Pre-mRNA polyadenylation factor FIP1

Overview
NamePre-mRNA polyadenylation factor FIP1
Smed IDSMED30026953
Length (bp)1648
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-mRNA polyadenylation factor FIP1 (SMED30026953) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-mRNA polyadenylation factor FIP1 (SMED30026953) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-mRNA polyadenylation factor FIP1 (SMED30026953) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-mRNA polyadenylation factor FIP1 (SMED30026953) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026953

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026953SMESG000023126.1 SmedASXL_011565SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026953SMESG000023126.1 SmedASXL_011565SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30026953SMESG000023126.1 dd_Smed_v4_2560_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026953SMESG000023126.1 dd_Smed_v4_2560_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026953SMESG000023126.1 dd_Smed_v4_2560_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026953SMESG000023126.1 dd_Smed_v4_2560_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Human
Match: FIP1L1 (factor interacting with PAPOLA and CPSF1 [Source:HGNC Symbol;Acc:HGNC:19124])

HSP 1 Score: 97.0561 bits (240), Expect = 4.142e-21
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  123 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 185          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Human
Match: FIP1L1 (factor interacting with PAPOLA and CPSF1 [Source:HGNC Symbol;Acc:HGNC:19124])

HSP 1 Score: 97.0561 bits (240), Expect = 1.152e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  123 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 185          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Human
Match: FIP1L1 (factor interacting with PAPOLA and CPSF1 [Source:HGNC Symbol;Acc:HGNC:19124])

HSP 1 Score: 96.6709 bits (239), Expect = 1.652e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  123 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 185          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Human
Match: FIP1L1 (factor interacting with PAPOLA and CPSF1 [Source:HGNC Symbol;Acc:HGNC:19124])

HSP 1 Score: 96.2857 bits (238), Expect = 2.214e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  138 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 200          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Human
Match: AC058822.1 (novel FIP1L1-PDGFRA fusion protein)

HSP 1 Score: 95.5153 bits (236), Expect = 6.347e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  138 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 200          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Celegans
Match: fipp-1 (Factor Interacting with Poly(A) Polymerase [Source:UniProtKB/TrEMBL;Acc:O16293])

HSP 1 Score: 90.1225 bits (222), Expect = 5.984e-19
Identity = 37/61 (60.66%), Postives = 47/61 (77.05%), Query Frame = 1
Query:  421 VDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
            +DLD    IN  P  D DL+++ D  +PW+KPGAD++DYFNYGFTEETW LYCE+QK LR+
Sbjct:  119 LDLDTTATINDKPIYDLDLAQMED--RPWRKPGADITDYFNYGFTEETWNLYCERQKKLRI 177          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Celegans
Match: fipp-1 (Factor Interacting with Poly(A) Polymerase [Source:UniProtKB/TrEMBL;Acc:O16293])

HSP 1 Score: 90.1225 bits (222), Expect = 5.984e-19
Identity = 37/61 (60.66%), Postives = 47/61 (77.05%), Query Frame = 1
Query:  421 VDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
            +DLD    IN  P  D DL+++ D  +PW+KPGAD++DYFNYGFTEETW LYCE+QK LR+
Sbjct:  119 LDLDTTATINDKPIYDLDLAQMED--RPWRKPGADITDYFNYGFTEETWNLYCERQKKLRI 177          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Celegans
Match: fipp-1 (Factor Interacting with Poly(A) Polymerase [Source:UniProtKB/TrEMBL;Acc:O16293])

HSP 1 Score: 90.1225 bits (222), Expect = 6.670e-19
Identity = 37/61 (60.66%), Postives = 47/61 (77.05%), Query Frame = 1
Query:  421 VDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
            +DLD    IN  P  D DL+++ D  +PW+KPGAD++DYFNYGFTEETW LYCE+QK LR+
Sbjct:  119 LDLDTTATINDKPIYDLDLAQMED--RPWRKPGADITDYFNYGFTEETWNLYCERQKKLRI 177          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Celegans
Match: fipp-1 (Factor Interacting with Poly(A) Polymerase [Source:UniProtKB/TrEMBL;Acc:O16293])

HSP 1 Score: 90.1225 bits (222), Expect = 6.670e-19
Identity = 37/61 (60.66%), Postives = 47/61 (77.05%), Query Frame = 1
Query:  421 VDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
            +DLD    IN  P  D DL+++ D  +PW+KPGAD++DYFNYGFTEETW LYCE+QK LR+
Sbjct:  119 LDLDTTATINDKPIYDLDLAQMED--RPWRKPGADITDYFNYGFTEETWNLYCERQKKLRI 177          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Fly
Match: Fip1 (gene:FBgn0037255 transcript:FBtr0078928)

HSP 1 Score: 85.1149 bits (209), Expect = 4.916e-17
Identity = 35/71 (49.30%), Postives = 48/71 (67.61%), Query Frame = 1
Query:  424 DLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALKTLS 636
            D +  G INGV   ++ +  L  E KPW+KPGAD++DYFNYGF EETW  YCE+QK  R+++    L +L+
Sbjct:  205 DFEGAGTINGVAVHEFSIDSL--EEKPWRKPGADITDYFNYGFNEETWRAYCERQKRFRVAESGVGLASLT 273          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Zebrafish
Match: fip1l1b (FIP1 like 1b (S. cerevisiae) [Source:NCBI gene;Acc:450021])

HSP 1 Score: 94.7449 bits (234), Expect = 4.574e-20
Identity = 39/62 (62.90%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
             VDL+ PG+INGVP ++ D+     E KPW+KPGAD+SDYFNYGF E+TW  YCEKQK LR+
Sbjct:  147 GVDLEAPGSINGVPVLEADMESF--EEKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRLRM 206          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Zebrafish
Match: fip1l1a (FIP1 like 1a (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-041014-8])

HSP 1 Score: 74.7146 bits (182), Expect = 7.942e-14
Identity = 44/119 (36.97%), Postives = 68/119 (57.14%), Query Frame = 1
Query:  493 EYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALKTLSGLQNFGYPLSGSHIHLGFNRTSHKNSK------GGLIDVIGSQ-----QSEYKNKH--NDMNMNIVNKIST 810
            E KPW+KPGAD+SDYFNYGF E++W +YC+KQ+ LR+S E  +L              GS   +  +++SH  S+       GLI+VIG       + E + +H  ++ N+ +V++ S 
Sbjct:  117 EEKPWRKPGADLSDYFNYGFNEDSWKVYCDKQRRLRMSLEILSL--------------GSSNKITVHQSSHDLSEYSSRKSSGLINVIGGHSGTISRVEGRRRHGADENNIQVVSEKSA 221          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Xenopus
Match: gigyf1 (GRB10 interacting GYF protein 1 [Source:Xenbase;Acc:XB-GENE-5911708])

HSP 1 Score: 97.8265 bits (242), Expect = 6.676e-21
Identity = 41/62 (66.13%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK LR+
Sbjct:  148 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRLRM 207          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Xenopus
Match: gigyf1 (GRB10 interacting GYF protein 1 [Source:Xenbase;Acc:XB-GENE-5911708])

HSP 1 Score: 97.8265 bits (242), Expect = 7.322e-21
Identity = 41/62 (66.13%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK LR+
Sbjct:  159 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRLRM 218          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Xenopus
Match: gigyf1 (GRB10 interacting GYF protein 1 [Source:Xenbase;Acc:XB-GENE-5911708])

HSP 1 Score: 97.8265 bits (242), Expect = 7.677e-21
Identity = 41/62 (66.13%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK LR+
Sbjct:  148 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRLRM 207          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Xenopus
Match: gigyf1 (GRB10 interacting GYF protein 1 [Source:Xenbase;Acc:XB-GENE-5911708])

HSP 1 Score: 97.4413 bits (241), Expect = 7.755e-21
Identity = 41/62 (66.13%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK LR+
Sbjct:  149 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRLRM 208          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Xenopus
Match: gigyf1 (GRB10 interacting GYF protein 1 [Source:Xenbase;Acc:XB-GENE-5911708])

HSP 1 Score: 97.0561 bits (240), Expect = 1.123e-20
Identity = 41/62 (66.13%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK LR+
Sbjct:  149 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRLRM 208          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Mouse
Match: Fip1l1 (FIP1 like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914149])

HSP 1 Score: 97.0561 bits (240), Expect = 3.938e-21
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  122 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 184          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Mouse
Match: Fip1l1 (FIP1 like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914149])

HSP 1 Score: 96.6709 bits (239), Expect = 1.041e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  137 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 199          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Mouse
Match: Fip1l1 (FIP1 like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914149])

HSP 1 Score: 96.6709 bits (239), Expect = 1.078e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  137 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 199          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Mouse
Match: Fip1l1 (FIP1 like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914149])

HSP 1 Score: 96.6709 bits (239), Expect = 1.152e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  137 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 199          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Mouse
Match: Fip1l1 (FIP1 like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914149])

HSP 1 Score: 96.2857 bits (238), Expect = 1.205e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  137 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 199          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. UniProt/SwissProt
Match: sp|Q5U317|FIP1_RAT (Pre-mRNA 3'-end-processing factor FIP1 OS=Rattus norvegicus OX=10116 GN=Fip1l1 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 7.283e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  137 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 199          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. UniProt/SwissProt
Match: sp|Q5RAA7|FIP1_PONAB (Pre-mRNA 3'-end-processing factor FIP1 OS=Pongo abelii OX=9601 GN=FIP1L1 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 7.522e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  123 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 185          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. UniProt/SwissProt
Match: sp|Q9D824|FIP1_MOUSE (Pre-mRNA 3'-end-processing factor FIP1 OS=Mus musculus OX=10090 GN=Fip1l1 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.059e-20
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  137 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 199          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. UniProt/SwissProt
Match: sp|Q6UN15|FIP1_HUMAN (Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.063e-19
Identity = 41/65 (63.08%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQE 612
             VDLD PG+INGVP ++ DL    D  KPW+KPGAD+SDYFNYGF E+TW  YCEKQK +R+  E
Sbjct:  138 GVDLDAPGSINGVPLLEVDLDSFED--KPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE 200          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. UniProt/SwissProt
Match: sp|Q5XJD3|FIP1_DANRE (Pre-mRNA 3'-end-processing factor FIP1 OS=Danio rerio OX=7955 GN=fip1l1 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.764e-19
Identity = 39/62 (62.90%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
             VDL+ PG+INGVP ++ D+     E KPW+KPGAD+SDYFNYGF E+TW  YCEKQK LR+
Sbjct:  147 GVDLEAPGSINGVPVLEADMESF--EEKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRLRM 206          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. TrEMBL
Match: A0A183KTU8 (Fip1 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS18488 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.592e-27
Identity = 50/79 (63.29%), Postives = 64/79 (81.01%), Query Frame = 1
Query:  397 NYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALKTL 633
            N K+++  V+LD PGNING+PT++Y+LS L DE KPWK+PGAD++DYFNYGFTEETW+ YCEKQK LR    N+ LK +
Sbjct:   18 NQKVARQGVELDDPGNINGIPTVEYNLSTLGDEEKPWKRPGADITDYFNYGFTEETWIQYCEKQKILRQEYANTTLKPV 96          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. TrEMBL
Match: A0A448X1P8 (Fip1 domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS19096 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.306e-26
Identity = 57/116 (49.14%), Postives = 76/116 (65.52%), Query Frame = 1
Query:  397 NYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALKTLSGLQNFGYPLSGSHIHLGFNRTSHKNSKGGLIDVIGS 744
            N K +K  VD+D PGNING+ T++++LS + +E KPWK PGAD++DYFNYGFTEETWL YCEKQK LR    N+ LK + G         G+ + LG    S +  +GGL+  + S
Sbjct:    3 NSKTTKQIVDIDDPGNINGMATVEFNLSGMPEEDKPWKWPGADITDYFNYGFTEETWLQYCEKQKLLRQEYANATLKPIVG--------GGAQVSLGL---SSRGPRGGLMSRLDS 107          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. TrEMBL
Match: G4VJD0 (Fip1-like 1 protein OS=Schistosoma mansoni OX=6183 GN=Smp_070070.2 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.349e-26
Identity = 54/107 (50.47%), Postives = 74/107 (69.16%), Query Frame = 1
Query:  307 VITKTSGANDSSPAKTMFSIKTISNSQMQNNYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALK 627
            VI K S         T +  ++++++      K+++  V+LD PGNING+PT++Y+LS L DE KPWK+PGAD++DYFNYGFTEETW+ YCEKQK LR    N+ LK
Sbjct:   83 VIIKPSSKTGIYKTGTAYQARSVAHTTQHQ--KVARQGVELDDPGNINGIPTVEYNLSTLGDEEKPWKRPGADITDYFNYGFTEETWIQYCEKQKILRQEYANTTLK 187          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. TrEMBL
Match: G4VJD1 (Fip1-like 1 protein OS=Schistosoma mansoni OX=6183 GN=Smp_070070.1 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.469e-26
Identity = 54/107 (50.47%), Postives = 74/107 (69.16%), Query Frame = 1
Query:  307 VITKTSGANDSSPAKTMFSIKTISNSQMQNNYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALK 627
            VI K S         T +  ++++++      K+++  V+LD PGNING+PT++Y+LS L DE KPWK+PGAD++DYFNYGFTEETW+ YCEKQK LR    N+ LK
Sbjct:   84 VIIKPSSKTGIYKTGTAYQARSVAHTTQHQ--KVARQGVELDDPGNINGIPTVEYNLSTLGDEEKPWKRPGADITDYFNYGFTEETWIQYCEKQKILRQEYANTTLK 188          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. TrEMBL
Match: C7TYX4 (Pre-mRNA 3'-end-processing factor FIP1 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.552e-26
Identity = 55/95 (57.89%), Postives = 69/95 (72.63%), Query Frame = 1
Query:  349 KTMFSIKTISNSQMQNNYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALKTL 633
            KT  + +  S S    + K S+  V+LD PGNING+PTI+Y+LS L DE KPWK+PGAD++DYFNYGFTEETW+ YCEKQK LR    N+ LK +
Sbjct:   95 KTGATYQARSVSHTTQHQKASRQGVELDDPGNINGIPTIEYNLSALGDEDKPWKRPGADITDYFNYGFTEETWIQYCEKQKILRQEYANTTLKPV 189          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Cavefish
Match: fip1l1b (FIP1 like 1b (S. cerevisiae) [Source:NCBI gene;Acc:450021])

HSP 1 Score: 97.4413 bits (241), Expect = 6.187e-21
Identity = 41/62 (66.13%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  418 AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
             VDLD PGNINGVP ++ ++     E KPW+KPGAD+SDYFNYGF EETW  YCEKQK LR+
Sbjct:  203 GVDLDAPGNINGVPVLEVEMESF--EEKPWRKPGADLSDYFNYGFNEETWKAYCEKQKRLRM 262          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Cavefish
Match: fip1l1a (FIP1 like 1a (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-041014-8])

HSP 1 Score: 85.1149 bits (209), Expect = 7.733e-18
Identity = 43/93 (46.24%), Postives = 57/93 (61.29%), Query Frame = 1
Query:  358 FSIKTISNSQMQNNYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALKTLS 636
            F+IK  S S       LS   VDLD  G+I+G   ++        E KPW+KPGAD+SDYFNYGF E+TW +YC+KQ+ +R+S E   L + S
Sbjct:  101 FNIKASSRST------LSARGVDLDASGSISGASVLEPGEESF--EEKPWRKPGADLSDYFNYGFGEDTWKVYCDKQRRMRMSLEVMTLGSSS 185          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Yeast
Match: FIP1 (Subunit of cleavage polyadenylation factor (CPF); interacts directly with poly(A) polymerase (Pap1p) to regulate its activity; bridging factor that links Pap1p and the CPF complex via Yth1p [Source:SGD;Acc:S000003853])

HSP 1 Score: 64.3142 bits (155), Expect = 9.306e-12
Identity = 33/77 (42.86%), Postives = 50/77 (64.94%), Query Frame = 1
Query:  418 AVDLDHPGNIN--GVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALKTLSGL 642
            ++DLD  G  +  G+ TID ++ K     KPW++PGA++SDYFNYGF E TW+ Y  +Q+  +L Q+ +  + L GL
Sbjct:  163 SIDLDKEGIFDSVGITTIDPEVLK----EKPWRQPGANLSDYFNYGFNEFTWMEYLHRQE--KLQQDYNPRRILMGL 233          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Nematostella
Match: EDO34677 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNL6])

HSP 1 Score: 83.9593 bits (206), Expect = 2.751e-17
Identity = 37/65 (56.92%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  409 SKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRL 603
            SKT VD++  G +NGV   +YDL     E KPW++PGAD++DYFNYGFTE+TW  YCEKQ+ +R+
Sbjct:  120 SKT-VDVNAEGTVNGVGIYEYDLES--SEEKPWRQPGADITDYFNYGFTEDTWKQYCEKQRRMRM 181          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Medaka
Match: fip1l1b (pre-mRNA 3'-end-processing factor FIP1 [Source:NCBI gene;Acc:101159890])

HSP 1 Score: 104.375 bits (259), Expect = 2.694e-23
Identity = 70/181 (38.67%), Postives = 97/181 (53.59%), Query Frame = 1
Query:  358 FSIKTISNSQMQNNYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSAL-----------------KTLSGL------QNFGYPLSGSHIHLGFNRTSHKNSKGGLIDVIGSQQS-----EYKNKHN--DMNMNIVNKIST 810
             +IK+ S    Q + KL    VDLD PGNINGVP ++ D+     E KPW+KPGAD+SDYFNYGF E+TW  YCEKQK LR+  + S +                 K +S L       +F  P+S     +G  + + K+S  G IDVIG Q +     E + +HN    N+ ++++ ST
Sbjct:  116 LNIKSGSRPYGQVSSKLK--GVDLDAPGNINGVPVLEVDVESF--EEKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRLRMGLDVSTVGSVTSKITVQQGRTGNEKDISSLPVHTSKTDFPSPISLYKSAIG--QVARKSS--GTIDVIGGQTATISRVEGRRRHNLDGNNIQVISEHST 288          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Medaka
Match: fip1l1b (pre-mRNA 3'-end-processing factor FIP1 [Source:NCBI gene;Acc:101159890])

HSP 1 Score: 103.605 bits (257), Expect = 4.932e-23
Identity = 70/181 (38.67%), Postives = 97/181 (53.59%), Query Frame = 1
Query:  358 FSIKTISNSQMQNNYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSAL-----------------KTLSGL------QNFGYPLSGSHIHLGFNRTSHKNSKGGLIDVIGSQQS-----EYKNKHN--DMNMNIVNKIST 810
             +IK+ S    Q + KL    VDLD PGNINGVP ++ D+     E KPW+KPGAD+SDYFNYGF E+TW  YCEKQK LR+  + S +                 K +S L       +F  P+S     +G  + + K+S  G IDVIG Q +     E + +HN    N+ ++++ ST
Sbjct:  145 LNIKSGSRPYGQVSSKLK--GVDLDAPGNINGVPVLEVDVESF--EEKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRLRMGLDVSTVGSVTSKITVQQGRTGNEKDISSLPVHTSKTDFPSPISLYKSAIG--QVARKSS--GTIDVIGGQTATISRVEGRRRHNLDGNNIQVISEHST 317          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Planmine SMEST
Match: SMESG000023126.1 (SMESG000023126.1)

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 489/492 (99.39%), Postives = 492/492 (100.00%), Query Frame = 1
Query:  118 MEVTSTNKDGEEIVAEILPVEESVKEIEPECFDNETEKIPTEENFQINNSIXXXXXXXXXXFAVITKTSGANDSSPAKTMFSIKTISNSQMQNNYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALKTLSGLQNFGYPLSGSHIHLGFNRTSHKNSKGGLIDVIGSQQSEYKNKHNDMNMNIVNKISTIPVQTGNVNVGPNQTSNYMSGLTNQAINSNLLNPIMSAAMAMGILPNAGTVQVLTNQPNAPLDSKMSQYNNMDNGVRNNHNYXXXXXXXXXXXXXXFDRSNSVDSMHSHEDYDRKPYMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHAKHERKRNRTPEEXXXXXXXXXXXXXXGEXXXXXXXXXXXXXXXXXXXXXYENRKDRHQRRHKSPGEDSGKYKTYKDEPDKTETNTDSSNVKREMEYPNAD 1593
            MEVTSTNK+GEEIVAEILPVEESVKEIEPECFDNETEKIPTEENFQINNSIDYEDDDSGDDFAVITKTSGANDSSPAKTMFSIKTISNSQMQNNYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALKTLSGLQNFGYPLSGSHIHLGFNRTSHKNSKGGLIDVIGSQQSEYKNKHNDMNMNIVNKISTIPVQTGNVNVGPNQTSNYMSGLTNQAINSNLLNPIMSAAMAMGILPNAG+VQVLTNQPNAPLDSKMSQYNNMDNGVRNNHNYNSGVGGQGNWNNQNFDRSNSVDSMHSHEDYDRKPYMKSERGSRRSEHEESRRYKSRERRDRSSERRRRSRTRSRERVHAKHERKRNRTPEESRRHRKHSRDRHSSGESDRKHRRHRSGKRHRQSRSRSYENRKDRHQRRHKSPGEDSGKYKTYKDEPDKTETNT+SSNVKREMEYPNAD
Sbjct:    1 MEVTSTNKNGEEIVAEILPVEESVKEIEPECFDNETEKIPTEENFQINNSIDYEDDDSGDDFAVITKTSGANDSSPAKTMFSIKTISNSQMQNNYKLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLYCEKQKTLRLSQENSALKTLSGLQNFGYPLSGSHIHLGFNRTSHKNSKGGLIDVIGSQQSEYKNKHNDMNMNIVNKISTIPVQTGNVNVGPNQTSNYMSGLTNQAINSNLLNPIMSAAMAMGILPNAGSVQVLTNQPNAPLDSKMSQYNNMDNGVRNNHNYNSGVGGQGNWNNQNFDRSNSVDSMHSHEDYDRKPYMKSERGSRRSEHEESRRYKSRERRDRSSERRRRSRTRSRERVHAKHERKRNRTPEESRRHRKHSRDRHSSGESDRKHRRHRSGKRHRQSRSRSYENRKDRHQRRHKSPGEDSGKYKTYKDEPDKTETNTESSNVKREMEYPNAD 492          
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Planmine SMEST
Match: SMESG000037947.1 (SMESG000037947.1)

HSP 1 Score: 72.4034 bits (176), Expect = 7.471e-14
Identity = 30/58 (51.72%), Postives = 42/58 (72.41%), Query Frame = 1
Query:  403 KLSKTAVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETWLLY 576
            K +  A++L+HPGNIN V T+++D+S L    KPW+  GAD+S +FNYGF E TW+ Y
Sbjct:  110 KYTNKALNLNHPGNINNVATVEFDISTLPS--KPWRNNGADISKFFNYGFNESTWIAY 165          
The following BLAST results are available for this feature:
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FIP1L14.142e-2163.08factor interacting with PAPOLA and CPSF1 [Source:H... [more]
FIP1L11.152e-2063.08factor interacting with PAPOLA and CPSF1 [Source:H... [more]
FIP1L11.652e-2063.08factor interacting with PAPOLA and CPSF1 [Source:H... [more]
FIP1L12.214e-2063.08factor interacting with PAPOLA and CPSF1 [Source:H... [more]
AC058822.16.347e-2063.08novel FIP1L1-PDGFRA fusion protein[more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fipp-15.984e-1960.66Factor Interacting with Poly(A) Polymerase [Sourc... [more]
fipp-15.984e-1960.66Factor Interacting with Poly(A) Polymerase [Sourc... [more]
fipp-16.670e-1960.66Factor Interacting with Poly(A) Polymerase [Sourc... [more]
fipp-16.670e-1960.66Factor Interacting with Poly(A) Polymerase [Sourc... [more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Fip14.916e-1749.30gene:FBgn0037255 transcript:FBtr0078928[more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fip1l1b4.574e-2062.90FIP1 like 1b (S. cerevisiae) [Source:NCBI gene;Acc... [more]
fip1l1a7.942e-1436.97FIP1 like 1a (S. cerevisiae) [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gigyf16.676e-2166.13GRB10 interacting GYF protein 1 [Source:Xenbase;Ac... [more]
gigyf17.322e-2166.13GRB10 interacting GYF protein 1 [Source:Xenbase;Ac... [more]
gigyf17.677e-2166.13GRB10 interacting GYF protein 1 [Source:Xenbase;Ac... [more]
gigyf17.755e-2166.13GRB10 interacting GYF protein 1 [Source:Xenbase;Ac... [more]
gigyf11.123e-2066.13GRB10 interacting GYF protein 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fip1l13.938e-2163.08FIP1 like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Fip1l11.041e-2063.08FIP1 like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Fip1l11.078e-2063.08FIP1 like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Fip1l11.152e-2063.08FIP1 like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Fip1l11.205e-2063.08FIP1 like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5U317|FIP1_RAT7.283e-2063.08Pre-mRNA 3'-end-processing factor FIP1 OS=Rattus n... [more]
sp|Q5RAA7|FIP1_PONAB7.522e-2063.08Pre-mRNA 3'-end-processing factor FIP1 OS=Pongo ab... [more]
sp|Q9D824|FIP1_MOUSE8.059e-2063.08Pre-mRNA 3'-end-processing factor FIP1 OS=Mus musc... [more]
sp|Q6UN15|FIP1_HUMAN1.063e-1963.08Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sap... [more]
sp|Q5XJD3|FIP1_DANRE2.764e-1962.90Pre-mRNA 3'-end-processing factor FIP1 OS=Danio re... [more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183KTU87.592e-2763.29Fip1 domain-containing protein OS=Schistosoma cura... [more]
A0A448X1P81.306e-2649.14Fip1 domain-containing protein (Fragment) OS=Proto... [more]
G4VJD03.349e-2650.47Fip1-like 1 protein OS=Schistosoma mansoni OX=6183... [more]
G4VJD13.469e-2650.47Fip1-like 1 protein OS=Schistosoma mansoni OX=6183... [more]
C7TYX43.552e-2657.89Pre-mRNA 3'-end-processing factor FIP1 OS=Schistos... [more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fip1l1b6.187e-2166.13FIP1 like 1b (S. cerevisiae) [Source:NCBI gene;Acc... [more]
fip1l1a7.733e-1846.24FIP1 like 1a (S. cerevisiae) [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
FIP19.306e-1242.86Subunit of cleavage polyadenylation factor (CPF); ... [more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO346772.751e-1756.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fip1l1b2.694e-2338.67pre-mRNA 3'-end-processing factor FIP1 [Source:NCB... [more]
fip1l1b4.932e-2338.67pre-mRNA 3'-end-processing factor FIP1 [Source:NCB... [more]
back to top
BLAST of Pre-mRNA polyadenylation factor FIP1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023126.10.000e+099.39SMESG000023126.1[more]
SMESG000037947.17.471e-1451.72SMESG000037947.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026953 ID=SMED30026953|Name=Pre-mRNA polyadenylation factor FIP1|organism=Schmidtea mediterranea sexual|type=transcript|length=1648bp
CTACTTAAAATTATCATGTCAAGTTATTATTATTTTCAAAATTGTCAAAT
ATTTGTTTGAATTTATGTTTATTGTTGATATTAAAATCGTTATTTATCGC
TTTCATTAATTATATTAATGGAAGTTACAAGTACTAATAAGGATGGTGAG
GAAATTGTAGCTGAAATTTTGCCCGTCGAAGAAAGTGTTAAAGAAATTGA
ACCAGAATGTTTTGATAATGAAACAGAAAAAATTCCAACTGAAGAAAATT
TTCAAATAAACAACAGCATTGACTATGAAGATGACGATTCTGGAGATGAT
TTTGCAGTGATAACTAAAACATCTGGAGCTAATGATTCCAGTCCTGCAAA
AACTATGTTTAGCATCAAAACGATATCAAATTCTCAGATGCAAAATAATT
ACAAATTGTCTAAAACAGCAGTTGATCTCGACCATCCGGGGAATATTAAC
GGAGTACCGACTATTGATTATGATCTTAGTAAATTAGTTGATGAATATAA
ACCTTGGAAAAAACCCGGTGCTGATGTCAGCGATTATTTTAATTATGGTT
TTACCGAAGAAACTTGGTTGCTCTATTGTGAAAAACAGAAAACTTTGAGA
TTATCTCAGGAAAATTCTGCATTGAAAACGCTTAGCGGGCTGCAAAATTT
CGGTTACCCATTAAGCGGCAGTCACATTCACTTGGGGTTCAATAGGACAA
GCCACAAAAACAGCAAAGGCGGTCTGATTGACGTGATTGGCAGTCAGCAG
AGTGAATATAAAAATAAGCACAATGACATGAATATGAACATCGTGAATAA
AATATCGACAATCCCAGTTCAGACGGGAAATGTAAATGTCGGACCGAACC
AAACCAGCAATTATATGTCAGGCCTCACTAATCAGGCAATCAATAGCAAC
CTATTGAATCCGATAATGTCGGCTGCCATGGCAATGGGAATCCTTCCCAA
CGCCGGCACTGTCCAGGTGCTGACGAATCAACCAAACGCTCCCCTCGATT
CCAAAATGTCTCAATACAATAATATGGACAATGGCGTCCGAAACAATCAC
AATTATAATAGCGGAGTCGGTGGTCAAGGCAACTGGAACAATCAGAACTT
CGATCGGTCAAATAGCGTGGATTCGATGCATTCCCACGAGGATTACGACC
GCAAGCCCTACATGAAATCGGAACGAGGCAGCCGTAGAAGTGAGCACGAG
GAATCCCGGCGCTATAAGTCCAGGGAAAGGAGAGACCGCAGTTCCGAACG
GCGTCGCAGATCCAGAACGAGGAGCAGAGAAAGAGTCCATGCAAAGCACG
AAAGAAAACGAAATCGCACCCCCGAGGAGAGCCGTCGGCACAGGAAGCAC
AGTCGCGATCGCCACTCATCCGGCGAGAGTGACCGGAAGCATCGTCGACA
TCGGTCGGGTAAACGGCACCGGCAATCGCGGTCTCGGTCCTATGAGAATC
GCAAAGACCGTCACCAACGTAGACACAAATCTCCGGGAGAAGACTCGGGG
AAATATAAAACCTACAAAGATGAGCCCGACAAAACCGAGACGAATACTGA
CAGTAGTAATGTCAAGCGGGAAATGGAATATCCAAATGCAGATTGAGCGC
CGTGTTTTGTAAATATCTAAATAAAATCTTCGTTTGTTTAAAAAAAAA
back to top

protein sequence of SMED30026953-orf-1

>SMED30026953-orf-1 ID=SMED30026953-orf-1|Name=SMED30026953-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=493bp
MEVTSTNKDGEEIVAEILPVEESVKEIEPECFDNETEKIPTEENFQINNS
IDYEDDDSGDDFAVITKTSGANDSSPAKTMFSIKTISNSQMQNNYKLSKT
AVDLDHPGNINGVPTIDYDLSKLVDEYKPWKKPGADVSDYFNYGFTEETW
LLYCEKQKTLRLSQENSALKTLSGLQNFGYPLSGSHIHLGFNRTSHKNSK
GGLIDVIGSQQSEYKNKHNDMNMNIVNKISTIPVQTGNVNVGPNQTSNYM
SGLTNQAINSNLLNPIMSAAMAMGILPNAGTVQVLTNQPNAPLDSKMSQY
NNMDNGVRNNHNYNSGVGGQGNWNNQNFDRSNSVDSMHSHEDYDRKPYMK
SERGSRRSEHEESRRYKSRERRDRSSERRRRSRTRSRERVHAKHERKRNR
TPEESRRHRKHSRDRHSSGESDRKHRRHRSGKRHRQSRSRSYENRKDRHQ
RRHKSPGEDSGKYKTYKDEPDKTETNTDSSNVKREMEYPNAD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005847mRNA cleavage and polyadenylation specificity factor complex
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006378mRNA polyadenylation
GO:0098789pre-mRNA cleavage required for polyadenylation
GO:0006397mRNA processing
Vocabulary: molecular function
TermDefinition
GO:0030674protein binding, bridging
GO:0003723RNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007854Fip1_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007854Pre-mRNA polyadenylation factor Fip1 domainPFAMPF05182Fip1coord: 117..161
e-value: 1.3E-20
score: 72.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 452..481
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 422..451
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 378..396
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 335..492
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 335..377
NoneNo IPR availablePANTHERPTHR13484FIP1-LIKE 1 PROTEINcoord: 87..227