Lamin

Overview
NameLamin
Smed IDSMED30026956
Length (bp)1646
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lamin (SMED30026956) t-SNE clustered cells

Violin plots show distribution of expression levels for Lamin (SMED30026956) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lamin (SMED30026956) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lamin (SMED30026956) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026956

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30026956SMESG000018461.1 dd_Smed_v4_3707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026956SMESG000018461.1 dd_Smed_v4_3707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lamin vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 61.2326 bits (147), Expect = 2.820e-9
Identity = 101/462 (21.86%), Postives = 200/462 (43.29%), Query Frame = 3
Query:  195 IRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNY----------RQKLEG-YEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNK---LNENL---AIENMKLKKEIEEMRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNR------------------HS---MGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKL-YCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +R++  EN  L++   +  +   +E + IKA    E+   RK L+ V   + +L  +   +REE + L  +   +   L   +    +++  +N+           ++ LEG    L+    ++ +   + K  ++++M + V+ ENR+ T+ EE+D+ K       R   R   T    I N     F++++   ++ L+ Q     E  K+ELEK Y  K ++  +    N NL   A E ++  +    +RID+   ++  +              E+   +  +  + +L EK      ++  ++  ++E       K A++ E+  +R +LE E  R                  HS    GGGS  K++++      + + F   A T+ RV +   DE+  G +++L N ++   ++  W+I+    DD    Y FP +F +K  +V+ +W   A
Sbjct:   49 VRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR----IRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE--SRSSFSQHARTSGRVAVEEVDEE--GKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGA 502          
BLAST of Lamin vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 61.2326 bits (147), Expect = 2.937e-9
Identity = 101/462 (21.86%), Postives = 200/462 (43.29%), Query Frame = 3
Query:  195 IRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNY----------RQKLEG-YEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNK---LNENL---AIENMKLKKEIEEMRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNR------------------HS---MGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKL-YCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +R++  EN  L++   +  +   +E + IKA    E+   RK L+ V   + +L  +   +REE + L  +   +   L   +    +++  +N+           ++ LEG    L+    ++ +   + K  ++++M + V+ ENR+ T+ EE+D+ K       R   R   T    I N     F++++   ++ L+ Q     E  K+ELEK Y  K ++  +    N NL   A E ++  +    +RID+   ++  +              E+   +  +  + +L EK      ++  ++  ++E       K A++ E+  +R +LE E  R                  HS    GGGS  K++++      + + F   A T+ RV +   DE+  G +++L N ++   ++  W+I+    DD    Y FP +F +K  +V+ +W   A
Sbjct:   49 VRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR----IRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE--SRSSFSQHARTSGRVAVEEVDEE--GKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGA 502          
BLAST of Lamin vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 61.2326 bits (147), Expect = 3.275e-9
Identity = 101/462 (21.86%), Postives = 200/462 (43.29%), Query Frame = 3
Query:  195 IRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNY----------RQKLEG-YEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNK---LNENL---AIENMKLKKEIEEMRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNR------------------HS---MGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKL-YCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +R++  EN  L++   +  +   +E + IKA    E+   RK L+ V   + +L  +   +REE + L  +   +   L   +    +++  +N+           ++ LEG    L+    ++ +   + K  ++++M + V+ ENR+ T+ EE+D+ K       R   R   T    I N     F++++   ++ L+ Q     E  K+ELEK Y  K ++  +    N NL   A E ++  +    +RID+   ++  +              E+   +  +  + +L EK      ++  ++  ++E       K A++ E+  +R +LE E  R                  HS    GGGS  K++++      + + F   A T+ RV +   DE+  G +++L N ++   ++  W+I+    DD    Y FP +F +K  +V+ +W   A
Sbjct:   49 VRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR----IRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE--SRSSFSQHARTSGRVAVEEVDEE--GKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGA 502          
BLAST of Lamin vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 60.8474 bits (146), Expect = 4.247e-9
Identity = 101/462 (21.86%), Postives = 200/462 (43.29%), Query Frame = 3
Query:  195 IRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNY----------RQKLEG-YEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNK---LNENL---AIENMKLKKEIEEMRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNR------------------HS---MGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKL-YCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +R++  EN  L++   +  +   +E + IKA    E+   RK L+ V   + +L  +   +REE + L  +   +   L   +    +++  +N+           ++ LEG    L+    ++ +   + K  ++++M + V+ ENR+ T+ EE+D+ K       R   R   T    I N     F++++   ++ L+ Q     E  K+ELEK Y  K ++  +    N NL   A E ++  +    +RID+   ++  +              E+   +  +  + +L EK      ++  ++  ++E       K A++ E+  +R +LE E  R                  HS    GGGS  K++++      + + F   A T+ RV +   DE+  G +++L N ++   ++  W+I+    DD    Y FP +F +K  +V+ +W   A
Sbjct:   49 VRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR----IRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE--SRSSFSQHARTSGRVAVEEVDEE--GKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGA 502          
BLAST of Lamin vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 58.151 bits (139), Expect = 2.610e-8
Identity = 77/331 (23.26%), Postives = 145/331 (43.81%), Query Frame = 3
Query:  555 KITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNK---LNENL---AIENMKLKKEIEEMRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNR------------------HS---MGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKL-YCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            K  ++++M + V+ ENR+ T+ EE+D+ K       R   R   T    I N     F++++   ++ L+ Q     E  K+ELEK Y  K ++  +    N NL   A E ++  +    +RID+   ++  +              E+   +  +  + +L EK      ++  ++  ++E       K A++ E+  +R +LE E  R                  HS    GGGS  K++++      + + F   A T+ RV +   DE+  G +++L N ++   ++  W+I+    DD    Y FP +F +K  +V+ +W   A
Sbjct:   99 KKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR----IRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE--SRSSFSQHARTSGRVAVEEVDEE--GKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGA 421          
BLAST of Lamin vs. Ensembl Mouse
Match: Lmna (lamin A [Source:MGI Symbol;Acc:MGI:96794])

HSP 1 Score: 52.7582 bits (125), Expect = 9.744e-7
Identity = 107/495 (21.62%), Postives = 212/495 (42.83%), Query Frame = 3
Query:  114 ESTNSPINSP-----FLDKKDTSGSASKLGEYI---RNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNY----------RQKLEG-YEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNK---LNENL---AIENMKLKKEIEEMRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGSSPKRKR----------ICKINPTNEAKFDIS---------AFTNDRVKL-YCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +++++P+ SP       +K+D      +L  YI   R++  EN  L++   +  +   +E + IKA    E+   RK L+ V   + +L  +   +REE + L  +   +   L   +    +++  +N+           ++ LEG    L+    ++ +   + K  ++++M + V+ ENR+ TL EE+D+ K       R   R   T    I N     F++++   ++ L+ Q     E  K+ELEK Y  K ++  +    N NL   A E ++  +    +RID+   ++  +              E+   +  +  + +L EK      ++  ++  ++E       K A++ E+  +R +LE E  R  +    + +R R              + T + K + S         A T+ RV +   DE+  G +++L N ++   ++  W+I     DD    Y FP +F +K  +V+ +W   A
Sbjct:   15 QASSTPL-SPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR----IRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQSQGGGSVTKKRKLESSESRSSFSQHARTSGRVAVEEVDEE--GKFVRLRNKSNEDQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVTIWASGA 502          
BLAST of Lamin vs. Ensembl Mouse
Match: Lmna (lamin A [Source:MGI Symbol;Acc:MGI:96794])

HSP 1 Score: 52.7582 bits (125), Expect = 1.009e-6
Identity = 99/460 (21.52%), Postives = 196/460 (42.61%), Query Frame = 3
Query:  195 IRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNY----------RQKLEG-YEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNK---LNENL---AIENMKLKKEIEEMRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGSSPKRKR----------ICKINPTNEAKFDIS---------AFTNDRVKL-YCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +R++  EN  L++   +  +   +E + IKA    E+   RK L+ V   + +L  +   +REE + L  +   +   L   +    +++  +N+           ++ LEG    L+    ++ +   + K  ++++M + V+ ENR+ TL EE+D+ K       R   R   T    I N     F++++   ++ L+ Q     E  K+ELEK Y  K ++  +    N NL   A E ++  +    +RID+   ++  +              E+   +  +  + +L EK      ++  ++  ++E       K A++ E+  +R +LE E  R  +    + +R R              + T + K + S         A T+ RV +   DE+  G +++L N ++   ++  W+I     DD    Y FP +F +K  +V+ +W   A
Sbjct:   49 VRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR----IRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQSQGGGSVTKKRKLESSESRSSFSQHARTSGRVAVEEVDEE--GKFVRLRNKSNEDQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVTIWASGA 502          
BLAST of Lamin vs. UniProt/SwissProt
Match: sp|P02545|LMNA_HUMAN (Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.040e-8
Identity = 101/462 (21.86%), Postives = 200/462 (43.29%), Query Frame = 3
Query:  195 IRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNY----------RQKLEG-YEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNK---LNENL---AIENMKLKKEIEEMRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNR------------------HS---MGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKL-YCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +R++  EN  L++   +  +   +E + IKA    E+   RK L+ V   + +L  +   +REE + L  +   +   L   +    +++  +N+           ++ LEG    L+    ++ +   + K  ++++M + V+ ENR+ T+ EE+D+ K       R   R   T    I N     F++++   ++ L+ Q     E  K+ELEK Y  K ++  +    N NL   A E ++  +    +RID+   ++  +              E+   +  +  + +L EK      ++  ++  ++E       K A++ E+  +R +LE E  R                  HS    GGGS  K++++      + + F   A T+ RV +   DE+  G +++L N ++   ++  W+I+    DD    Y FP +F +K  +V+ +W   A
Sbjct:   49 VRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR----IRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTE--SRSSFSQHARTSGRVAVEEVDEE--GKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGA 502          
BLAST of Lamin vs. UniProt/SwissProt
Match: sp|P11048|LMNA_XENLA (Lamin-A OS=Xenopus laevis OX=8355 GN=lmna PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.803e-6
Identity = 107/495 (21.62%), Postives = 209/495 (42.22%), Query Frame = 3
Query:  105 RERESTNSPINSP-----FLDKKDTSGSASKLGEYI---RNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNY----------RQKLEG-YEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIENMKLKKEIEE--MRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEK----HSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNR-------------------HSMG--GGSSPKRKRICKINPTNEAKFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIE-IVSDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            R   ST++P+ SP       +K+D  G   +L  YI   R++  EN +L++   +  D   +E   IK+    E+   RK L+ V   + +L  +   +REE + L  +   + S L   +    +++  +N+           ++ LE     LK    ++ +     K  ++++M + V+ ENR  TL EE+++ K       R   R   T    + N     F++K+   +  L+ Q        KEEL K Y  K  +  +  E  +    + ++EI++  +RID+   ++  +              E+   +  +  + +L +K      ++  ++  ++E       K A++ E++ +R +LE E  R                   HS      S+ KR+R+ +   +  + F   A T  +V +  +    G Y++L N ++   +L  W+I+  + D+   VY FP R  +K  + + +W   A
Sbjct:    8 RATRSTHTPL-SPTRITRLQEKEDLQGLNDRLAVYIDKVRSLELENARLRLRITESEDVISREVTGIKSAYETELADARKTLDSVAKERARLQLELSKIREEHKELKARNAKKESDLLTAQARLKDLEALLNSKDAALTTALGEKRNLENEIRELKAHIAKLEASLADTKKQLQDEMLRRVDTENRNQTLKEELEFQKSIYNEEMRETKRRHETRLVEVDNGRQREFESKLADALHELRAQHEGQIGLYKEELGKTYNAKLENAKQSAERNSSLVGEAQEEIQQSRIRIDSLSAQLSQLQKQLAAREAKLRDLEDAYARERDSSRRLLADKDREMAEMRARMQQQLDEYQELLDIKLALDMEINAYRKLLEGEEERLRLSPSPNTQKRSARTIASHSGAHISSSASKRRRLEE-GESRSSSFTQHARTTGKVSVE-EVDPEGKYVRLRNKSNEDQSLGNWQIKRQIGDETPIVYKFPPRLTLKAGQTVTIWASGA 499          
BLAST of Lamin vs. UniProt/SwissProt
Match: sp|P13648|LMNA_CHICK (Lamin-A OS=Gallus gallus OX=9031 GN=LMNA PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.144e-6
Identity = 94/476 (19.75%), Postives = 188/476 (39.50%), Query Frame = 3
Query:  195 IRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNYRQKLEGYEA------------------LKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQTENRLKE----ILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNR-------------------HSMGGGSSPKRK---RICKINPTNEAKFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDALSVMDDEDNI 1445
            +R++  EN  L++   +  +   +E + IKA    E+   RK L+ V   + +L  +   +REE +          +     + + +  Q ++ +    L   EA                  L+    ++    ++ K  ++++M + V+ ENR+ TL EE+++ K       R   R   T    I N     F++K+   ++ L+ Q      H ++ELEK Y  K  +  +  E  +       +E+++  I   D +    +   +     E       +  +R +E    +L EK      ++  ++  ++E       K A++ E++ +R +LE E  R                   HS G GS+ KR+      +        F   A T+ RV +  +    G +++L N ++    L  W+++    DD    Y FP +F +K  + + +W   A +      ++
Sbjct:   48 VRSLELENAGLRLRITESEEVVSREVSGIKAAYEAELADARKTLDSVAKERARLQLELSKVREEHK-------ELKARNAKKEADLLAAQARLKDLEALLNSKEAALSTALGEKRNLENEVRDLRAQVAKLEGALSEAKKQLQDEMLRRVDAENRLQTLKEELEFQKNIYSEELRETKRRHETRLVEIDNGRQQEFESKLAEALQDLRRQHEDQIRHYRDELEKTYGAKLENAKQSAERNSSMAGAAHEELQQTHI-RIDSLSAELSQLQKQLAAKEAKLREVEEALSREREGGRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEINAYRKLLEGEEERLRLSPSPSSQRGARSSGLQHS-GAGSAKKRRLEDGEGREGREGRTSFSHHARTSGRVGVE-EVDLEGRFVRLRNKSNEDQALGNWQVKRQNGDDPPLTYRFPPKFTLKAGQAVTIWASGAGATHSPPSDV 513          
BLAST of Lamin vs. UniProt/SwissProt
Match: sp|P48678|LMNA_MOUSE (Prelamin-A/C OS=Mus musculus OX=10090 GN=Lmna PE=1 SV=2)

HSP 1 Score: 52.7582 bits (125), Expect = 7.056e-6
Identity = 99/460 (21.52%), Postives = 196/460 (42.61%), Query Frame = 3
Query:  195 IRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNY----------RQKLEG-YEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNK---LNENL---AIENMKLKKEIEEMRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGSSPKRKR----------ICKINPTNEAKFDIS---------AFTNDRVKL-YCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +R++  EN  L++   +  +   +E + IKA    E+   RK L+ V   + +L  +   +REE + L  +   +   L   +    +++  +N+           ++ LEG    L+    ++ +   + K  ++++M + V+ ENR+ TL EE+D+ K       R   R   T    I N     F++++   ++ L+ Q     E  K+ELEK Y  K ++  +    N NL   A E ++  +    +RID+   ++  +              E+   +  +  + +L EK      ++  ++  ++E       K A++ E+  +R +LE E  R  +    + +R R              + T + K + S         A T+ RV +   DE+  G +++L N ++   ++  W+I     DD    Y FP +F +K  +V+ +W   A
Sbjct:   49 VRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR----IRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQSQGGGSVTKKRKLESSESRSSFSQHARTSGRVAVEEVDEE--GKFVRLRNKSNEDQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVTIWASGA 502          
BLAST of Lamin vs. UniProt/SwissProt
Match: sp|Q3ZD69|LMNA_PIG (Prelamin-A/C OS=Sus scrofa OX=9823 GN=LMNA PE=3 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 7.426e-6
Identity = 95/460 (20.65%), Postives = 197/460 (42.83%), Query Frame = 3
Query:  195 IRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNY----------RQKLEG-YEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYK-------RLNDRSKTTLETNIQNAAN--FDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNK---LNENL---AIENMKLKKEIEEMRIDNFD-KIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS----LKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGSSPKRKRICKINPTNEAKFDIS-------------------AFTNDRVKL-YCDEQCNGDYIKLMNDTDNPINLNEWKIEIV-SDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +R++  EN  L++   +  +   +E + IK+    E+   RK L+ V   + +L  +   +REE + L  +   +   L   +    +++  +N+           ++ LEG    L+    ++ +   + K  ++++M + V+ ENR+ TL EE+D+ K       R   R   T    I N     F++++   ++ L+ Q     E  K+ELEK Y  K ++  +    N NL   A E ++  +    +RID+   ++  +              E+   +  +  + +L +K      ++  ++  ++E       K A++ E+  +R +LE E  R  +    + +R R    + +++ +   S                   A T+ RV +   DE+  G +++L N ++   ++  W+I+    DD    Y FP +F +K  +V+ +W   A
Sbjct:   49 VRSLETENAGLRLRITESEEVVSREVSGIKSAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLMAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQDLRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSR----IRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLADKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQSGGSVTKKRKLESSESRSSFSQHARTSGRVAVEEVDEE--GKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGA 502          
BLAST of Lamin vs. TrEMBL
Match: A0A4Z2DLB2 (Lamin-B2 isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_011225 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.958e-9
Identity = 96/451 (21.29%), Postives = 201/451 (44.57%), Query Frame = 3
Query:  189 EYIRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLNDRSKTTL---------ETNIQNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIEN--------MKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGS--SP------KRKRI--------CKINPTNEAK--------FDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +Y+R +  + +KL    Q + +    +    + T  +EI  LR  ++D+   K K   D+K  R+E   +  K          L+++   ++ +++ ++Q  + Y+ L  DY  +     + K  ++ +     +LEN+I  L E++D+  RL D  +  L         E   +  A +++++  ++  ++ Q  ++ E  K ++E+ +ENK   + K + N + E+        +  +K  +++  D   KI  +  L  R++++     +  R  E +L     E   LK +LE +  E +     K A++ E+  +R +LE E +R ++   S  SP      KR+RI          +N T  +         + +S+     V+ + ++  +G +IK+ N +   +NL  W++   +D  +  + F   F +K      +W +DA
Sbjct:  111 DYVRKLELDKQKLTKRIQTVTEERMSKVEEARKTYEDEITALRNLVDDLAKQKSKAELDSKQTRDELNDMKTKANKREQENRNLQRKIENLERELSKFKQDHDAYQPLLSDYHVLEKRFEEMKRDLEAETLLRTDLENKILGLKEQLDFRSRLFDEEREKLVERSLYIEEEVEGRKHAEYESRLTEELRSIRDQTASELEEYKIQMEETFENKLGQL-KSSANFSAEDACRQRSELLMARKRADDLSHDLSKKIAELELLQRRVTDLEGQLSDERRDFEAQLLFQRQEVERLKEELEESFREFTDLMNTKIALDQEILMYRKMLEGEESRLNLTPASRDSPFNIHTVKRRRIDGDYDGDDSTVNLTGSSYSSSRSRFAYRVSSTARGPVEFFKEQDIHGKWIKIYNSSTEEVNLGSWELVHEADGHETRFKFSRTFSLKPGTTCTIWSQDA 560          
BLAST of Lamin vs. TrEMBL
Match: A0A4Z2DL98 (Lamin-B2 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_011225 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.983e-9
Identity = 96/451 (21.29%), Postives = 201/451 (44.57%), Query Frame = 3
Query:  189 EYIRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLNDRSKTTL---------ETNIQNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIEN--------MKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGS--SP------KRKRI--------CKINPTNEAK--------FDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +Y+R +  + +KL    Q + +    +    + T  +EI  LR  ++D+   K K   D+K  R+E   +  K          L+++   ++ +++ ++Q  + Y+ L  DY  +     + K  ++ +     +LEN+I  L E++D+  RL D  +  L         E   +  A +++++  ++  ++ Q  ++ E  K ++E+ +ENK   + K + N + E+        +  +K  +++  D   KI  +  L  R++++     +  R  E +L     E   LK +LE +  E +     K A++ E+  +R +LE E +R ++   S  SP      KR+RI          +N T  +         + +S+     V+ + ++  +G +IK+ N +   +NL  W++   +D  +  + F   F +K      +W +DA
Sbjct:  111 DYVRKLELDKQKLTKRIQTVTEERMSKVEEARKTYEDEITALRNLVDDLAKQKSKAELDSKQTRDELNDMKTKANKREQENRNLQRKIENLERELSKFKQDHDAYQPLLSDYHVLEKRFEEMKRDLEAETLLRTDLENKILGLKEQLDFRSRLFDEEREKLVERSLYIEEEVEGRKHAEYESRLTEELRSIRDQTASELEEYKIQMEETFENKLGQL-KSSANFSAEDACRQRSELLMARKRADDLSHDLSKKIAELELLQRRVTDLEGQLSDERRDFEAQLLFQRQEVERLKEELEESFREFTDLMNTKIALDQEILMYRKMLEGEESRLNLTPASRDSPFNIHTVKRRRIDGDYDGDDSTVNLTGSSYSSSRSRFAYRVSSTARGPVEFFKEQDIHGKWIKIYNSSTEEVNLGSWELVHEADGHETRFKFSRTFSLKPGTTCTIWSQDA 560          
BLAST of Lamin vs. TrEMBL
Match: A0A4Z2DLD5 (Lamin-B2 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_011225 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.992e-9
Identity = 96/451 (21.29%), Postives = 201/451 (44.57%), Query Frame = 3
Query:  189 EYIRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLNDRSKTTL---------ETNIQNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIEN--------MKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGS--SP------KRKRI--------CKINPTNEAK--------FDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            +Y+R +  + +KL    Q + +    +    + T  +EI  LR  ++D+   K K   D+K  R+E   +  K          L+++   ++ +++ ++Q  + Y+ L  DY  +     + K  ++ +     +LEN+I  L E++D+  RL D  +  L         E   +  A +++++  ++  ++ Q  ++ E  K ++E+ +ENK   + K + N + E+        +  +K  +++  D   KI  +  L  R++++     +  R  E +L     E   LK +LE +  E +     K A++ E+  +R +LE E +R ++   S  SP      KR+RI          +N T  +         + +S+     V+ + ++  +G +IK+ N +   +NL  W++   +D  +  + F   F +K      +W +DA
Sbjct:   76 DYVRKLELDKQKLTKRIQTVTEERMSKVEEARKTYEDEITALRNLVDDLAKQKSKAELDSKQTRDELNDMKTKANKREQENRNLQRKIENLERELSKFKQDHDAYQPLLSDYHVLEKRFEEMKRDLEAETLLRTDLENKILGLKEQLDFRSRLFDEEREKLVERSLYIEEEVEGRKHAEYESRLTEELRSIRDQTASELEEYKIQMEETFENKLGQL-KSSANFSAEDACRQRSELLMARKRADDLSHDLSKKIAELELLQRRVTDLEGQLSDERRDFEAQLLFQRQEVERLKEELEESFREFTDLMNTKIALDQEILMYRKMLEGEESRLNLTPASRDSPFNIHTVKRRRIDGDYDGDDSTVNLTGSSYSSSRSRFAYRVSSTARGPVEFFKEQDIHGKWIKIYNSSTEEVNLGSWELVHEADGHETRFKFSRTFSLKPGTTCTIWSQDA 525          
BLAST of Lamin vs. TrEMBL
Match: A0A0X3NM60 (Lamin-B2 OS=Schistocephalus solidus OX=70667 GN=LMNB2 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.850e-9
Identity = 106/495 (21.41%), Postives = 219/495 (44.24%), Query Frame = 3
Query:   99 SNRERESTNSPINSPFLDKKDTSGSAS-KLGEYI---RNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLNDR------SKT-TLETNIQN--AANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQT-------ENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGSSPKR---------KR--------------ICKINPTNEAKFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCFPNRF-IKGKRVLNVWRKDALSVMDDEDNIRM 1451
            S R RE + SP+N    D+K+   S + +L  YI   R +  + E +K + Q + +      +  + T  +EI  LR+ ++D+   K     + K  R++     NKL         L+++   ++  ++ ++   E Y+ LK ++  +       +  ++ +     +LEN++A L EE+D+  RL D       S+T T+E  I++  AA +++++  ++   + Q   + +  + ++E  ++ K +++   N N + E+++L+ EI  +R    D  H +      +  +N    +   Q        EN+L+    E   L+ +LE    E +     K A++ E+  +R +LE E +R ++    SP+R         KR              + + + T    F +S      V+   ++   G ++KL+N +D  ++L  W ++  +D  +  + F     +K      +W  DA +  +   +I M
Sbjct:   43 SPRRRERSVSPLNITRSDEKEELASLNDRLAHYIDYVRKLEKDKETMKRKIQSITEERISRVDEARRTYEDEIASLRQLVDDLAKQKAVTDMELKKHRDDAADAKNKLARRDLEARGLQRKVDALEHDLSAFKDDHERYQRLKPEFDTLEKRLEAMRRDLEAETILRTDLENKVAGLREELDFKNRLFDEERQKLVSRTLTIEEEIEDRKAAEYESRLADELLSFRQQTGDELQEYRCQMENTFQKKLDELRAANSNASDESLRLRDEIIVVRKRADDLTHELAKKTGEVDLLNRRLSDLEHQLNQEREDFENQLRAQRAEVKRLQDELELRFGEFTDLMNTKIALDQEILMYRKMLEGEESRLNI---QSPQRDSAFYLAGKKRRLDADYDDETSSSEMPETSSTARYSFRVSTSATGGVEFSSEQDGQGRWVKLVNSSDEDVSLGNWVLKHQADGRECSFKFHRSVTLKPSATCTIWSSDAGATHNPPKDIVM 534          
BLAST of Lamin vs. TrEMBL
Match: A0A564ZD22 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14838 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.985e-9
Identity = 95/421 (22.57%), Postives = 181/421 (42.99%), Query Frame = 3
Query:  459 MQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRL--NDRSKTTLETNI-------QNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXX---QTENRLKEILV----EKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETN--------RHSM--GGGSSPKRKRICKINPTNE--------AKFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCFP-NRFIKGKRVLNVWRKDALSVMDDEDNIRMNVALPDFSKSFSCELTNDMYEFEASFQLKRTYQRKFIKAHQRN*IV--SEKCSIL 1610
            ++  I  Y+   E Y+ L  ++ ++       K  +K +     +LEN++A+L EE+D+  RL   +RSK  + T           A  F++++  +++  +     + E  + ++E  ++NK   + K NE    +  +L +E+  MR  N D  H +   +  +  ++    +  +   +T +  +  L     E   L+ +LE    E +     K  ++ E+  +R +LE E +        RHS   GG  S K++R+   +  +E            +S  +   ++   D+  +G ++KL N     INL  W ++  SD  +  Y F  N  +K   +  +W  DA +  +  ++I M         + +  LTND  E +AS  + R  + K I    R       EKCS++
Sbjct:  164 LERDIGAYKADHERYQKLLPEFEDLEKNLEAAKEGLKAETILRTDLENKVASLREELDFKDRLFQEERSKLVMHTLTVEEEVAETKAMEFESRLADELQAYRDSANEELEQYRFQMESTFQNKLEQLQKANEEANRDGGRLTEELTIMRRMNDDLSHELARKSREVELLHGRIADLEKLLNKTHDDYQAQLAAEREEIKRLRSELEQRFAEFTDLMNTKVVLDQEILMYRKMLEGEESRLNLTSPKRHSAFSGGFMSAKKRRLDSGDGFDEESGSSGSQTAIRVSTSSVGSIEFSADQDGSGKWVKLGNVGKEDINLGNWVLKHKSDGEEVTYKFARNVTLKPGTLCTLWSSDAGATHNPPEDIVMKNQSFHTGANITVTLTNDNEEEQASCLIVRESRPKLISRRFRAGATKSDEKCSLM 584          
BLAST of Lamin vs. Ensembl Cavefish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 53.9138 bits (128), Expect = 3.426e-7
Identity = 71/336 (21.13%), Postives = 143/336 (42.56%), Query Frame = 3
Query:  510 LKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLND----RSKTTLETNI-----QNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFY----ENKSNDVNKLNENLAIENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHS--------LKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGSSPKRKRICKINPTNEAKFDISA--FTNDRV--------KLYCDE-QCNGDYIKLMNDTDNPINLNEWKIE-IVSDDFKDVYCFPNRF-IKGKRVLNVWRKDA 1415
            LK    ++    N  K  ++++M + V+ ENRI TL EE+++ K + +     SK   E+ I          F++K+   +  L+ Q        KEE+EK Y    EN     ++ N +L        +E+++ R+   + +    +   +     E       +  +R ++++  +          ++  ++  ++E       K A++ E+S +R +LE E  R  +     P RKR  ++N T+     ++    T  R+        ++  DE    G +++L N  D   +L  W+++  V      +Y FP +F +K  + + +W   A
Sbjct:  162 LKAQLAKLEGSLNDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYNEELRESKRRHESRIVEIDSGKQQEFESKLADALTELRGQHEEQLRIYKEEIEKTYNAKLENARQSADR-NSHLV---GAAHEELQQTRV-RLESMSAQLSQLQKQLAAREAKVRELEEALSRERDMMRRRLDEREREMSDMRQRMQQQLDEYQELLDIKLALDMEISAYRKLLEGEEERLRLSPSPPPTRKR--RLNDTDSEASSVAGGMVTRTRITQQASASGRITVDEVDLEGKFVRLSNKADQDQSLGHWQVKRQVGTSTPIIYKFPPKFTLKAGQSVTIWASGA 490          
BLAST of Lamin vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 49.6766 bits (117), Expect = 6.505e-6
Identity = 72/337 (21.36%), Postives = 148/337 (43.92%), Query Frame = 3
Query:  519 DYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLND--------RSKTTL-ETNIQNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKL---NENLA------IENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQ-TENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNR----------------HSMGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKLYCDE-QCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKD-VYCFPNR-FIKGKRVLNVWRKDA 1415
            D LE + +N K +I   ++  + V++EN+I TL E++D+ K + +        R +T L E +      F++K+   ++ L+ +  A  +  K++LE+ +  K  +  ++   N + A      +   KL+ E + ++I N   + T N+         E   +R RQ +  RL +   E   ++  +++ + E  +    K  ++ E++ +R +LE E  R                H+ G   +  +KR  +        + +S  ++ R  +  DE    G++IKL N++D   +L  W +        D V+  P    ++ +  + +W   A
Sbjct:  173 DNLESALQNAKTQIN--SETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGRQKEFESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKLENAKQVAVKNSDFATSTKEELAGTKLRLESQSLQISN---LQTQNSTLEARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQSLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSISRTHAQGTRKAGSKKRKHEGASGLSPSYKVSQHSSSRGVVSIDEIDLMGNFIKLRNNSDTDQSLGGWVVRKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGA 504          
BLAST of Lamin vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 49.6766 bits (117), Expect = 7.529e-6
Identity = 72/337 (21.36%), Postives = 148/337 (43.92%), Query Frame = 3
Query:  519 DYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLND--------RSKTTL-ETNIQNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKL---NENLA------IENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQ-TENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNR----------------HSMGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKLYCDE-QCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKD-VYCFPNR-FIKGKRVLNVWRKDA 1415
            D LE + +N K +I   ++  + V++EN+I TL E++D+ K + +        R +T L E +      F++K+   ++ L+ +  A  +  K++LE+ +  K  +  ++   N + A      +   KL+ E + ++I N   + T N+         E   +R RQ +  RL +   E   ++  +++ + E  +    K  ++ E++ +R +LE E  R                H+ G   +  +KR  +        + +S  ++ R  +  DE    G++IKL N++D   +L  W +        D V+  P    ++ +  + +W   A
Sbjct:  173 DNLESALQNAKTQIN--SETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGRQKEFESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKLENAKQVAVKNSDFATSTKEELAGTKLRLESQSLQISN---LQTQNSTLEARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQSLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSISRTHAQGTRKAGSKKRKHEGASGLSPSYKVSQHSSSRGVVSIDEIDLMGNFIKLRNNSDTDQSLGGWVVRKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGA 504          
BLAST of Lamin vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 49.2914 bits (116), Expect = 9.471e-6
Identity = 72/337 (21.36%), Postives = 148/337 (43.92%), Query Frame = 3
Query:  519 DYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLND--------RSKTTL-ETNIQNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKL---NENLA------IENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQ-TENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNR----------------HSMGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKLYCDE-QCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKD-VYCFPNR-FIKGKRVLNVWRKDA 1415
            D LE + +N K +I   ++  + V++EN+I TL E++D+ K + +        R +T L E +      F++K+   ++ L+ +  A  +  K++LE+ +  K  +  ++   N + A      +   KL+ E + ++I N   + T N+         E   +R RQ +  RL +   E   ++  +++ + E  +    K  ++ E++ +R +LE E  R                H+ G   +  +KR  +        + +S  ++ R  +  DE    G++IKL N++D   +L  W +        D V+  P    ++ +  + +W   A
Sbjct:  173 DNLESALQNAKTQIN--SETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGRQKEFESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKLENAKQVAVKNSDFATSTKEELAGTKLRLESQSLQISN---LQTQNSTLEARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQSLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSISRTHAQGTRKAGSKKRKHEGASGLSPSYKVSQHSSSRGVVSIDEIDLMGNFIKLRNNSDTDQSLGGWVVRKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGA 504          
BLAST of Lamin vs. Planmine SMEST
Match: SMESG000018461.1 (SMESG000018461.1)

HSP 1 Score: 911.368 bits (2354), Expect = 0.000e+0
Identity = 494/495 (99.80%), Postives = 494/495 (99.80%), Query Frame = 3
Query:   96 MSNRERESTNSPINSPFLDKKDTSGSASKLGEYIRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLNDRSKTTLETNIQNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCFPNRFIKGKRVLNVWRKDALSVMDDEDNIRMNVALPDFSKSFSCELTNDMYEFEASFQLKRTYQRKFIKAHQRN 1580
            MSNRERESTNSPINSPFLDKKDTSGSASKLGEYIRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFLNNKLKNESSSLNILKKETIEMQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLNDRSKTTLETNIQNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIENMKLKKEIEEMRIDNFDKIHTINNLNNRISNINEFNENRNRQTENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHS GGGSSPKRKRICKINPTNEAKFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCFPNRFIKGKRVLNVWRKDALSVMDDEDNIRMNVALPDFSKSFSCELTNDMYEFEASFQLKRTYQRKFIKAHQRN
Sbjct:    1 MSNRERESTNSPINSPFLDKKDTSGSASKLGEYIRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFLNNKLKNESSSLNILKKETIEMQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLNDRSKTTLETNIQNAANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIENMKLKKEIEEMRIDNFDKIHTINNLNNRISNINEFNENRNRQTENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSTGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCFPNRFIKGKRVLNVWRKDALSVMDDEDNIRMNVALPDFSKSFSCELTNDMYEFEASFQLKRTYQRKFIKAHQRN 495          
BLAST of Lamin vs. Planmine SMEST
Match: SMESG000047473.1 (SMESG000047473.1)

HSP 1 Score: 432.565 bits (1111), Expect = 1.415e-146
Identity = 274/522 (52.49%), Postives = 368/522 (70.50%), Query Frame = 3
Query:   78 KNNV*RMSNRERESTNSPINSPFLDKKDTSGSASKLGEYIRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLNDRSKTTLETN---IQNAANFDAK-VNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNE-------NLAIENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCFPNRFIKGKRVLNVWRKDALSVMDDEDNIRMNVALPDFSKSFSCELTNDMYEFEASFQLKRTYQRKFIKAHQRN*IVSEKCSIL 1610
            K N  R S + R+STNS +N+ F DK++  G A+ + +Y+RNI   NE LK E Q LI+S++K+   IK+T GEEID LRKAL+D+ +S IKL  +NK+++EE++ L+NKLKNE+ SLN +K + IE+QE I+NYR+KLEGYE LKQ+Y +IS ENNKNK+ +KN++ KCVELENR  TLTEE+D+YK+LN  SK T ET+   IQN  N DA   N +VEILK QLT DFEHC+E+LEKFY+NK N++ K NE        L  EN  LK+EIE +R DNF K + I+ LNNRI + NEF E R+R+ +N LK++L E   L+  L   I ELS    EK A+E E   F ++LE E  R ++ G ++PKR++I   N   + KF I+A+TND +KL+CDE+ NG +IKL+ND+D  IN+NEWK+ I++DD   VYCFP++ I  K+ L +W  D+  VMDD DNIR+N++LPD S   SC LTNDM  FEASF+LKR   RK +KAH RN   +E+C+I+
Sbjct:    8 KENQSRRSIKPRKSTNSSLNASFADKENVDGLANYI-DYVRNIEASNENLKNEKQNLIESYEKDIYTIKSTYGEEIDSLRKALDDLATSTIKLNLENKSLQEERDCLSNKLKNETYSLNAMKTDMIELQENISNYRKKLEGYEVLKQEYSDISIENNKNKVALKNEICKCVELENRRITLTEEVDFYKKLNANSKITTETSFSIIQNTHNSDANDKNEQVEILKRQLTEDFEHCREKLEKFYDNKCNEIMKANEKSILRYNTLFGENSNLKREIENLRNDNFAKDNQISALNNRIVSFNEFIEQRDREHDNHLKDMLNENRILQDKLNLKIQELSDLVDEKIALEKEFYVFTTLLEGEKTRCNISGVTTPKRRKIN--NDDTDDKFQINAYTNDAMKLFCDEEYNGGHIKLLNDSDKLININEWKLTIITDDSTSVYCFPDKNIDSKQTLQIWTVDS-PVMDDVDNIRLNISLPDLSVLRSCTLTNDMDGFEASFKLKRAEPRKILKAHPRNVQTNERCAIM 525          
BLAST of Lamin vs. Planmine SMEST
Match: SMESG000047473.1 (SMESG000047473.1)

HSP 1 Score: 431.409 bits (1108), Expect = 5.105e-146
Identity = 274/523 (52.39%), Postives = 369/523 (70.55%), Query Frame = 3
Query:   78 KNNV*RMSNRERESTNSPINSPFLDKKDTSGSASKLGEYIRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLNDRSKTTLETN---IQNAANFDAK-VNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNE-------NLAIENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGGSSPKRKRICKINPTNEAKFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCFPNRFIKGKRVLNVWRKDALSVMDDEDNIRMNVALPDFSKSFSCELTNDMYEFEASFQLKRTYQRKFIKAHQRN*IVSEKCSILL 1613
            K N  R S + R+STNS +N+ F DK++  G A+ + +Y+RNI   NE LK E Q LI+S++K+   IK+T GEEID LRKAL+D+ +S IKL  +NK+++EE++ L+NKLKNE+ SLN +K + IE+QE I+NYR+KLEGYE LKQ+Y +IS ENNKNK+ +KN++ KCVELENR  TLTEE+D+YK+LN  SK T ET+   IQN  N DA   N +VEILK QLT DFEHC+E+LEKFY+NK N++ K NE        L  EN  LK+EIE +R DNF K + I+ LNNRI + NEF E R+R+ +N LK++L E   L+  L   I ELS    EK A+E E   F ++LE E  R ++ G ++PKR++I   N   + KF I+A+TND +KL+CDE+ NG +IKL+ND+D  IN+NEWK+ I++DD   VYCFP++ I  K+ L +W  D+  VMDD DNIR+N++LPD S   SC LTNDM  FEASF+LKR   RK +KAH RN   +E+C+I++
Sbjct:    8 KENQSRRSIKPRKSTNSSLNASFADKENVDGLANYI-DYVRNIEASNENLKNEKQNLIESYEKDIYTIKSTYGEEIDSLRKALDDLATSTIKLNLENKSLQEERDCLSNKLKNETYSLNAMKTDMIELQENISNYRKKLEGYEVLKQEYSDISIENNKNKVALKNEICKCVELENRRITLTEEVDFYKKLNANSKITTETSFSIIQNTHNSDANDKNEQVEILKRQLTEDFEHCREKLEKFYDNKCNEIMKANEKSILRYNTLFGENSNLKREIENLRNDNFAKDNQISALNNRIVSFNEFIEQRDREHDNHLKDMLNENRILQDKLNLKIQELSDLVDEKIALEKEFYVFTTLLEGEKTRCNISGVTTPKRRKIN--NDDTDDKFQINAYTNDAMKLFCDEEYNGGHIKLLNDSDKLININEWKLTIITDDSTSVYCFPDKNIDSKQTLQIWTVDS-PVMDDVDNIRLNISLPDLSVLRSCTLTNDMDGFEASFKLKRAEPRKILKAHPRNVQTNERCAIIV 526          
BLAST of Lamin vs. Planmine SMEST
Match: SMESG000009886.1 (SMESG000009886.1)

HSP 1 Score: 65.0846 bits (157), Expect = 7.009e-11
Identity = 97/449 (21.60%), Postives = 204/449 (45.43%), Query Frame = 3
Query:  189 EYIRNIGDENEKLKVENQKLIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEFXXXXXXXXXXXXXXXXXETIEMQEKINNYRQKLEGYEALKQDYLEISSENNKNKITMKNDMYKCVELENRIATLTEEIDYYKRLND-------RSKTTLETNIQN--AANFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLN----ENLAI---ENMKLKKEIEEMRIDNFDKIHTXXXXXXXXXXXXXXXXXXXXQTENRLKEILVEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGG-----------SSPKRKRICK----INPTNEA--------KFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDNPINLNEWKIEIVSDDFKDVYCF-PNRFIKGKRVLNVWRKDA 1415
            +Y+R++    EKL  + Q +  +   E + IK    +E+  LRK ++D+   +  +  + KN +E+      KL+     L  L+++   ++  ++  R   E Y  L   +  +  +  K    +  ++    ++EN+  TL E++++ +RL +       +    +E  I++   A +++K+  ++  ++ +   +FE  K E E+ +  +  D+ K+N    EN+     E +  + + E+   +   K    + L  RI ++         + E +L ++  E  +L+ DLE  ++E S+  + K A++ E+  +R +LESE  R ++              +S KR+++ +    + P N           + +   +   V+      C+G ++KL+N TD  I +  W ++ ++D+ +  Y F  N  IK K    VW  DA
Sbjct:   97 DYVRSLEIAKEKLTKKIQSISKTETSEIDKIKKLYEDELRSLRKMVDDLAKERANIEIELKNAKEDAIAYRKKLEKRDLDLQNLQRKLENLERDLSKQRMDSERYSTLLVQHDTLEKKCAKLSKELDGEILLRTDIENKNVTLKEQLEFNERLYNEENVKIRQHHIVIEEQIEDRKQAEYESKLADELRAIREETAEEFESYKLEFEQSFTLRLADLKKINQQTNENVTKTRDEMLTWRSKAEQREQELAMKTSENDALKRRIKDLESLLNTERNEFEGQLMKLRGESDNLRNDLEKRLDEFSSLMSTKIALDQEILMYRKLLESEETRCNISVAADGDTSFSALNASSKRRKVGERGEYVLPDNRGNTVSCGRESYKVDLVSRGNVEFSSKPDCSGKFVKLINPTDKDICIGGWMLKYIADNQETSYKFHHNLHIKAKSDCTVWSSDA 545          
The following BLAST results are available for this feature:
BLAST of Lamin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMNA2.820e-921.86lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA2.937e-921.86lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA3.275e-921.86lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA4.247e-921.86lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA2.610e-823.26lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
back to top
BLAST of Lamin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lamin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lamin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lamin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lamin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Lmna9.744e-721.62lamin A [Source:MGI Symbol;Acc:MGI:96794][more]
Lmna1.009e-621.52lamin A [Source:MGI Symbol;Acc:MGI:96794][more]
back to top
BLAST of Lamin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P02545|LMNA_HUMAN2.040e-821.86Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 ... [more]
sp|P11048|LMNA_XENLA1.803e-621.62Lamin-A OS=Xenopus laevis OX=8355 GN=lmna PE=2 SV=... [more]
sp|P13648|LMNA_CHICK3.144e-619.75Lamin-A OS=Gallus gallus OX=9031 GN=LMNA PE=2 SV=1[more]
sp|P48678|LMNA_MOUSE7.056e-621.52Prelamin-A/C OS=Mus musculus OX=10090 GN=Lmna PE=1... [more]
sp|Q3ZD69|LMNA_PIG7.426e-620.65Prelamin-A/C OS=Sus scrofa OX=9823 GN=LMNA PE=3 SV... [more]
back to top
BLAST of Lamin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DLB21.958e-921.29Lamin-B2 isoform 3 OS=Schistosoma japonicum OX=618... [more]
A0A4Z2DL981.983e-921.29Lamin-B2 isoform 2 OS=Schistosoma japonicum OX=618... [more]
A0A4Z2DLD51.992e-921.29Lamin-B2 isoform 1 OS=Schistosoma japonicum OX=618... [more]
A0A0X3NM602.850e-921.41Lamin-B2 OS=Schistocephalus solidus OX=70667 GN=LM... [more]
A0A564ZD222.985e-922.57Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Lamin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lmna3.426e-721.13lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmnl36.505e-621.36lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
lmnl37.529e-621.36lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
lmnl39.471e-621.36lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
back to top
BLAST of Lamin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lamin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lamin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lamin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lamin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000018461.10.000e+099.80SMESG000018461.1[more]
SMESG000047473.11.415e-14652.49SMESG000047473.1[more]
SMESG000047473.15.105e-14652.39SMESG000047473.1[more]
SMESG000009886.17.009e-1121.60SMESG000009886.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026956 ID=SMED30026956|Name=Lamin|organism=Schmidtea mediterranea sexual|type=transcript|length=1646bp
ATTTAGAGGATTTTTAAATACTTTTATTGTTCTCACCCACCAAAAAATTA
CTTTTACCGTTTAGTTGGGTTTTATGAAAAAACAACGTGTAAAGAATGTC
TAACAGAGAGAGAGAAAGTACAAATTCACCGATAAATTCCCCATTTCTAG
ATAAAAAAGATACTAGCGGATCTGCCAGTAAATTAGGAGAATACATTCGT
AATATTGGTGATGAAAATGAAAAATTGAAAGTGGAAAATCAAAAACTAAT
AGATTCATTTAAAAAAGAAACCAATTTGATAAAGGCTACATGTGGGGAGG
AAATAGATTGCCTAAGAAAAGCATTAGAAGATGTCACTTCGTCTAAAATA
AAATTAGCATTTGATAATAAAAACATGCGGGAAGAACAAGAATTTTTAAA
TAATAAATTGAAGAATGAGTCAAGTTCATTAAATATTTTGAAAAAGGAAA
CAATTGAAATGCAAGAAAAAATAAATAACTACAGACAAAAACTAGAAGGT
TATGAAGCTTTAAAACAAGATTACTTAGAAATTTCTAGTGAAAATAATAA
GAATAAAATCACAATGAAAAATGATATGTATAAGTGCGTTGAATTAGAAA
ATCGAATTGCCACCTTAACCGAAGAAATTGATTATTATAAAAGGCTTAAT
GACCGTTCAAAAACTACATTGGAAACAAATATTCAAAATGCAGCCAATTT
TGACGCTAAAGTCAATGCTAAAGTAGAAATACTCAAAATGCAATTGACTG
CCGATTTCGAACACTGCAAAGAAGAACTTGAAAAATTTTACGAAAATAAG
TCCAATGATGTCAATAAACTCAATGAAAACTTGGCGATTGAAAATATGAA
ATTAAAAAAGGAAATCGAAGAAATGCGAATTGATAATTTCGACAAGATTC
ACACAATCAACAATCTTAACAATAGAATTAGCAATATCAATGAATTCAAT
GAAAATAGAAATCGTCAAACTGAAAATCGTCTAAAGGAAATTTTAGTTGA
AAAACATTCACTAAAATGCGACCTGGAATCAACTATCAACGAATTATCAG
CAACGAAGGCGGAAAAAGCAGCTATCGAGAACGAATTATCGGAATTTAGA
TCAATATTAGAGAGTGAAACAAACCGACACAGCATGGGAGGCGGTTCCTC
TCCCAAGCGTAAAAGAATTTGTAAGATAAATCCTACCAATGAAGCTAAAT
TTGATATCTCAGCTTTTACCAATGACAGAGTGAAATTATATTGTGACGAA
CAATGCAATGGGGATTACATCAAATTGATGAATGACACTGACAACCCGAT
AAATCTCAATGAGTGGAAAATTGAAATTGTTTCTGATGACTTTAAGGACG
TTTATTGTTTCCCAAATAGATTTATCAAGGGGAAGAGAGTTCTAAATGTC
TGGAGAAAAGATGCGTTATCCGTTATGGATGATGAGGATAACATTCGCAT
GAATGTGGCATTGCCAGATTTTTCCAAGTCCTTCAGCTGTGAACTGACCA
ATGATATGTATGAATTTGAAGCATCGTTTCAGTTGAAAAGAACTTATCAA
AGGAAGTTTATCAAAGCTCATCAGAGAAATTAAATTGTTTCAGAAAAATG
TTCAATTTTGTTATAAAATAAAATCAATTTAGATATTCAAAAAAAA
back to top

protein sequence of SMED30026956-orf-1

>SMED30026956-orf-1 ID=SMED30026956-orf-1|Name=SMED30026956-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=496bp
MSNRERESTNSPINSPFLDKKDTSGSASKLGEYIRNIGDENEKLKVENQK
LIDSFKKETNLIKATCGEEIDCLRKALEDVTSSKIKLAFDNKNMREEQEF
LNNKLKNESSSLNILKKETIEMQEKINNYRQKLEGYEALKQDYLEISSEN
NKNKITMKNDMYKCVELENRIATLTEEIDYYKRLNDRSKTTLETNIQNAA
NFDAKVNAKVEILKMQLTADFEHCKEELEKFYENKSNDVNKLNENLAIEN
MKLKKEIEEMRIDNFDKIHTINNLNNRISNINEFNENRNRQTENRLKEIL
VEKHSLKCDLESTINELSATKAEKAAIENELSEFRSILESETNRHSMGGG
SSPKRKRICKINPTNEAKFDISAFTNDRVKLYCDEQCNGDYIKLMNDTDN
PINLNEWKIEIVSDDFKDVYCFPNRFIKGKRVLNVWRKDALSVMDDEDNI
RMNVALPDFSKSFSCELTNDMYEFEASFQLKRTYQRKFIKAHQRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036415Lamin_tail_dom_sf
IPR001322Lamin_tail_dom
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
GO:0016491oxidoreductase activity
Vocabulary: cellular component
TermDefinition
GO:0005882intermediate filament
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 225..263
NoneNo IPR availableCOILSCoilCoilcoord: 164..184
NoneNo IPR availableCOILSCoilCoilcoord: 91..146
NoneNo IPR availableCOILSCoilCoilcoord: 34..54
NoneNo IPR availableCOILSCoilCoilcoord: 282..344
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availablePANTHERPTHR45721FAMILY NOT NAMEDcoord: 34..445
NoneNo IPR availablePANTHERPTHR45721:SF11LAMIN DM0-RELATEDcoord: 34..445
IPR036415Lamin tail domain superfamilyGENE3DG3DSA:2.60.40.1260coord: 339..485
e-value: 8.5E-7
score: 30.6
IPR036415Lamin tail domain superfamilySUPERFAMILYSSF74853Lamin A/C globular tail domaincoord: 367..440