: 108.227 bits (269), Expect = 4.181e-26
Identity = 80/289 (27.68%), Postives = 138/289 (47.75%), Query Frame = 3
Query:  105 DNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDD---INSL----EKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKL 950
            +NL G+V ++TG  SGIGL  A  LA   A VV+ CR+++  H   + I    ++  +    ++L S  SI +FV++   +   + +LV NAG  G      T + IE   AVN +G +LL K L  +L +S  AR+V +         +N  D   I+++    +KY+   A+ QS+L   +      +  S+  +T NA +PG  N  + +    +  ++  FR  +  L  + P  +  T V C  S  + G+ G+ + +    E   E   P+   +  ++ E+L
Sbjct:  130 ENLDGRVVMVTGASSGIGLATASALAAHGAHVVMACRDMEKAHKAELHIKKTNKDCKLEVMFVDLASFASIHDFVDKFKKKSMPLHVLVCNAGVLGG-PWRCTGDNIEYTFAVNYLGHFLLIKLLQDVLCSSSPARIVMLSSESHRFQDLNYSDKLHISTVPLSRDKYHSILAYNQSKLCSIMLSMELNRRLSSEGVTCNAVHPG--NLIYTSLYGKSWCYWLIFR--IARLFAKTPEQAASTVVYCAVSPELNGVGGQYFINCRPCEPSVEAADPDKARALWTLSERL 413          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Nematostella
Match: EDO39346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC3])

HSP 1 Score: 98.2117 bits (243), Expect = 4.235e-23
Identity = 77/283 (27.21%), Postives = 134/283 (47.35%), Query Frame = 3
Query:  129 VITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPV-MCCSSKGMFGISGKLYFDMEEVEIQ-PELLKPELIESAISIMEKLTDLESQL 971
            +ITG  SGIG E A  LA+  A V + CR+ +     R E++ ++ NQNI+   L++    ++  F    +     + +LVNNAG   + +  +T + +E   A N +G Y+LTK L+P LT+ +S RV+ +      +  ++  D  S   ++    + Q++  + + M+ F ++Y    I F + +PG  +T    R++  D FY+  +      ++R      +T V +C SS+     SG  Y D   V    P        E   S M++L  +  Q 
Sbjct:   47 MITGANSGIGKETARALAKSGATVHMVCRDEQRGEQARQELLQESGNQNIYLHVLDMSQPSNVCKFARDFAASNRPLHVLVNNAGCMVNTRT-ITEDGLEMNFATNTLGTYILTKELLPCLTSQESPRVITVSSGGMLLVKLDGSDFQSERTFDGAMVYSQNKRQQVVMMERFAEDYP--NIFFASMHPGWADTP-AVRSSMPD-FYRRTK-----TMLRTSEQGADTVVWLCVSSEQEKLKSGGFYQDRNPVSKHLPLAWTKSSSEDEKSFMKQLNTIADQF 319          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Nematostella
Match: EDO35001 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMN3])

HSP 1 Score: 93.2041 bits (230), Expect = 2.787e-21
Identity = 89/321 (27.73%), Postives = 144/321 (44.86%), Query Frame = 3
Query:   42 VAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAG-YKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYR-----------AFFQSQLMRFLSMKYFTKEYST---NKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDL 959
            V G   +L++ +L   + +    L GK  ++TG  SGIG   A  LA++ A V++ CR+++       EI  K     + C  L+L S  S+  F E +     ++DILVNNAG Y+ + K   T +  E Q  VN +G +LLT  L+ LL AS  +R+V +      +G     D ++ +K +  +            + +S+L  FL    FT E S      +T NA  PG   T    R +      K     L  L ++ P    +T + C +   +  +SGK + D  + ++       E  +   ++ E LT L
Sbjct:   20 VLGTSIWLFRRYLVGRRCTNTVRLHGKTVIVTGANSGIGKATALELARRGARVIMACRDLESAEKAASEIRYKVPKAEVVCRFLDLNSLISVRKFAEDVMREEKRLDILVNNAGVYQPANK--KTVDGFETQFGVNHLGHFLLTNMLLDLLKASAPSRIVVV---SSRLGFRANLDFDAFDKEDTDKKSMRGGHVMPVGYGRSKLANFL----FTHELSKRLPQGVTVNALCPGMVWTGL-GRTSKMSWKMKLLFWPLGFLFLKRPMEGAQTVIYCATEPKLSNVSGKCFTDCHQTDMPANCTDDETAKRLWNVSEILTGL 330          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Nematostella
Match: EDO47050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNF1])

HSP 1 Score: 87.0409 bits (214), Expect = 2.818e-19
Identity = 75/292 (25.68%), Postives = 133/292 (45.55%), Query Frame = 3
Query:  114 SGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKS----ARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYS--TNKITFNACNPGPTNTAFHARATYNDTFYKHF----RKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDL 959
            +GKVA++TGG  GIG E A  L +    V++GCR+ K        + D+  +  +    L+L    S+  FV+      +++++LVNNAG   +    LT +  E+Q+ +   G +LLT  L+  L  S +    +R+V +     S G+IN +D+ S + Y+++ A+ Q+++   L      +  S  +  +T NA +PG  NT            ++H     R  + +  +  P     T +  C S  + G+ GK   + E           ++ E    +  KLT +
Sbjct:   14 AGKVAIVTGGNCGIGYETARGLIRSGMTVIMGCRSEKAAESAIQHLKDEQPDARVRYIHLDLSDLSSVREFVKSFHQSENQLNVLVNNAGVMLT-PYALTKDGFEQQIGICHFGHFLLTMLLLDTLKKSGTKDCHSRIVTVSSTAHSSGSINFEDLQSKKSYSRFGAYAQAKVANVLFTYALQRRLSIDSTHVTANALHPGVVNT----------ELFRHLPWIARAPMGLFFLT-PEQGAATSLYACLSPDLEGVGGKYLANCEVQSSSAYSYNEDIQERLWRVSRKLTGI 293          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Medaka
Match: RDH13 (retinol dehydrogenase 13 [Source:NCBI gene;Acc:101164512])

HSP 1 Score: 126.716 bits (317), Expect = 7.132e-33
Identity = 90/315 (28.57%), Postives = 154/315 (48.89%), Query Frame = 3
Query:   39 PVAGFG-----YFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEK-YNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFR-KYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLE 962
            PV+ FG       L KHH+   +   +  ++GK  VITG  +GIG E A  LA++   +++GCR+++ C     EI   T N +++   L+L S KSI  F ER++    +VD+L+NNAG       + T +  + Q  VN +G +LLT  L+  L     +RV+ +      +G I+ +D+N  +K ++  +A+ QS+L   L  +   K      +T NA +PG   T        + + +  F       L+++ P++  +  V    S+ M G++G+ Y  M E E   + L  E+      +  +L  L+
Sbjct:    7 PVSVFGTVFGSAVLLKHHVTGGRCPSKATITGKTVVITGANTGIGKETARELAKRGGRILMGCRDMEKCETAAKEIRGATLNPHVYACHLDLASIKSIREFAERVNKEEKRVDVLINNAGVMRCPAWK-TEDGFDMQFGVNHLGHFLLTNLLLEKLKEPAPSRVINLSSLAHIIGNIDFEDLNWEKKTFDTKQAYCQSKLANVLFTRELAKRLQGTGVTVNAVHPGVVATELGRHTGLHQSQFSSFMLGPFFSLLVKSPALGAQPSVFLAVSEEMEGVTGRYYDVMTEKEPAAQALDDEVACRLWEVSSRLVGLQ 320          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Medaka
Match: rdh12l (retinol dehydrogenase 12 [Source:NCBI gene;Acc:101168330])

HSP 1 Score: 120.939 bits (302), Expect = 4.347e-31
Identity = 80/260 (30.77%), Postives = 129/260 (49.62%), Query Frame = 3
Query:   93 YSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFD 872
            +S    L GK  VITG  +GIG E A  LA++ A V++ CR+++       EIM+K+ +  +   KL+L +S+SI  F E ++    K++IL+NNAG         T +  E Q+ VN +G +LLT  LI L+  S  AR+V +     + G+IN DD+NS + Y+K +A+ QS+L   L  +   K      +T  + +PG   T      +  + F+    +       ++     +T + C     +   SG  Y D
Sbjct:   12 WSSDAKLDGKTVVITGANTGIGKETAIDLAKRGARVIIACRDMEKAQAAVKEIMEKSNSNAVVSMKLDLSNSQSIREFAEVINRDEPKLNILINNAGVMVC-PYGKTADGFEMQIGVNHLGHFLLTYLLIDLIKRSAPARIVTVSSMAHAWGSINLDDLNSEKSYSKSKAYAQSKLANVLFTRSLAKRLEGTGVTAYSLHPGVVQTDLWRHLSAPEQFFMKIARPF----TKNSLQGAQTTIYCAVEPSLDTESGGYYSD 266          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Medaka
Match: zgc:112332 (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:111946613])

HSP 1 Score: 114.775 bits (286), Expect = 8.123e-29
Identity = 74/266 (27.82%), Postives = 132/266 (49.62%), Query Frame = 3
Query:   93 YSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLI------MRHPSVSVETPVMCCSSKGMFGISGKLYFD 872
            +S  + L GK  +ITG  +GIG E A  LA++ A +++ CR+++   + R +I + T N+N+   KL+L  +KSI  F E ++    +V++L+NNAG         T +  E QL VN +G +LLT  L+ L+  S  AR+V +     +   +  DDINS + Y+  +A+ QS+L   +  +   K      ++  + +PG   +            ++H  + + V +       + P    +T + C    G+  +SG+ + D
Sbjct:   11 WSSEERLDGKTVIITGANTGIGKETARDLARRGARIIMACRDLERAEEARTDIFEDTGNENMVIRKLDLSDTKSIKAFAELINKEEKQVNVLINNAGIMMC-PYSKTADGFEMQLGVNHLGHFLLTYLLLDLMKRSAPARIVVVASVAHTWTGLRLDDINSAKSYDTMKAYGQSKLANVMFARSLAKRLKATGVSVFSLHPGVVQS----------DLWRHQHQCIQVAVKIFRVFTKTPVEGAQTTIYCAVEPGLEILSGEYFSD 265          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Medaka
Match: si:ch211-107o10.3 (retinol dehydrogenase 13 [Source:NCBI gene;Acc:101171076])

HSP 1 Score: 103.605 bits (257), Expect = 1.371e-24
Identity = 82/296 (27.70%), Postives = 138/296 (46.62%), Query Frame = 3
Query:   42 VAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAF--HARAT---YNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPE 914
            + G G F +K  +       +  L GK  +ITG  +GIG E A  LAQ+ A V++ CR+++  +    ++  ++ N N+   KL+L S +S+ +  + +    +++DIL+NNAG     + + T +  E Q  VN +G +LLT  L+ LL  S  +R+V +       G I  DDIN  + Y+ ++++ QS+L   L  +   K      +T  + +PG   T    H   T   +    YK F        ++  S   +T + C   + +   SG  Y D       P+ L  E
Sbjct:   18 LTGVGLFAFKRWMAGGVCCSKVRLDGKTVLITGANTGIGKETAVDLAQRGARVIMACRDMERANKAAEDVRKRSGNGNVIVKKLDLASLESVRHLSKEVLASEERLDILINNAGIMSCPQWK-TEDGFEMQFGVNHLGHFLLTNCLLDLLKKSTPSRIVNVSSLAHEKGEIYFDDINLEKDYHPWKSYRQSKLANVLFTRELAKRLEGTGVTTYSLHPGVIKTELGRHFLPTIPLWKRVLYKPFS-----FFIKSSSQGAQTTIYCAVEEKLQNESGLYYSDCAPKTPAPQALDDE 307          
BLAST of Retinol dehydrogenase 13 vs. Ensembl Medaka
Match: si:dkey-23o4.6 (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:101167436])

HSP 1 Score: 101.293 bits (251), Expect = 9.502e-24
Identity = 87/289 (30.10%), Postives = 135/289 (46.71%), Query Frame = 3
Query:  111 LSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDI-NSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPEL---IESAISIMEKLTDLES 965
            L GK  ++TG  SGIG E +  LA++ A VV+ CR++        EI   T N N+    L+L S  S+  F +   +  D++DIL+NNAG     K  LT +  E QLAVN +G +LLT  L+P L +S  +RVV +       G I+ DD+  S   Y    ++ QS+L   L  +   +    + ++    +PG   T                 +   +L+M+ P    +T + C  + G+   SG  + D EE E  PE    E    +  A + + +L D+ S
Sbjct:   28 LDGKTVLVTGANSGIGKETSRDLARRGARVVMACRDLSRAVQAAEEIRKSTGNGNVVVRHLDLASLYSVRTFAKEFLDTEDRLDILINNAGVMMCPK-RLTEDGFETQLAVNHLGHFLLTNLLLPKLRSSSPSRVVNVSSIAHRGGRIDFDDLFFSRRPYGALESYRQSKLANILFTRDLARRLKGSGVSAFCLHPGVIRTELGRHVESWFPLLGALLRLPALLLMKTPWQGCQTTLFCAVTPGLEDRSGCYFSDCEEREAAPEGRDDEAARRLWDASARLVRLGDISS 315          
BLAST of Retinol dehydrogenase 13 vs. Planmine SMEST
Match: SMESG000010198.1 (SMESG000010198.1)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 311/313 (99.36%), Postives = 312/313 (99.68%), Query Frame = 3
Query:   39 PVAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLESQLNE 977
            PVAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGG SGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEI+DKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLESQLNE
Sbjct:    7 PVAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGGASGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIIDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTDLESQLNE 319          
BLAST of Retinol dehydrogenase 13 vs. Planmine SMEST
Match: SMESG000010175.1 (SMESG000010175.1)

HSP 1 Score: 315.849 bits (808), Expect = 5.022e-106
Identity = 150/301 (49.83%), Postives = 220/301 (73.09%), Query Frame = 3
Query:   57 YFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYN-DTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELIESAISIMEKLTD 956
            ++LYK +  VPKY   ++L+GKV +ITGG SGIG ELA+RLA + A ++LGCRNI  C + R +I  K+ N+N++CS+L+LES  SI  FV+RLS +FD+VDIL+NNAGYKG +  E+T  ++EKQLA+N +G +LLTK LI LL+ASK ARV+Y+ICP++  G IN  DIN +++Y+KY+AF QSQLMR LSM++F K++  ++I+FNAC+PG   T FH +++YN +   +   KY++ LI+R    + ETPVMCC S  + G++G+LY D++ +EI   +L P    S+++ ++ L D
Sbjct:   18 FYLYKTYYAVPKYEGNEDLTGKVVLITGGSSGIGKELAYRLAMRQATLILGCRNINKCKESRQKIFLKSNNKNVYCSELDLESYDSINGFVKRLSEKFDRVDILINNAGYKGGKIREITGAFVEKQLAINFIGAHLLTKKLISLLSASKGARVLYLICPQYKEGNINMSDINMIKEYDKYKAFNQSQLMRMLSMRHFAKKFPPSQISFNACDPGMVYTNFHNQSSYNKNIISRLLFKYINTLILRGAWQAPETPVMCCVSDELNGVTGQLYRDLKPLEINENILDP----SSLAFIDLLCD 314          
BLAST of Retinol dehydrogenase 13 vs. Planmine SMEST
Match: SMESG000009696.1 (SMESG000009696.1)

HSP 1 Score: 124.405 bits (311), Expect = 3.720e-32
Identity = 78/265 (29.43%), Postives = 137/265 (51.70%), Query Frame = 3
Query:  102 RDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIM--DKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVE 887
            +  + GKV +ITG  +GIGLE A  LA++  I+ +GCRN + C   R +++   K     +F   ++L S KSI++F ++  + F K+D+L+NNAG      LE T +  E Q+ VN +G +LLT  L+ ++  ++ +R++ +       G IN  D+N   + Y +  A+ QS+L   L  +Y  K      +   + +PG  +T    R      + ++ R   + L M+ P    +T V C  +  +  +SG+ + D + +E
Sbjct:   32 KTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILSFTKKFKHSFTKLDVLINNAGIMMCPYLE-TEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARYLAKILQPFGVAVVSLHPGVVSTEL-IRYLPGIEYLEYARPVFNFL-MKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPIE 293          
BLAST of Retinol dehydrogenase 13 vs. Planmine SMEST
Match: SMESG000049264.1 (SMESG000049264.1)

HSP 1 Score: 122.865 bits (307), Expect = 1.370e-31
Identity = 77/265 (29.06%), Postives = 138/265 (52.08%), Query Frame = 3
Query:  102 RDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIM--DKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDIN-SLEKYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVE 887
            +  + GKV +ITG  +GIGLE A  LA++  I+ +GCRN + C   R +++   K     +F   ++L S KSI++F ++  + F K+D+L+NNAG      LE T +  E Q+ VN +G +LLT  L+ ++ +++ +R++ +       G IN  D+N   + Y +  A+ QS+L   L  ++  K      +   + +PG  +T    R      + ++ R   + L M+ P    +T V C  +  +  +SG+ + D + +E
Sbjct:   32 KTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDETKVFTHTVDLASIKSILSFTKKFKHSFKKLDVLINNAGIMMCPYLE-TEDGFEMQIGVNHLGHFLLTNELLDVIKSTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTEL-IRYLPGIEYLEYARPVFNFL-MKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPME 293          
BLAST of Retinol dehydrogenase 13 vs. Planmine SMEST
Match: SMESG000009674.1 (SMESG000009674.1)

HSP 1 Score: 113.235 bits (282), Expect = 3.837e-28
Identity = 74/265 (27.92%), Postives = 134/265 (50.57%), Query Frame = 3
Query:  102 RDNLSGKVAVITGGGSGIGLELAHRLAQQDAIVVLGCRNIKDCHDKRVEIM--DKTRNQNIFCSKLNLESSKSIINFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLTKSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLE-KYNKYRAFFQSQLMRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYLDVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVE 887
            +  + GKV +ITG  +GIGLE A  LA++  I+ +GCRN + C   R +++   K     +F   ++L S KSI++F ++  + F K+D+L+NNAG       + T +  E Q+ VN +G +LLT  L+ ++  ++ +R++ +       G IN  DIN     +N   ++ QS+L   L  ++  K      +   + +PG  +T    +      + ++ R   + L M+ P    +T V C  +  +  +SG  + D + +E
Sbjct:   32 KTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILSFTKKFKHSFKKLDVLINNAGIM-MWYYQDTEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIINVSSRAHLHGIINKTDINLRGVNFNLLSSYGQSKLSNILHARHLAKILQPFGVAVVSLHPGVVSTGL-PKYLPGIEYLEYARPVFNFL-MKTPYEGSQTSVCCAVNPDLHKLSGLYFSDCQPIE 293          
The following BLAST results are available for this feature:
BLAST of Retinol dehydrogenase 13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RDH139.258e-2727.84retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:H... [more]
RDH139.258e-2727.84retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:H... [more]
DHRS121.252e-2431.16dehydrogenase/reductase 12 [Source:HGNC Symbol;Acc... [more]
RDH125.662e-2328.79retinol dehydrogenase 12 [Source:HGNC Symbol;Acc:H... [more]
RDH125.662e-2328.79retinol dehydrogenase 12 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhs-222.077e-2327.18DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
dhs-222.077e-2327.18DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
dhs-247.979e-2330.17DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
dhs-247.979e-2330.17DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
dhs-79.230e-1324.22DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG20701.165e-3636.77gene:FBgn0033203 transcript:FBtr0088921[more]
CG20701.165e-3636.77gene:FBgn0033203 transcript:FBtr0336999[more]
CG304916.771e-3529.43gene:FBgn0050491 transcript:FBtr0088919[more]
CG304916.771e-3529.43gene:FBgn0050491 transcript:FBtr0336997[more]
CG20647.127e-3530.62gene:FBgn0033205 transcript:FBtr0088923[more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-107o10.32.694e-2929.07si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
si:ch211-107o10.32.694e-2929.07si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
si:ch211-107o10.37.617e-2929.07si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
si:dkey-73n8.33.547e-2732.70si:dkey-73n8.3 [Source:ZFIN;Acc:ZDB-GENE-141219-27... [more]
si:dkey-73n8.35.437e-2732.70si:dkey-73n8.3 [Source:ZFIN;Acc:ZDB-GENE-141219-27... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdh131.734e-3629.26cystatin-like [Source:Xenbase;Acc:XB-GENE-990109][more]
stat3.11.565e-1926.76signal transducer and activator of transcription 3... [more]
runx15.564e-1826.45RUNX family transcription factor 1 [Source:Xenbase... [more]
dhrs121.121e-1726.13dehydrogenase/reductase (SDR family) member 12 [So... [more]
dhrs121.321e-1726.13dehydrogenase/reductase (SDR family) member 12 [So... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rdh133.475e-2527.21retinol dehydrogenase 13 (all-trans and 9-cis) [So... [more]
Dhrs133.188e-2125.50dehydrogenase/reductase (SDR family) member 13 [So... [more]
Rdh124.583e-2128.35retinol dehydrogenase 12 [Source:MGI Symbol;Acc:MG... [more]
Rdh141.981e-2026.49retinol dehydrogenase 14 (all-trans and 9-cis) [So... [more]
Rdh115.325e-2028.40retinol dehydrogenase 11 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NBN7|RDH13_HUMAN4.446e-2627.84Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 G... [more]
sp|Q8CEE7|RDH13_MOUSE2.430e-2427.21Retinol dehydrogenase 13 OS=Mus musculus OX=10090 ... [more]
sp|A0PJE2|DHR12_HUMAN6.013e-2431.16Dehydrogenase/reductase SDR family member 12 OS=Ho... [more]
sp|Q96NR8|RDH12_HUMAN2.719e-2228.79Retinol dehydrogenase 12 OS=Homo sapiens OX=9606 G... [more]
sp|P59837|RDH12_BOVIN5.975e-2229.55Retinol dehydrogenase 12 OS=Bos taurus OX=9913 GN=... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2AR141.727e-4635.05Retinol dehydrogenase 13 OS=Camponotus floridanus ... [more]
A0A1S3D6F96.420e-4333.22retinol dehydrogenase 13 OS=Diaphorina citri OX=12... [more]
A0A433TV804.401e-4232.27Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A293M3J92.188e-4133.21Dehydrogenase (Fragment) OS=Ornithodoros erraticus... [more]
A0A0L8GQG53.798e-4032.23Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdh12l2.844e-3231.58retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
si:dkey-73n8.32.392e-2830.49retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
rdh121.020e-2729.90retinol dehydrogenase 11 [Source:NCBI gene;Acc:103... [more]
si:dkey-94e7.21.341e-2734.93retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
zgc:1123321.997e-2733.18zgc:112332 [Source:ZFIN;Acc:ZDB-GENE-050522-387][more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhrsx9.593e-2835.21dehydrogenase/reductase (SDR family) X-linked [Sou... [more]
rdh14b6.670e-2228.04retinol dehydrogenase 14b [Source:ZFIN;Acc:ZDB-GEN... [more]
RDH135.436e-1527.68retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:H... [more]
dhrs45.368e-1126.20dehydrogenase/reductase (SDR family) member 4 [Sou... [more]
si:dkey-221h15.44.432e-923.61si:dkey-221h15.4 [Source:ZFIN;Acc:ZDB-GENE-041014-... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
YMR226C2.099e-1027.33NADP(+)-dependent serine dehydrogenase and carbony... [more]
ENV91.316e-626.03Protein proposed to be involved in vacuolar functi... [more]
AYR14.445e-628.67Bifunctional triacylglycerol lipase and 1-acyl DHA... [more]
YKL107W_mRNA7.731e-621.01Putative short-chain dehydrogenase/reductase; prop... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468152.195e-2928.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325334.181e-2627.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393464.235e-2327.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350012.787e-2127.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470502.818e-1925.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RDH137.132e-3328.57retinol dehydrogenase 13 [Source:NCBI gene;Acc:101... [more]
rdh12l4.347e-3130.77retinol dehydrogenase 12 [Source:NCBI gene;Acc:101... [more]
zgc:1123328.123e-2927.82retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
si:ch211-107o10.31.371e-2427.70retinol dehydrogenase 13 [Source:NCBI gene;Acc:101... [more]
si:dkey-23o4.69.502e-2430.10retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Retinol dehydrogenase 13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010198.10.000e+099.36SMESG000010198.1[more]
SMESG000010175.15.022e-10649.83SMESG000010175.1[more]
SMESG000009696.13.720e-3229.43SMESG000009696.1[more]
SMESG000049264.11.370e-3129.06SMESG000049264.1[more]
SMESG000009674.13.837e-2827.92SMESG000009674.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026959 ID=SMED30026959|Name=Retinol dehydrogenase 13|organism=Schmidtea mediterranea sexual|type=transcript|length=1196bp
CTATATAAATCTTATATGATATGTACATATTATTACTACCTGTAGCCGGT
TTTGGATATTTTCTATACAAACATCATTTAGGTGTACCTAAGTATTCTGA
GCGCGATAATCTATCTGGAAAAGTAGCAGTTATTACAGGTGGAGGTTCTG
GAATTGGACTTGAATTGGCTCATCGTTTAGCTCAACAAGATGCCATTGTG
GTACTTGGATGCAGAAATATCAAAGATTGTCACGATAAGCGTGTTGAAAT
AATGGATAAAACCAGAAACCAAAATATTTTTTGTTCCAAATTAAATTTAG
AATCAAGCAAATCTATAATAAACTTTGTTGAACGATTATCAAATAGATTT
GACAAGGTTGATATTTTGGTTAATAATGCCGGGTATAAAGGATCTAGAAA
ATTGGAATTAACAAATGAATATATTGAAAAACAGTTGGCGGTAAATGCAG
TTGGACCTTATTTACTAACAAAAAGTCTAATCCCATTATTGACTGCTTCC
AAATCTGCACGTGTAGTGTACATGATTTGTCCAGAATTTTCCATGGGAAC
AATTAACACCGATGACATAAATTCATTAGAAAAATATAACAAATATCGAG
CTTTTTTCCAAAGTCAATTAATGAGATTTTTGTCCATGAAATATTTTACC
AAAGAATATTCAACTAACAAAATCACATTCAACGCGTGCAATCCCGGTCC
AACTAATACAGCATTTCATGCTCGTGCTACGTACAATGATACATTTTATA
AACATTTTAGAAAGTATTTGGATGTTCTAATAATGAGACATCCATCCGTT
AGCGTGGAAACGCCAGTCATGTGTTGCTCATCGAAGGGAATGTTTGGAAT
TTCGGGCAAGCTCTATTTTGATATGGAAGAAGTTGAAATTCAACCCGAGC
TATTAAAGCCGGAATTGATCGAATCTGCAATATCGATTATGGAGAAACTA
ACTGATTTAGAGAGCCAGTTGAATGAATAATTGCTCGTTTAATTCACATT
AAATAAACAAAATCCGTCACTTTATCTTTATTTTACTCCTGGGTAATAAA
TTGCCGATGGAAGCATTAGAAACTTGTCGAGGCGATTTCCCATGTTAAAA
ACGAACGTTTTCGTATTATTCCTCTCGTATAGCGCGTCCCCAATGCACTC
ACACACGATATAACTAGAGCGTTACCCGTGAAAATTAATAAACGCA
back to top

protein sequence of SMED30026959-orf-1

>SMED30026959-orf-1 ID=SMED30026959-orf-1|Name=SMED30026959-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MYILLLPVAGFGYFLYKHHLGVPKYSERDNLSGKVAVITGGGSGIGLELA
HRLAQQDAIVVLGCRNIKDCHDKRVEIMDKTRNQNIFCSKLNLESSKSII
NFVERLSNRFDKVDILVNNAGYKGSRKLELTNEYIEKQLAVNAVGPYLLT
KSLIPLLTASKSARVVYMICPEFSMGTINTDDINSLEKYNKYRAFFQSQL
MRFLSMKYFTKEYSTNKITFNACNPGPTNTAFHARATYNDTFYKHFRKYL
DVLIMRHPSVSVETPVMCCSSKGMFGISGKLYFDMEEVEIQPELLKPELI
ESAISIMEKLTDLESQLNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 111..122
score: 54.57
coord: 216..233
score: 30.54
coord: 35..52
score: 49.07
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 34..168
e-value: 1.1E-25
score: 90.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 24..315
e-value: 7.8E-49
score: 168.3
NoneNo IPR availablePANTHERPTHR43157:SF37RETINOL DEHYDROGENASE 13coord: 21..313
NoneNo IPR availablePANTHERPTHR43157FAMILY NOT NAMEDcoord: 21..313
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 30..278