G_PROTEIN_RECEP_F3_4 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F3_4 domain-containing protein
Smed IDSMED30026937
Length (bp)676
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GRM1 (glutamate metabotropic receptor 1 [Source:HGNC Symbol;Acc:HGNC:4593])

HSP 1 Score: 65.4698 bits (158), Expect = 8.648e-12
Identity = 57/227 (25.11%), Postives = 102/227 (44.93%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP  +   C  I  + + W++  SI+A   +CLG +  L +  ++V  R + ++K+SS    + IL  +FL Y+       + +   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I V   L+++L         +  P+ KE Y  ++CN        P+G+N L ++  TY+
Sbjct:  547 CTACKENEYVQ-DEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVY--LICNTSNLGVVAPLGYNGLLIMSCTYY 770          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GRM1 (glutamate metabotropic receptor 1 [Source:HGNC Symbol;Acc:HGNC:4593])

HSP 1 Score: 65.4698 bits (158), Expect = 9.147e-12
Identity = 57/227 (25.11%), Postives = 102/227 (44.93%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP  +   C  I  + + W++  SI+A   +CLG +  L +  ++V  R + ++K+SS    + IL  +FL Y+       + +   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I V   L+++L         +  P+ KE Y  ++CN        P+G+N L ++  TY+
Sbjct:  547 CTACKENEYVQ-DEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVY--LICNTSNLGVVAPLGYNGLLIMSCTYY 770          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GRM1 (glutamate metabotropic receptor 1 [Source:HGNC Symbol;Acc:HGNC:4593])

HSP 1 Score: 65.4698 bits (158), Expect = 9.147e-12
Identity = 57/227 (25.11%), Postives = 102/227 (44.93%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP  +   C  I  + + W++  SI+A   +CLG +  L +  ++V  R + ++K+SS    + IL  +FL Y+       + +   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I V   L+++L         +  P+ KE Y  ++CN        P+G+N L ++  TY+
Sbjct:  547 CTACKENEYVQ-DEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVY--LICNTSNLGVVAPLGYNGLLIMSCTYY 770          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GRM5 (glutamate metabotropic receptor 5 [Source:HGNC Symbol;Acc:HGNC:4597])

HSP 1 Score: 65.0846 bits (157), Expect = 1.357e-11
Identity = 55/227 (24.23%), Postives = 98/227 (43.17%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP ++   C LI  Q + W     I A + ACLG +  L +  V++  R + ++K+SS    + IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  ++I +   ++++L       +    P+ +E Y  ++CN        P+G+N L +L  T++
Sbjct:  534 CTPCKENEY-VFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVY--LICNTTNLGVVTPLGYNGLLILSCTFY 757          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GRM5 (glutamate metabotropic receptor 5 [Source:HGNC Symbol;Acc:HGNC:4597])

HSP 1 Score: 64.6994 bits (156), Expect = 1.632e-11
Identity = 55/227 (24.23%), Postives = 98/227 (43.17%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP ++   C LI  Q + W     I A + ACLG +  L +  V++  R + ++K+SS    + IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  ++I +   ++++L       +    P+ +E Y  ++CN        P+G+N L +L  T++
Sbjct:  534 CTPCKENEY-VFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVY--LICNTTNLGVVTPLGYNGLLILSCTFY 757          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: mgl-2 (Metabotropic GLutamate receptor family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU50])

HSP 1 Score: 67.3958 bits (163), Expect = 7.613e-13
Identity = 53/230 (23.04%), Postives = 107/230 (46.52%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKG---GSNAKFTSNRFVLSVNLVIIFVDAVLL---LSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C +C+D +  +    +C++C    WP  N   C  I P+++SW S+  ILA +LA  G +T++  + V++   ++ ++K+++   S+ IL  L   Y          S   C I   +      VVY++ L KT RI R+  G K        +F +    + +  +++ V  V++   L   + +  + +  +P    + + + C+ +   F IP  W++  + + T +
Sbjct:  531 CESCLDIQYVNKTTNQCMNCTLGSWPNANRTGCEYIIPEVVSWTSFGHILALVLAVTGIITSMATLAVFLRHNSTPVVKSTTRELSYIILSGLVACYAVSFALLATPSTTSCFITRVIPPIAFAVVYSALLTKTNRIARILAGSKKRILTKKPRFLTTFSQVVITWILVAVQCVIVGVGLMRDWPDATYAKYALP----RKLILECDTETKSFLIPFFWDFFLITLCTLY 756          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: mgl-2 (Metabotropic GLutamate receptor family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU50])

HSP 1 Score: 67.3958 bits (163), Expect = 7.765e-13
Identity = 42/145 (28.97%), Postives = 72/145 (49.66%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIK 437
            C +C+D +  +    +C++C    WP  N   C  I P+++SW S+  ILA +LA  G +T++  + V++   ++ ++K+++   S+ IL  L   Y          S   C I   +      VVY++ L KT RI R+  G K
Sbjct:  531 CESCLDIQYVNKTTNQCMNCTLGSWPNANRTGCEYIIPEVVSWTSFGHILALVLAVTGIITSMATLAVFLRHNSTPVVKSTTRELSYIILSGLVACYAVSFALLATPSTTSCFITRVIPPIAFAVVYSALLTKTNRIARILAGSK 675          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: mgl-2 (Metabotropic GLutamate receptor family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU50])

HSP 1 Score: 67.3958 bits (163), Expect = 8.379e-13
Identity = 53/230 (23.04%), Postives = 107/230 (46.52%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKG---GSNAKFTSNRFVLSVNLVIIFVDAVLL---LSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C +C+D +  +    +C++C    WP  N   C  I P+++SW S+  ILA +LA  G +T++  + V++   ++ ++K+++   S+ IL  L   Y          S   C I   +      VVY++ L KT RI R+  G K        +F +    + +  +++ V  V++   L   + +  + +  +P    + + + C+ +   F IP  W++  + + T +
Sbjct:  531 CESCLDIQYVNKTTNQCMNCTLGSWPNANRTGCEYIIPEVVSWTSFGHILALVLAVTGIITSMATLAVFLRHNSTPVVKSTTRELSYIILSGLVACYAVSFALLATPSTTSCFITRVIPPIAFAVVYSALLTKTNRIARILAGSKKRILTKKPRFLTTFSQVVITWILVAVQCVIVGVGLMRDWPDATYAKYALP----RKLILECDTETKSFLIPFFWDFFLITLCTLY 756          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 48.9062 bits (115), Expect = 1.417e-6
Identity = 41/157 (26.11%), Postives = 72/157 (45.86%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCI---LITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTS 464
            C  C D E   I+   C+ C +  WP ++   C    L   + + W S  S++  +LA  G +  L +I VYV    + ++KAS    S+ +L S+ + Y    +   + S   C I      +    +Y++  +KT RI+R+F+  +     +F S
Sbjct:  497 CSKCEDYEY-LINETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIFS-TRSAQRPRFIS 651          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 48.9062 bits (115), Expect = 1.417e-6
Identity = 41/157 (26.11%), Postives = 72/157 (45.86%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCI---LITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTS 464
            C  C D E   I+   C+ C +  WP ++   C    L   + + W S  S++  +LA  G +  L +I VYV    + ++KAS    S+ +L S+ + Y    +   + S   C I      +    +Y++  +KT RI+R+F+  +     +F S
Sbjct:  497 CSKCEDYEY-LINETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIFS-TRSAQRPRFIS 651          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: grm1a (glutamate receptor, metabotropic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7893])

HSP 1 Score: 70.8626 bits (172), Expect = 8.865e-14
Identity = 59/230 (25.65%), Postives = 102/230 (44.35%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQI-QMPNSKEKY-----VEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE    D   C +C    WP +    C  +  + + W S  SI+A + +C+G +  L + +++     + ++K+SS    + IL  +FL YI         +   C +   L      + Y++ + KT RI R+  G K     +    RF+ +   V+I   A +L+SLQ      L + + P   + Y     V ++CN        P+G+N L ++  TY+
Sbjct:  552 CTTCKDNEYVQ-DEFTCRACDLGWWPDDELAECKPLPLKYLEWGSVESIIAVVFSCVGILVTLFVTFIFFQYSDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPTVISCYLQRILVGLSSAMCYSALVTKTNRIARILAGSKKKICTR--KPRFMSAWAQVVI---AFMLISLQLAVVVTLMVLEPPEPVKSYPSIREVYLICNTSNVGVVAPLGYNGLLIMSCTYY 775          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: grm1a (glutamate receptor, metabotropic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7893])

HSP 1 Score: 70.8626 bits (172), Expect = 9.480e-14
Identity = 59/230 (25.65%), Postives = 102/230 (44.35%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQI-QMPNSKEKY-----VEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE    D   C +C    WP +    C  +  + + W S  SI+A + +C+G +  L + +++     + ++K+SS    + IL  +FL YI         +   C +   L      + Y++ + KT RI R+  G K     +    RF+ +   V+I   A +L+SLQ      L + + P   + Y     V ++CN        P+G+N L ++  TY+
Sbjct:  560 CTTCKDNEYVQ-DEFTCRACDLGWWPDDELAECKPLPLKYLEWGSVESIIAVVFSCVGILVTLFVTFIFFQYSDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPTVISCYLQRILVGLSSAMCYSALVTKTNRIARILAGSKKKICTR--KPRFMSAWAQVVI---AFMLISLQLAVVVTLMVLEPPEPVKSYPSIREVYLICNTSNVGVVAPLGYNGLLIMSCTYY 783          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: grm1b (glutamate receptor, metabotropic 1b [Source:ZFIN;Acc:ZDB-GENE-090821-3])

HSP 1 Score: 68.1662 bits (165), Expect = 7.853e-13
Identity = 61/230 (26.52%), Postives = 101/230 (43.91%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQF-YNNKFLQIQMPNSKEKY-----VEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE    D   C +C    WP E    C  +  + + W+   SI A + +CLG +    +  V++  R + ++K+SS    + IL  +FL YI         S   C +   L      + Y++ + KT RI R+  G K     +    RF+ +   V+I   A +L+S+Q       + ++ P   + Y     V ++CN        P+G+N L +L  TY+
Sbjct:  547 CTPCKDNEYVQ-DEFTCKACELGWWPDEELQVCEPLPLRYLEWSHPESIAAVVFSCLGILVTSFVTLVFILYRDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPSIASCYLQRLLVGLSASMCYSALVTKTNRIARILAGSKKKICTR--KPRFMSAWAQVVI---AFILISMQLTLEVTLIILEPPEPIKSYPSIREVFLICNTSNMGMVAPLGYNGLLILSCTYY 770          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: grm1b (glutamate receptor, metabotropic 1b [Source:ZFIN;Acc:ZDB-GENE-090821-3])

HSP 1 Score: 68.1662 bits (165), Expect = 7.853e-13
Identity = 61/230 (26.52%), Postives = 101/230 (43.91%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQF-YNNKFLQIQMPNSKEKY-----VEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE    D   C +C    WP E    C  +  + + W+   SI A + +CLG +    +  V++  R + ++K+SS    + IL  +FL YI         S   C +   L      + Y++ + KT RI R+  G K     +    RF+ +   V+I   A +L+S+Q       + ++ P   + Y     V ++CN        P+G+N L +L  TY+
Sbjct:  547 CTPCKDNEYVQ-DEFTCKACELGWWPDEELQVCEPLPLRYLEWSHPESIAAVVFSCLGILVTSFVTLVFILYRDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPSIASCYLQRLLVGLSASMCYSALVTKTNRIARILAGSKKKICTR--KPRFMSAWAQVVI---AFILISMQLTLEVTLIILEPPEPIKSYPSIREVFLICNTSNMGMVAPLGYNGLLILSCTYY 770          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: grm2a (glutamate receptor, metabotropic 2a [Source:ZFIN;Acc:ZDB-GENE-030131-8097])

HSP 1 Score: 62.003 bits (149), Expect = 9.459e-11
Identity = 47/214 (21.96%), Postives = 96/214 (44.86%), Query Frame = 3
Query:   36 IDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSN-AKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            +D   C  C   QWP +N   C  +  + I W    +I    +ACLG +  L +I +++    + ++KAS    S+ +L  + L Y    +Y  + S   C +          V Y++ L KT RI R+F G+K G+   +F S    +++   +I    ++++         ++ ++   +   V + CN       + + +N + +++ T++
Sbjct:  334 LDEFTCADCSFGQWPLDNLTGCYDLPEEYIHWEDAWAIGPVSIACLGMLCTLFVIGLFLKNNETPVVKASGRELSYILLLGVLLCYFMTFIYISKPSAVVCTLRRLGLGTSFAVCYSALLTKTNRIARIFNGVKDGAQRPRFISPASQVAICAALISCQLLVVVVWLLVEAPGVRKEVSPERRDVVTLKCNSKDSSMLMSLTYNCVLIILCTFY 547          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GRM1 (glutamate receptor, metabotropic 1 [Source:NCBI gene;Acc:100495945])

HSP 1 Score: 66.2402 bits (160), Expect = 5.097e-12
Identity = 56/227 (24.67%), Postives = 101/227 (44.49%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C +  WP      C  I  + + W+   SI+A   +CLG +  + +  +++  R + ++K+SS    + IL  +FL YI       + +   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I +   L++SL         +  P+ KE Y  ++CN        P+G+N L ++  TY+
Sbjct:  545 CTPCKENEFVQ-DEFTCKACDQGAWPNPGLTGCEPIPVKYLQWSDIESIIAVAFSCLGILITMFVTLIFILYRDTPVVKSSSRELCYIILAGIFLGYICPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSACAQVVIASILISLQLSLVVSLIIMEPPMPILSYPSIKEVY--LICNTSNLGVVAPLGYNGLLIMSCTYY 768          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 63.5438 bits (153), Expect = 3.572e-11
Identity = 52/227 (22.91%), Postives = 101/227 (44.49%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE+   D   C +C    WP ++   C  I  + + W+    I A + +CLG +  + ++ +++  R + ++K+SS    + IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  V+I +   ++++L       +    P+ +E Y  ++CN +      P+G+N L +L  T++
Sbjct:  540 CTPCKDNEI-VFDEYTCKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVY--LICNTNNLGVVTPLGYNGLLILSCTFY 763          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 63.5438 bits (153), Expect = 4.377e-11
Identity = 52/227 (22.91%), Postives = 101/227 (44.49%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE+   D   C +C    WP ++   C  I  + + W+    I A + +CLG +  + ++ +++  R + ++K+SS    + IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  V+I +   ++++L       +    P+ +E Y  ++CN +      P+G+N L +L  T++
Sbjct:  529 CTPCKDNEI-VFDEYTCKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVY--LICNTNNLGVVTPLGYNGLLILSCTFY 752          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 63.5438 bits (153), Expect = 4.508e-11
Identity = 52/227 (22.91%), Postives = 101/227 (44.49%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE+   D   C +C    WP ++   C  I  + + W+    I A + +CLG +  + ++ +++  R + ++K+SS    + IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  V+I +   ++++L       +    P+ +E Y  ++CN +      P+G+N L +L  T++
Sbjct:  540 CTPCKDNEI-VFDEYTCKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVY--LICNTNNLGVVTPLGYNGLLILSCTFY 763          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 63.1586 bits (152), Expect = 4.780e-11
Identity = 52/227 (22.91%), Postives = 101/227 (44.49%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE+   D   C +C    WP ++   C  I  + + W+    I A + +CLG +  + ++ +++  R + ++K+SS    + IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  V+I +   ++++L       +    P+ +E Y  ++CN +      P+G+N L +L  T++
Sbjct:  540 CTPCKDNEI-VFDEYTCKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVY--LICNTNNLGVVTPLGYNGLLILSCTFY 763          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Grm1 (glutamate receptor, metabotropic 1 [Source:MGI Symbol;Acc:MGI:1351338])

HSP 1 Score: 68.1662 bits (165), Expect = 7.545e-13
Identity = 59/227 (25.99%), Postives = 101/227 (44.49%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP      C  IT + + W+   SI+A   +CLG +  L +  ++V  R + ++K+SS    + IL  +FL Y+       + +   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I V   L+++L         +  P+ KE Y  ++CN        PVG+N L ++  TY+
Sbjct:  547 CTACKENEFVQ-DEFTCRACDLGWWPNAELTGCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVY--LICNTSNLGVVAPVGYNGLLIMSCTYY 770          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Grm1 (glutamate receptor, metabotropic 1 [Source:MGI Symbol;Acc:MGI:1351338])

HSP 1 Score: 68.1662 bits (165), Expect = 7.545e-13
Identity = 59/227 (25.99%), Postives = 101/227 (44.49%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP      C  IT + + W+   SI+A   +CLG +  L +  ++V  R + ++K+SS    + IL  +FL Y+       + +   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I V   L+++L         +  P+ KE Y  ++CN        PVG+N L ++  TY+
Sbjct:  547 CTACKENEFVQ-DEFTCRACDLGWWPNAELTGCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVY--LICNTSNLGVVAPVGYNGLLIMSCTYY 770          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Grm1 (glutamate receptor, metabotropic 1 [Source:MGI Symbol;Acc:MGI:1351338])

HSP 1 Score: 66.2402 bits (160), Expect = 3.369e-12
Identity = 59/227 (25.99%), Postives = 101/227 (44.49%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP      C  IT + + W+   SI+A   +CLG +  L +  ++V  R + ++K+SS    + IL  +FL Y+       + +   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I V   L+++L         +  P+ KE Y  ++CN        PVG+N L ++  TY+
Sbjct:  547 CTACKENEFVQ-DEFTCRACDLGWWPNAELTGCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVY--LICNTSNLGVVAPVGYNGLLIMSCTYY 770          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Grm5 (glutamate receptor, metabotropic 5 [Source:MGI Symbol;Acc:MGI:1351342])

HSP 1 Score: 65.0846 bits (157), Expect = 1.013e-11
Identity = 54/227 (23.79%), Postives = 98/227 (43.17%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP ++   C LI  Q + W     I A + ACLG +  L +  +++  R + ++K+SS    + IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  ++I +   ++++L       +    P+ +E Y  ++CN        P+G+N L +L  T++
Sbjct:  533 CTPCKENEY-VFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVY--LICNTTNLGVVTPLGYNGLLILSCTFY 756          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Grm2 (glutamate receptor, metabotropic 2 [Source:MGI Symbol;Acc:MGI:1351339])

HSP 1 Score: 64.3142 bits (155), Expect = 1.118e-11
Identity = 47/194 (24.23%), Postives = 86/194 (44.33%), Query Frame = 3
Query:   36 IDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIK-GGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCN-RD 611
            +D   C  C    WP  +   C  +  + I W    ++    +ACLGA+  L ++ V+V   A+ ++KAS     + +LG +FL Y    ++  + S   C +          V Y++ L KT RI R+F G + G    +F S    +++ L +I    +++ +        +  +    + + V + CN RD
Sbjct:   62 LDEFTCADCGLGYWPNASLTGCFELPQEYIRWGDAWAVGPVTIACLGALATLFVLGVFVRHNATPVVKASGRELCYILLGGVFLCYCMTFIFIAKPSTAVCTLRRLGLGTAFSVCYSALLTKTNRIARIFGGAREGAQRPRFISPASQVAICLALISGQLLIVAAWLVVEAPGIGKETAPERREVVTLRCNHRD 255          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|P97772|GRM1_MOUSE (Metabotropic glutamate receptor 1 OS=Mus musculus OX=10090 GN=Grm1 PE=1 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 2.356e-11
Identity = 59/227 (25.99%), Postives = 101/227 (44.49%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP      C  IT + + W+   SI+A   +CLG +  L +  ++V  R + ++K+SS    + IL  +FL Y+       + +   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I V   L+++L         +  P+ KE Y  ++CN        PVG+N L ++  TY+
Sbjct:  547 CTACKENEFVQ-DEFTCRACDLGWWPNAELTGCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVY--LICNTSNLGVVAPVGYNGLLIMSCTYY 770          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|P41594|GRM5_HUMAN (Metabotropic glutamate receptor 5 OS=Homo sapiens OX=9606 GN=GRM5 PE=1 SV=2)

HSP 1 Score: 65.0846 bits (157), Expect = 6.517e-11
Identity = 55/227 (24.23%), Postives = 98/227 (43.17%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP ++   C LI  Q + W     I A + ACLG +  L +  V++  R + ++K+SS    + IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  ++I +   ++++L       +    P+ +E Y  ++CN        P+G+N L +L  T++
Sbjct:  534 CTPCKENEY-VFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVY--LICNTTNLGVVTPLGYNGLLILSCTFY 757          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3UVX5|GRM5_MOUSE (Metabotropic glutamate receptor 5 OS=Mus musculus OX=10090 GN=Grm5 PE=1 SV=2)

HSP 1 Score: 65.0846 bits (157), Expect = 7.085e-11
Identity = 54/227 (23.79%), Postives = 98/227 (43.17%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP ++   C LI  Q + W     I A + ACLG +  L +  +++  R + ++K+SS    + IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  ++I +   ++++L       +    P+ +E Y  ++CN        P+G+N L +L  T++
Sbjct:  533 CTPCKENEY-VFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVY--LICNTTNLGVVTPLGYNGLLILSCTFY 756          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|P31424|GRM5_RAT (Metabotropic glutamate receptor 5 OS=Rattus norvegicus OX=10116 GN=Grm5 PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 7.287e-11
Identity = 54/227 (23.79%), Postives = 98/227 (43.17%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP ++   C LI  Q + W     I A + ACLG +  L +  +++  R + ++K+SS    + IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  ++I +   ++++L       +    P+ +E Y  ++CN        P+G+N L +L  T++
Sbjct:  533 CTPCKENEY-VFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVY--LICNTTNLGVVTPLGYNGLLILSCTFY 756          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|P23385|GRM1_RAT (Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 8.957e-11
Identity = 58/227 (25.55%), Postives = 100/227 (44.05%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP      C  I  + + W+   SI+A   +CLG +  L +  ++V  R + ++K+SS    + IL  +FL Y+       + +   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I V   L+++L         +  P+ KE Y  ++CN        PVG+N L ++  TY+
Sbjct:  547 CTACKENEFVQ-DEFTCRACDLGWWPNAELTGCEPIPVRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVY--LICNTSNLGVVAPVGYNGLLIMSCTYY 770          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: A0A2R2MRZ1 (metabotropic glutamate receptor 5 OS=Lingula unguis OX=7574 GN=LOC106155347 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.429e-15
Identity = 58/203 (28.57%), Postives = 100/203 (49.26%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENT-DTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLF-TGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCN 605
            CR+C DNE+   +   C++CP FQWP+++T  +C  I  + + W   ++I   ++A LG +  +     Y+     RL+KASS   SF +L  + L Y++ +++     +Y C             +Y     +T RIYR+F TG K     KF S R  +++  + I V  ++ +          ++ MP   E++VE+ CN
Sbjct:  333 CRHCRDNEITINNASTCLACPIFQWPEQSTFTSCEPIAAEHVRWGDPLAIGIVIVALLGLLATVATSVFYIRFNKERLIKASSRELSFLMLIGILLGYVTAIIFLATPKDYLCYCEYLGFSLSFSWLYAPLATRTNRIYRIFNTGKKSTIRPKFISPRSQVTIATIFITVQVIISIITAIVVPPTAELSMPVKTERFVELYCN 535          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: A0A1S3HQU1 (metabotropic glutamate receptor 3 OS=Lingula unguis OX=7574 GN=LOC106156989 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.030e-12
Identity = 51/225 (22.67%), Postives = 109/225 (48.44%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLF-TGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            CR C +NE    ++  C  CPE  WP E+  +C  + P+ + W   ++I     + +G +    I+  ++    ++L+KA S   ++ IL  +F++Y++ + +  +  ++ C +  F        +Y     +T RIYR+F +G K        S R  + +  ++I ++ ++ +     N   ++ +MP   EK+VE++C   I      + +N L + + +++
Sbjct:  737 CRKCRNNEYLVSNQTSCKECPELMWPVESLTSCESVQPEHMRWGDSLAITILTFSIIGIILAAFILAFFIRHNNAKLIKACSRELAYLILTGVFVSYLTAIFFLAKPEDHFCYVEHFGFSLSFAWIYAPLFTRTNRIYRIFASGKKTKKRPPLVSPRSQVIIASLLITIEVIISIITAAVNPPGIEQRMPVKTEKFVELLCKLPIQGIVASLAYNILLVAMCSFY 961          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: V4AGY8 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_145056 PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.161e-12
Identity = 60/229 (26.20%), Postives = 112/229 (48.91%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTD--TCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLF-TGIKGGSNAKFTSNRFVLSVNLVIIF--VDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C++C  NE+ + +   C SCP F+WP+  TD  +C  I P  I W+   +I+    + +G +  + I+  Y+    S  +KASS   S+F+L  + + Y+++     +   + C +  F        +Y   L +T RIYR+F +G K     +F  ++  + + ++ +F  V   ++  L +       +Q+P   +KYVE+ CN  +      + +N L +L  TY+
Sbjct:  521 CKSCRSNEMVTNNGTSCESCPMFEWPELETDLKSCSPIPPVTIDWSEPFAIMLVTFSFIGIVLAISILVFYIKYNESSFIKASSRDLSYFMLTGVCIGYLTVFGMVTKPETWSCKMVFFCFCISFTCIYGPLLTRTIRIYRIFESGKKSNKRPRFIGSKTQIVIAMLFVFGQVAISIVFVLWYSPEATRTMQVPT--QKYVELSCNMPLAGLISFLSYNILLVLTCTYF 747          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: A0A1S3JY51 (metabotropic glutamate receptor OS=Lingula unguis OX=7574 GN=LOC106176936 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.119e-12
Identity = 51/225 (22.67%), Postives = 109/225 (48.44%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLF-TGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            CR C +NE    ++  C  CPE  WP E+  +C  + P+ + W   ++I     + +G +    I+  ++    ++L+KA S   ++ IL  +F++Y++ + +  +  ++ C +  F        +Y     +T RIYR+F +G K        S R  + +  ++I ++ ++ +     N   ++ +MP   EK+VE++C   I      + +N L + + +++
Sbjct:  332 CRKCRNNEYLVSNQTSCKECPELMWPVESLTSCESVQPEHMRWGDSLAITILTFSIIGIILAAFILAFFIRHNNAKLIKACSRELAYLILTGVFVSYLTAIFFLAKPEDHFCYVEHFGFSLSFAWIYAPLFTRTNRIYRIFASGKKTKKRPPLVSPRSQVIIASLLITIEVIISIITAAVNPPGIEQRMPVKTEKFVELLCKLPIQGIVASLAYNILLVAMCSFY 556          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: A0A3B3TDJ6 (Glutamate receptor, metabotropic 1b OS=Paramormyrops kingsleyae OX=1676925 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 5.663e-12
Identity = 61/230 (26.52%), Postives = 107/230 (46.52%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQF-YNNKFLQIQMPNSKEKY-----VEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C +C DNE    D   C +C    WP E  + C  I  + + W++  SI+A + +CLG +  + + +++V  R + ++K+SS    + IL  +FL YI         +   C +   L      + Y++ + KT RI R+  G K     +    RF+ +   V+I   A +L+S+Q       L ++ P   + Y     V ++CN        P+G+N L ++  TY+
Sbjct:  546 CTSCKDNEYVQ-DEFTCKACELGWWPDEELEGCQPIPLRYLQWSNAESIVAVVFSCLGILVTMFVTFIFVLYRDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPTVASCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTR--KPRFMSAWAQVVI---AFVLISIQLTLEVTLLILEPPEPIKSYPSIREVFLICNTSNMGMVAPLGYNGLLIMSCTYY 769          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: grm1a (glutamate receptor, metabotropic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7893])

HSP 1 Score: 73.9442 bits (180), Expect = 7.332e-15
Identity = 59/230 (25.65%), Postives = 105/230 (45.65%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQF-YNNKFLQIQMPNSKEKY-----VEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE    D   C +C    WP +    C  +  + + W+S  SI+A + +CLG +  L + +V++  R + ++K+SS    + IL  +F+ YI         +   C +   L      + Y++ + KT RI R+  G K     +    RF+ +   V+I   A +L+S+Q       + ++ P   + Y     V ++CN        P+G+N L ++  TY+
Sbjct:  541 CTTCKDNEYVQ-DEFTCKACDLGWWPDDELAGCQPLPLKYLEWSSVESIVAVVFSCLGILVTLFVTFVFIQYRDTPVVKSSSRELCYIILAGIFMGYICPFTLIARPTVISCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTR--KPRFMSAWAQVVI---AFILISMQLTLEVTLIVLEPPEPIKSYPSIREVYLICNTSNVGMIAPLGYNGLLIMSCTYY 764          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: grm5a (metabotropic glutamate receptor 5-like [Source:NCBI gene;Acc:103040533])

HSP 1 Score: 67.0106 bits (162), Expect = 1.433e-12
Identity = 55/227 (24.23%), Postives = 98/227 (43.17%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE    D   C +C    WP ++   C  I  Q + W     I A + ACLG +  + ++ ++V    + ++K+SS    F IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  ++IF+   ++++L       +    P+ +E  V ++CN        P+G+N L +L  T++
Sbjct:  543 CTPCKDNEY-VFDEYTCRACELGSWPTDDLTGCEPIPVQYLLWGDPEPIAAVVFACLGLLATIFVMLIFVRFHDTPVVKSSSRELCFIILAGICLGYLCTFCLIAKPHVVYCYLQRLGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILIFLQLAIIVALFIMEPPQVIYDYPSIRE--VHLICNTTTLGVVAPLGYNGLLILSCTFY 766          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: grm5a (metabotropic glutamate receptor 5-like [Source:NCBI gene;Acc:103040533])

HSP 1 Score: 66.6254 bits (161), Expect = 2.040e-12
Identity = 55/227 (24.23%), Postives = 98/227 (43.17%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE    D   C +C    WP ++   C  I  Q + W     I A + ACLG +  + ++ ++V    + ++K+SS    F IL  + L Y+       +     C +          + Y++ + KT RI R+  G K        +F S    L +  ++IF+   ++++L       +    P+ +E  V ++CN        P+G+N L +L  T++
Sbjct:  526 CTPCKDNEY-VFDEYTCRACELGSWPTDDLTGCEPIPVQYLLWGDPEPIAAVVFACLGLLATIFVMLIFVRFHDTPVVKSSSRELCFIILAGICLGYLCTFCLIAKPHVVYCYLQRLGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILIFLQLAIIVALFIMEPPQVIYDYPSIRE--VHLICNTTTLGVVAPLGYNGLLILSCTFY 749          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: grm1b (glutamate receptor, metabotropic 1b [Source:ZFIN;Acc:ZDB-GENE-090821-3])

HSP 1 Score: 63.5438 bits (153), Expect = 2.287e-11
Identity = 59/227 (25.99%), Postives = 97/227 (42.73%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE    D   C +C    WP E    C  I  + + W    SI A + +CLG +    + +V++  R + ++K+SS    + IL  +FL YI         S   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I V   L ++L            P+ +E +  ++CN        P+G+N L +L  TY+
Sbjct:  550 CTACKDNEYVQ-DEFTCKACELGWWPDEELHGCEPIPLRYLEWGHPESIAAVVFSCLGILVTSFVTFVFILYRDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPSLASCYLQRLLVGLSASMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVVIAFILISVQLTLEITLIILEPPEPIKSYPSIREVF--LICNTSNMGMVAPLGYNGLLILSCTYY 773          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: grm6b (metabotropic glutamate receptor 6-like [Source:NCBI gene;Acc:111195348])

HSP 1 Score: 60.4622 bits (145), Expect = 2.607e-10
Identity = 51/167 (30.54%), Postives = 79/167 (47.31%), Query Frame = 3
Query:   36 IDRLRCISCPEFQWPQENTDTCILITPQI-ISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLF-TGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSL 530
            +D   C +CP    P  N   C   TP I + W+S  +I+   LA LG +   G+I  +V    + +++AS    S+ +L  +FL Y+   L   E     C     L    + + Y++ L KT RIYR+F  G K  +  KF S    L +  ++I   +V LLS+
Sbjct:  558 LDEFNCDTCPFDMRPTPNRTGC-RPTPIIKLEWSSPWAIIPVFLAVLGILATTGVIVTFVRFNDTPIVRASGRELSYVLLTGIFLIYLITFLMIAEPGAVVCAFRRLLLGLGMCISYSAMLTKTNRIYRIFEQGKKSVTPPKFISPTSQLIITFILI---SVQLLSI 720          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Match: casr (calcium-sensing receptor [Source:ZFIN;Acc:ZDB-GENE-050119-8])

HSP 1 Score: 59.3066 bits (142), Expect = 1.356e-10
Identity = 38/142 (26.76%), Postives = 69/142 (48.59%), Query Frame = 3
Query:    3 CRNCIDNEVPS-IDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLF 425
            C +C + E  +  D   C+ CPE  WP  N   C+    + +SW     +    + CLGA+  L +  V+V  R + ++KA+++  S+ +  SLF  ++S L + G+ S   C +          +  +  L+KT R+ ++F
Sbjct:  543 CISCAEGEYNNESDANSCLGCPEDSWPSANHTMCVPKREEYLSWREPFGVCLAFVGCLGAVLTLSVAAVFVKHRGTAIVKATNVELSYLLFFSLFCCFLSSLFFIGKPSTVACKLRQPTFGISFVLCVSCVLVKTHRVLQVF 684          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007590.1 (pep scaffold:Pmarinus_7.0:GL478498:6932:63706:-1 gene:ENSPMAG00000006812.1 transcript:ENSPMAT00000007590.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.485e-8
Identity = 41/143 (28.67%), Postives = 62/143 (43.36%), Query Frame = 3
Query:    3 CRNC--IDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLF 425
            C NC   +     +D   C  CP    P  N   C  I    + W+S  +++   LA LG +T   +I  +V    + +++AS    S+ +L  +FL Y +  L   E S   C          + V Y + L KT RIYR+F
Sbjct:  540 CWNCERCEGYYFQLDEFNCHLCPYNMRPNVNRTGCDAIPIVKLEWHSPFAVVPVFLAILGLLTTAFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYATTFLMIAEPSLAVCSFRRIFLGLGMCVSYAALLTKTNRIYRIF 682          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Match: grm3 (glutamate receptor, metabotropic 3 [Source:ZFIN;Acc:ZDB-GENE-061009-13])

HSP 1 Score: 50.8322 bits (120), Expect = 8.185e-8
Identity = 37/184 (20.11%), Postives = 82/184 (44.57%), Query Frame = 3
Query:   39 DRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIK--GGSNAKFTSNRFVLSVNLVIIFVD-AVLLLSLQFYNNKFLQIQMPNSKE 581
            D   C+ C   +WP  +   C  +  + I W    +++   ++C+G +  + ++  ++    + ++KAS     + +L  + + Y +   +  + +   C +   +      V Y++ L KT RI R+F   +  G S  KF S    + + L +I +  +V+ + L   N    +  +P+ +E
Sbjct:  536 DEFTCMDCGPGRWPSADLRDCYDLPEEYIKWEDAWALVPIAISCIGLICTVTVLITFIVHGNTPIVKASGRELCYALLAGVSMCYSTTFAFVAKATVLVCALRRLVLAASFVVCYSALLTKTNRISRMFNSAREGGSSRPKFVSPLAQMVICLTLILIQLSVVAIWLIVENPGLRRFTIPDKRE 719          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO42746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0J8])

HSP 1 Score: 48.521 bits (114), Expect = 8.379e-7
Identity = 42/162 (25.93%), Postives = 76/162 (46.91%), Query Frame = 3
Query:   30 PSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAV 515
            PS  +  C  CPE     E   +C+ IT + + W S   I+  + + LG M ++ +I +++  R + ++KAS+   SF  L  + LT+       G  S  +C +  F+      +  +  LLKT R+ R+F      + A+ TS   +L+  +  +   A+
Sbjct:  517 PSRGQDGCKGCPEGYEANEMHTSCVQITEEYLRWGSTSGIIVLVFSSLGTMLSITVITIFIKHRETAVVKASNRELSFVHLACILLTFTFPFSLVGRPSRVQCGVWPFVFAVVFCLGTSIMLLKTDRLLRVFR-----AKARLTSRSNLLTNKMQFLTASAL 673          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: grm1a (glutamate metabotropic receptor 1 [Source:NCBI gene;Acc:101165118])

HSP 1 Score: 68.5514 bits (166), Expect = 4.368e-13
Identity = 55/227 (24.23%), Postives = 98/227 (43.17%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C DNE    D   C +C    WP E  + C  +  + + W    S++A   +C+G +    + +V++  R + ++K+SS    + IL  +FL YI         +   C +   L      + Y++ + KT RI R+  G K        +F S    + +  ++I V   L ++L            P+ +E Y  ++CN        P+G+N L ++  TY+
Sbjct:  553 CTTCKDNEYVQ-DEFTCKACELGWWPDEELEDCQPLPLKYVDWADVESVVAVAFSCVGILITSFVTFVFIQYRDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPTVASCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVVIAFMLISVQLTLEITLIILEPPEPIKSYPSIREVY--LICNTSNVGMVAPLGYNGLLIMSCTYY 776          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: grm3 (metabotropic glutamate receptor 3 [Source:NCBI gene;Acc:101166047])

HSP 1 Score: 62.3882 bits (150), Expect = 4.826e-11
Identity = 46/166 (27.71%), Postives = 76/166 (45.78%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVII 500
            C  C  +E  + D   C  C   QWP ++  +C  +    I W    +I    +AC+G M    +I+V++    + L+KAS     + +L  +F++Y    L+  + S   C +          V Y++ L KT RI R+F G+K G+ A     RF+   + V I
Sbjct:  531 CTACEAHEYLA-DEFTCAPCAPGQWPTDDLTSCYDLPEDYIMWEDAWAIGPITIACVGFMCTGLVIWVFIRHNNTPLVKASGRELCYILLSGVFMSYAMTFLFLAKPSPAICALRRLGLGTSFAVCYSALLTKTNRIARIFNGVKEGAGA--VRPRFISPFSQVFI 693          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: stxbp5b (syntaxin-binding protein 5 [Source:NCBI gene;Acc:101172714])

HSP 1 Score: 61.6178 bits (148), Expect = 9.069e-11
Identity = 55/227 (24.23%), Postives = 100/227 (44.05%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGG---SNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C +NE    D   C +C    WP E  + C  I    + W++  SI+  + +CLG +    + +++V  R + ++K+SS    + IL  +FL Y+         +   C +   L  +   + Y++ + KT RI R+  G K        +F S    + +  V+I V   L ++L            P+ +E +  ++CN        P+G+N L ++  TY+
Sbjct:  552 CTACKENEYVQ-DEFTCKACELGWWPDEELEGCQPIPLHYLEWSNPESIIQVVFSCLGILVTSFVAFIFVLYRDTPVVKSSSRELCYIILAGIFLGYLCPFTLLARPTVASCYLQRLLVGFSAAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVVIASVLISVQLTLEVTLIIMEPPEPIKSYPSIREVF--LICNTSNLGVVAPLGYNGLLIMSCTYY 775          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: grm2a (glutamate metabotropic receptor 2 [Source:NCBI gene;Acc:101169193])

HSP 1 Score: 60.077 bits (144), Expect = 3.301e-10
Identity = 47/214 (21.96%), Postives = 95/214 (44.39%), Query Frame = 3
Query:   36 IDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSN-AKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            +D   C  C   QWP  N   C  +  + I W    +I    ++CLG M+ L +I +++    + ++KAS    S+ +L  + + Y    +Y  + S   C +          V Y++ L KT RI R+F G+K G+   +F S    +++   +I    V+++         ++ ++   +   V + CN       + + +N + +++ T +
Sbjct:  554 LDEFTCADCSFGQWPLANLTGCYDLPEEYIRWEDAWAIGPVTISCLGMMSTLFVIGLFLKHNETPVVKASGRELSYILLLGVLMCYCMTFIYIAKPSTAVCTLRRLGLGTSFAVCYSALLTKTNRIARIFGGVKDGAQRPRFISPASQVAICGALISCQLVVVVVWLLLEAPGVRKEVSPERRDVVTLKCNNRDSSMLLSLTYNCILIILCTVY 767          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: grm2a (glutamate metabotropic receptor 2 [Source:NCBI gene;Acc:101169193])

HSP 1 Score: 59.6918 bits (143), Expect = 3.916e-10
Identity = 47/214 (21.96%), Postives = 95/214 (44.39%), Query Frame = 3
Query:   36 IDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSN-AKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            +D   C  C   QWP  N   C  +  + I W    +I    ++CLG M+ L +I +++    + ++KAS    S+ +L  + + Y    +Y  + S   C +          V Y++ L KT RI R+F G+K G+   +F S    +++   +I    V+++         ++ ++   +   V + CN       + + +N + +++ T +
Sbjct:  523 LDEFTCADCSFGQWPLANLTGCYDLPEEYIRWEDAWAIGPVTISCLGMMSTLFVIGLFLKHNETPVVKASGRELSYILLLGVLMCYCMTFIYIAKPSTAVCTLRRLGLGTSFAVCYSALLTKTNRIARIFGGVKDGAQRPRFISPASQVAICGALISCQLVVVVVWLLLEAPGVRKEVSPERRDVVTLKCNNRDSSMLLSLTYNCILIILCTVY 736          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000064459.1 (SMESG000064459.1)

HSP 1 Score: 429.098 bits (1102), Expect = 1.343e-146
Identity = 224/224 (100.00%), Postives = 224/224 (100.00%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVAKRASRLLKASSLRSSFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW
Sbjct:  515 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVAKRASRLLKASSLRSSFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 738          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000033752.1 (SMESG000033752.1)

HSP 1 Score: 64.3142 bits (155), Expect = 9.584e-12
Identity = 58/230 (25.22%), Postives = 106/230 (46.09%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKF------LQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C  NE   ++  +C  C E +WP +N   C L+T   +  + W++I+  +L+ LG  T   ++ V+   + + +++AS    SF IL    + Y+   ++  + + Y C I   L      V+Y S L KT RI R+F       +A+ T+ R         + + AV L+S+Q  +N          I+    K ++  + C  +   F + + +N L + + TY+
Sbjct:  558 CSLCKSNEF-VVNMTKCEMCAEGEWPYQNRTGCYLLTVHYMKLSGWLAIIPMILSFLGTATTTSVMGVFYYYKNTPIVRASGRELSFLILSGCLVCYLVSFIFLLKPTPYSCAIQRILLGLGFAVMYASLLTKTNRIARIF------ESAQKTAKRPPCISPKSQLMICAV-LISVQLLSNAIWLFFSPPGIRYDRKKPEFPVLKCKIETKTFLVSLVYNMLLISVCTYY 779          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000033752.1 (SMESG000033752.1)

HSP 1 Score: 63.929 bits (154), Expect = 1.086e-11
Identity = 58/230 (25.22%), Postives = 106/230 (46.09%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKF------LQIQMPNSKEKYVEMVCNRDIPRFWIPVGWNWLKLLISTYW 674
            C  C  NE   ++  +C  C E +WP +N   C L+T   +  + W++I+  +L+ LG  T   ++ V+   + + +++AS    SF IL    + Y+   ++  + + Y C I   L      V+Y S L KT RI R+F       +A+ T+ R         + + AV L+S+Q  +N          I+    K ++  + C  +   F + + +N L + + TY+
Sbjct:  573 CSLCKSNEF-VVNMTKCEMCAEGEWPYQNRTGCYLLTVHYMKLSGWLAIIPMILSFLGTATTTSVMGVFYYYKNTPIVRASGRELSFLILSGCLVCYLVSFIFLLKPTPYSCAIQRILLGLGFAVMYASLLTKTNRIARIF------ESAQKTAKRPPCISPKSQLMICAV-LISVQLLSNAIWLFFSPPGIRYDRKKPEFPVLKCKIETKTFLVSLVYNMLLISVCTYY 794          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000024379.1 (SMESG000024379.1)

HSP 1 Score: 48.521 bits (114), Expect = 1.788e-6
Identity = 35/141 (24.82%), Postives = 68/141 (48.23%), Query Frame = 3
Query:    3 CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLF 425
            C  C   ++ +  +  C+ C   Q P +N   CI IT   +  NS I++   L   +G      ++ +++    S +++ASS   SF +L  + + ++  ++   + +++ C I  F       V Y++ L+KT RI R+F
Sbjct:   85 CIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNRIERIF 225          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000064049.1 (SMESG000064049.1)

HSP 1 Score: 48.1358 bits (113), Expect = 2.718e-6
Identity = 43/224 (19.20%), Postives = 101/224 (45.09%), Query Frame = 3
Query:    3 CRNCIDNEV--PSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISILACLLACLGAMTNLGIIYVYVXXXXXXXXXXXXXXXXFFILGSLFLTYISMLLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNAKFTSNRFVLSVNLVIIF---VDAVLLLSLQFYNNKFLQIQMPNSKEKY-----VEMVCNRDIPRFWIPVGWN 644
            C++C +NE+   +     C SC +   P  +   C  I    + W+    I+A + + +G +  + I+ ++     + ++K+ +    + IL  + L+Y++      + + + C++   +      +++ S + KT RI R+ + I      +        +  +VI+F   V  ++++S+  ++N       P SK  Y     V ++CN +    +I +G++
Sbjct:  368 CKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDASVIVAIIFSIVGLIITVIIVGIFAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNRICRILS-ISKKKIIRRKGRFLTTTAQIVIVFLLNVVEIIIISVMIWHN------FPKSKSDYSVAATVRLICNTESQDLFISMGFD 584          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRM18.648e-1225.11glutamate metabotropic receptor 1 [Source:HGNC Sym... [more]
GRM19.147e-1225.11glutamate metabotropic receptor 1 [Source:HGNC Sym... [more]
GRM19.147e-1225.11glutamate metabotropic receptor 1 [Source:HGNC Sym... [more]
GRM51.357e-1124.23glutamate metabotropic receptor 5 [Source:HGNC Sym... [more]
GRM51.632e-1124.23glutamate metabotropic receptor 5 [Source:HGNC Sym... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgl-27.613e-1323.04Metabotropic GLutamate receptor family [Source:Un... [more]
mgl-27.765e-1328.97Metabotropic GLutamate receptor family [Source:Un... [more]
mgl-28.379e-1323.04Metabotropic GLutamate receptor family [Source:Un... [more]
mgl-11.417e-626.11Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-11.417e-626.11Probable metabotropic glutamate receptor mgl-1 [S... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm1a8.865e-1425.65glutamate receptor, metabotropic 1a [Source:ZFIN;A... [more]
grm1a9.480e-1425.65glutamate receptor, metabotropic 1a [Source:ZFIN;A... [more]
grm1b7.853e-1326.52glutamate receptor, metabotropic 1b [Source:ZFIN;A... [more]
grm1b7.853e-1326.52glutamate receptor, metabotropic 1b [Source:ZFIN;A... [more]
grm2a9.459e-1121.96glutamate receptor, metabotropic 2a [Source:ZFIN;A... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRM15.097e-1224.67glutamate receptor, metabotropic 1 [Source:NCBI ge... [more]
GRM53.572e-1122.91glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
GRM54.377e-1122.91glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
GRM54.508e-1122.91glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
GRM54.780e-1122.91glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grm17.545e-1325.99glutamate receptor, metabotropic 1 [Source:MGI Sym... [more]
Grm17.545e-1325.99glutamate receptor, metabotropic 1 [Source:MGI Sym... [more]
Grm13.369e-1225.99glutamate receptor, metabotropic 1 [Source:MGI Sym... [more]
Grm51.013e-1123.79glutamate receptor, metabotropic 5 [Source:MGI Sym... [more]
Grm21.118e-1124.23glutamate receptor, metabotropic 2 [Source:MGI Sym... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P97772|GRM1_MOUSE2.356e-1125.99Metabotropic glutamate receptor 1 OS=Mus musculus ... [more]
sp|P41594|GRM5_HUMAN6.517e-1124.23Metabotropic glutamate receptor 5 OS=Homo sapiens ... [more]
sp|Q3UVX5|GRM5_MOUSE7.085e-1123.79Metabotropic glutamate receptor 5 OS=Mus musculus ... [more]
sp|P31424|GRM5_RAT7.287e-1123.79Metabotropic glutamate receptor 5 OS=Rattus norveg... [more]
sp|P23385|GRM1_RAT8.957e-1125.55Metabotropic glutamate receptor 1 OS=Rattus norveg... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MRZ12.429e-1528.57metabotropic glutamate receptor 5 OS=Lingula ungui... [more]
A0A1S3HQU11.030e-1222.67metabotropic glutamate receptor 3 OS=Lingula ungui... [more]
V4AGY82.161e-1226.20G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
A0A1S3JY513.119e-1222.67metabotropic glutamate receptor OS=Lingula unguis ... [more]
A0A3B3TDJ65.663e-1226.52Glutamate receptor, metabotropic 1b OS=Paramormyro... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm1a7.332e-1525.65glutamate receptor, metabotropic 1a [Source:ZFIN;A... [more]
grm5a1.433e-1224.23metabotropic glutamate receptor 5-like [Source:NCB... [more]
grm5a2.040e-1224.23metabotropic glutamate receptor 5-like [Source:NCB... [more]
grm1b2.287e-1125.99glutamate receptor, metabotropic 1b [Source:ZFIN;A... [more]
grm6b2.607e-1030.54metabotropic glutamate receptor 6-like [Source:NCB... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
casr1.356e-1026.76calcium-sensing receptor [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000007590.11.485e-828.67pep scaffold:Pmarinus_7.0:GL478498:6932:63706:-1 g... [more]
grm38.185e-820.11glutamate receptor, metabotropic 3 [Source:ZFIN;Ac... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO427468.379e-725.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm1a4.368e-1324.23glutamate metabotropic receptor 1 [Source:NCBI gen... [more]
grm34.826e-1127.71metabotropic glutamate receptor 3 [Source:NCBI gen... [more]
stxbp5b9.069e-1124.23syntaxin-binding protein 5 [Source:NCBI gene;Acc:1... [more]
grm2a3.301e-1021.96glutamate metabotropic receptor 2 [Source:NCBI gen... [more]
grm2a3.916e-1021.96glutamate metabotropic receptor 2 [Source:NCBI gen... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064459.11.343e-146100.00SMESG000064459.1[more]
SMESG000033752.19.584e-1225.22SMESG000033752.1[more]
SMESG000033752.11.086e-1125.22SMESG000033752.1[more]
SMESG000024379.11.788e-624.82SMESG000024379.1[more]
SMESG000064049.12.718e-619.20SMESG000064049.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026937 ID=SMED30026937|Name=G_PROTEIN_RECEP_F3_4 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=676bp
AATGCAGAAATTGTATTGATAACGAAGTTCCGTCCATTGACCGATTGAGA
TGCATTTCATGCCCCGAATTTCAGTGGCCCCAAGAAAATACTGATACGTG
CATTTTAATTACTCCACAAATCATTTCCTGGAACTCGTGGATTTCTATAT
TAGCATGCTTATTAGCTTGTCTTGGAGCAATGACAAATTTAGGCATCATC
TATGTTTATGTAGCAAAAAGAGCGAGTAGACTGTTAAAAGCGAGTTCTTT
AAGAAGCAGTTTCTTTATTTTGGGCTCACTATTTCTAACATATATTAGCA
TGCTACTCTACGCCGGTGAATTGAGTAATTATAAATGTATAATCCACCTC
TTTTTAACTCACTGGCCATTAGGAGTTGTCTATACTAGCACATTACTCAA
AACGTTCAGGATATACAGATTATTTACTGGTATTAAAGGAGGATCAAATG
CGAAATTCACTTCTAATAGGTTCGTTTTATCAGTAAATCTTGTAATAATA
TTTGTGGATGCTGTTCTTCTTCTTAGCCTTCAATTTTACAACAATAAATT
TCTTCAAATTCAAATGCCGAATTCCAAAGAAAAGTACGTGGAAATGGTAT
GCAATCGAGACATTCCTCGATTCTGGATTCCGGTCGGTTGGAACTGGCTG
AAATTACTGATATCAACATATTGGGG
back to top

protein sequence of SMED30026937-orf-1

>SMED30026937-orf-1 ID=SMED30026937-orf-1|Name=SMED30026937-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=224bp
CRNCIDNEVPSIDRLRCISCPEFQWPQENTDTCILITPQIISWNSWISIL
ACLLACLGAMTNLGIIYVYVAKRASRLLKASSLRSSFFILGSLFLTYISM
LLYAGELSNYKCIIHLFLTHWPLGVVYTSTLLKTFRIYRLFTGIKGGSNA
KFTSNRFVLSVNLVIIFVDAVLLLSLQFYNNKFLQIQMPNSKEKYVEMVC
NRDIPRFWIPVGWNWLKLLISTYW
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR038550GPCR_3_9-Cys_sf
IPR017978GPCR_3_C
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0007196adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway
GO:0051966regulation of synaptic transmission, glutamatergic
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0042734presynaptic membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0008066glutamate receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038550GPCR, family 3, nine cysteines domain superfamilyGENE3DG3DSA:2.10.50.30coord: 1..49
e-value: 1.1E-6
score: 30.3
IPR017978GPCR family 3, C-terminalPFAMPF000037tm_3coord: 63..223
e-value: 2.0E-14
score: 53.9
IPR017978GPCR family 3, C-terminalPROSITEPS50259G_PROTEIN_RECEP_F3_4coord: 47..224
score: 12.079
NoneNo IPR availablePANTHERPTHR24060METABOTROPIC GLUTAMATE RECEPTORcoord: 1..215
NoneNo IPR availablePANTHERPTHR24060:SF158METABOTROPIC GLUTAMATE RECEPTORcoord: 1..215
NoneNo IPR availableCDDcd139537tm_classC_mGluR-likecoord: 47..223
e-value: 2.72406E-13
score: 64.9505
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 46..68
NoneNo IPR availableTMHMMTMhelixcoord: 157..179
NoneNo IPR availableTMHMMTMhelixcoord: 113..135