hedgehog-like protein

Overview
Namehedgehog-like protein (ACZ64510.1)
Smed IDSMED30026929
Length (bp)1524
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of hedgehog-like protein (SMED30026929) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for hedgehog-like protein (SMED30026929) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026929

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026929SMESG000002733.1 SmedASXL_004622SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026929SMESG000002733.1 dd_Smed_v6_64104_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30026929SMESG000002733.1 dd_Smed_v6_41965_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
esophagusSMED30026929SMESG000002733.1 GQ337474smed_ncbi_20200123PMID:19933103
Rink et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30026929SMESG000002733.1 GQ337474smed_ncbi_20200123PMID:19933103
Rink et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of hedgehog-like protein vs. Ensembl Human
Match: IHH (Indian hedgehog signaling molecule [Source:HGNC Symbol;Acc:HGNC:5956])

HSP 1 Score: 84.7297 bits (208), Expect = 4.952e-24
Identity = 69/252 (27.38%), Postives = 112/252 (44.44%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHP-GKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +          K L      +      +     R MT+  +  L  L   + NQWPG  V ++V + W+             + H S   +  H+ GR +D++        +D +  G LA+LA+  AGFDW  Y+    +HCSVK + + +A   GCF   + V +E     + +  ++ GDRVL + ++G   FS V+ F  +       F  I T +  + + ++P H
Sbjct:   47 LAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPG--VKLRVTEGWD------------EDGHHS--EESLHYEGRAVDITTSD-----RDRNKYGLLARLAV-EAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGAR-VALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAH 275          

HSP 2 Score: 46.9802 bits (110), Expect = 4.952e-24
Identity = 25/75 (33.33%), Postives = 39/75 (52.00%), Query Frame = 2
Query: 1139 EVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYP 1363
               FAS V PG ++ +  +   LQ  +V  V  +V   G  APLT+ G L+V  +  SC ++  + + A LA +P
Sbjct:  291 RATFASHVQPGQYVLVAGVP-GLQPARVAAVSTHVA-LGAYAPLTKHGTLVVEDVVASCFAAVADHHLAQLAFWP 363          
BLAST of hedgehog-like protein vs. Ensembl Human
Match: SHH (sonic hedgehog signaling molecule [Source:HGNC Symbol;Acc:HGNC:10848])

HSP 1 Score: 84.3445 bits (207), Expect = 1.827e-23
Identity = 72/251 (28.69%), Postives = 116/251 (46.22%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +     +    K L      +      +     R MT+  +  L  L   + NQWPG  V ++V + W+             + H S   +  H+ GR +D++  S+   SK    G LA+LA+  AGFDW  Y+    +HCSVK +++ +A   GCF  ++TV++EQ    + +K+L  GDRVL     G + +S  + F  +     + F  I T    + + ++  H
Sbjct:   42 LAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG--VKLRVTEGWD------------EDGHHS--EESLHYEGRAVDIT-TSDRDRSKY---GMLARLAV-EAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKL-VKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAH 270          

HSP 2 Score: 45.8246 bits (107), Expect = 1.827e-23
Identity = 24/79 (30.38%), Postives = 38/79 (48.10%), Query Frame = 2
Query: 1139 EVIFASSVIPGDFIFIV---DLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPY 1366
              +FAS V PG  +++V   D  R L    V  V       G  APLT +G +++N +  SC +  +  ++A  A  P+
Sbjct:  302 RALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVLASCYAVIEEHSWAHRAFAPF 380          
BLAST of hedgehog-like protein vs. Ensembl Human
Match: DHH (desert hedgehog signaling molecule [Source:HGNC Symbol;Acc:HGNC:2865])

HSP 1 Score: 82.0333 bits (201), Expect = 3.567e-16
Identity = 70/252 (27.78%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHP-GKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L+YK+F P   E + GASGP +          + LV     +      + +   R MT+  ++ +  L   + N WPG  V ++V + W+             + H +   D  H+ GR +D++        +D +  G LA+LA+  AGFDW  Y+  N +H SVK D++ +    GCF  N+TV +    E   ++ L  GD VL    +G V  +PV+ F  +       FV + T    + + ++P H
Sbjct:   43 LLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG--VRLRVTEGWD------------EDGHHA--QDSLHYEGRALDITTSD-----RDRNKYGLLARLAV-EAGFDWVYYESRNHVHVSVKADNSLAVRAGGCFPGNATVRL-WSGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWH 271          
BLAST of hedgehog-like protein vs. Ensembl Celegans
Match: wrt-7 (WaRThog (Hedgehog-like family) [Source:UniProtKB/TrEMBL;Acc:O45992])

HSP 1 Score: 38.891 bits (89), Expect = 4.912e-8
Identity = 25/84 (29.76%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  792 SAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGE-VRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            +A     Y CF N++ V V +K    +M  L+IGD V  + +NGE + F PV  + H+   +   F+E  +++N ++  ++ +H
Sbjct:  265 AAPQCQQYYCFPNDAVVNVYEK-AVKRMDELEIGDWVEALDENGEDITFLPVKYWLHRDPEQEAEFLEF-SLDNGETFTLTEKH 346          

HSP 2 Score: 37.3502 bits (85), Expect = 4.912e-8
Identity = 29/86 (33.72%), Postives = 44/86 (51.16%), Query Frame = 2
Query: 1067 FTYRNTFTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKV-IKYVVKQGKIAPLTQEGNLIVNSIFVSCIS 1321
             T ++    TE  + ++EL I   E I A  V  GD  ++       + + V+ + IK V K G  AP+T +G+L+VN I  SC S
Sbjct:  342 LTEKHLVYTTECRQNSSELKISW-ESISAGKVNAGDCFYLAQSEALTKYRLVEILDIKRVKKTGIYAPMTSQGHLLVNKIHTSCHS 426          
BLAST of hedgehog-like protein vs. Ensembl Celegans
Match: wrt-4 (Warthog protein 4 Warthog protein 4 N-product Warthog protein 4 C-product [Source:UniProtKB/Swiss-Prot;Acc:Q94129])

HSP 1 Score: 40.0466 bits (92), Expect = 1.283e-6
Identity = 32/117 (27.35%), Postives = 56/117 (47.86%), Query Frame = 3
Query:  813 YGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNG-EVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH*SIAFLAQISHIEILLQRLSERKLPQNCSFITKKLYLLHQ 1160
            Y CF  ++ V V     F +M  L +GD V  + KNG +V F PV  + H+   +   FVE  T++N ++  ++ +H  + F+ Q S      + ++   +P     I    Y+ H+
Sbjct:  344 YYCFPGDAMVNVYNGG-FKRMDELAVGDWVQALDKNGSQVTFIPVQYWLHRDPKQVADFVEF-TLDNGETFSLTEKH--LVFVTQCSVPYSEDENINANPVPAERVNIGDCFYIAHR 456          

HSP 2 Score: 31.5722 bits (70), Expect = 1.283e-6
Identity = 19/56 (33.93%), Postives = 28/56 (50.00%), Query Frame = 2
Query: 1169 GDFIFIVDLHRDLQVQKVDKV-IKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKN 1333
            GD  +I    +    Q+V  + I  V K G  +P+T  G+L+V+ I  SC S   N
Sbjct:  448 GDCFYIAHRKKSQMYQRVKVLDINIVQKTGIYSPMTSRGHLLVDRIHASCHSETDN 503          
BLAST of hedgehog-like protein vs. Ensembl Fly
Match: hh (gene:FBgn0004644 transcript:FBtr0100506)

HSP 1 Score: 75.0998 bits (183), Expect = 1.631e-21
Identity = 85/292 (29.11%), Postives = 137/292 (46.92%), Query Frame = 3
Query:  192 RIALLYALLFIWPVELCVKSPEHY------YKSYKMRS-HVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            R+  L ALL I  V   V SP H          ++ R+ + LV K+  P   E +  ASGP++     D    K LV     +      +     R M+K  ++ L  L   + N+WPG  + + V ++W+             E++     +  H+ GR + ++  S+   SK    G LA+LA+  AGFDW  Y     ++CSVK DS+ S+  +GCF   ST  +E       +  L IGDRVL++  NG+  +S VI F  ++  + + FV++ T +    + ++P H
Sbjct:   63 RLTSLVALLLI--VLPMVFSPAHSCGPGRGLGRHRARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEEGTGADRLMSKRCKEKLNVLAYSVMNEWPG--IRLLVTESWD-------------EDYH-HGQESLHYEGRAVTIA-TSDRDQSKY---GMLARLAV-EAGFDWVSYVSRRHIYCSVKSDSSISSHVHGCFTPESTALLESGVRK-PLGELSIGDRVLSMTANGQAVYSEVILFMDRNLEQMQNFVQLHT-DGGAVLTVTPAH 329          

HSP 2 Score: 47.3654 bits (111), Expect = 1.631e-21
Identity = 25/81 (30.86%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1145 IFASSVIPGDFIFIVDLHR-DLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKF 1384
            +FA  +   + + + D+   +L+ Q+V KV   V  +G +APLT+EG ++VNS+  SC +   +++ A   L P  ++S  
Sbjct:  344 VFADRIEEKNQVLVRDVETGELRPQRVVKV-GSVRSKGVVAPLTREGTIVVNSVAASCYAVINSQSLAHWGLAPMRLLSTL 423          
BLAST of hedgehog-like protein vs. Ensembl Zebrafish
Match: dhh (desert hedgehog signaling molecule [Source:NCBI gene;Acc:558147])

HSP 1 Score: 88.1965 bits (217), Expect = 1.512e-26
Identity = 84/286 (29.37%), Postives = 129/286 (45.10%), Query Frame = 3
Query:  192 RIALLYALLFIWPVELCVKSPEHYYKSYKMRSHV-LVYKEFQPVELENSYGASGPIDA--TDLVDRVPHKRLVRXXXXXXXXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            R+ LL A L+ W V         Y   ++ R    + YK++ P   EN+ GASG  +   T   +R            + K        R+MTK  +  L  L   + NQWPG  V ++V + W+         P G+           H+ GR +D++       +K +  G LAQLA+  AGFDW  Y+    +HCSVK D + + +  GCF+ +  V +    +   M  L  G++VL+++ +GEV FS V+ F H        F  I T  N + I ++P H
Sbjct:   11 RLGLLTACLYSWLVVDGCGPGPGYGGRHRQRKLTPMSYKQYVPGVSENNLGASGRAEGRITRSSERFNELVCNYNTDIDFKDEERSNADRFMTKRCKDCLNKLAIAVMNQWPG--VRLRVTEAWDEDGHH----PPGS----------LHYEGRAVDITTSDRD--TKKY--GLLAQLAV-EAGFDWVHYESKYHVHCSVKADHSVAVEKGGCFSASGLVTMADGVQ-KPMSCLWPGEKVLSVSGSGEVVFSRVLLFLHLDRESRTSFF-IITTENEKRIALTPNH 273          

HSP 2 Score: 51.6026 bits (122), Expect = 1.512e-26
Identity = 30/91 (32.97%), Postives = 47/91 (51.65%), Query Frame = 2
Query: 1109 AATELFIHHK--EVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMI 1375
            AA  L +HH   E +FA +V  GD+I      R +Q  KV  V     + G  APLT+ GNL V+ +  S  ++F++   A    +P+ ++
Sbjct:  277 AAHNLKLHHHDYETVFARNVRIGDYILTTGGDRGIQPSKVVSV-SLEERMGVYAPLTEHGNLFVDGVLASNYATFQDHGLAHTVFWPFRVL 366          
BLAST of hedgehog-like protein vs. Ensembl Zebrafish
Match: shhb (sonic hedgehog signaling molecule b [Source:NCBI gene;Acc:30444])

HSP 1 Score: 83.5741 bits (205), Expect = 1.269e-22
Identity = 81/292 (27.74%), Postives = 125/292 (42.81%), Query Frame = 3
Query:  177 RSDCKRIALL-YALLFIWPVELCVKSPEHYYKS-YKMRSHVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXX--XXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            R   K+ ALL +  L + P  L       Y K  +  +   L YK+F P   E + GASG  +     +    K L+     +   K        R MTK  +  L  L   + N WPG  V ++V + W+      +              +  H+ GR +D++  S+   SK    G L++LA+  AGFDW  Y+    +HCSVK +++ +A   GCF  + TV +        +K+LK+GDRVL   + G V  S  I F         +F+ I T      + ++  H
Sbjct:    4 RLHLKQFALLCFISLLLTPCGLACGPGRGYGKRRHPKKLTPLAYKQFIPNVAEKTLGASGKYEGKITRNSERFKELIPNYNPDIIFKDEENTNADRLMTKRCKDKLNSLAISVMNHWPG--VKLRVTEGWDEDGHHLE--------------ESLHYEGRAVDIT-TSDRDKSK---YGMLSRLAV-EAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSGTVTLGDGTR-KPIKDLKVGDRVLAADEKGNVLISDFIMFIDHDPTTRRQFIVIETSEPFTKLTLTAAH 273          

HSP 2 Score: 43.1282 bits (100), Expect = 1.269e-22
Identity = 26/82 (31.71%), Postives = 39/82 (47.56%), Query Frame = 2
Query: 1142 VIFASSVIPGDFIFI-VDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKF 1384
              FAS+V PGD + +  D    L+   V K I     +G  AP+T  G +IV+ +  SC +  +N  +A  A  P  +  K 
Sbjct:  288 ATFASNVKPGDTVLVWEDTCESLKSVTV-KRIYTEEHEGSFAPVTAHGTIIVDQVLASCYAVIENHKWAHWAFAPVRLCHKL 368          
BLAST of hedgehog-like protein vs. Ensembl Zebrafish
Match: shha (sonic hedgehog signaling molecule a [Source:NCBI gene;Acc:30269])

HSP 1 Score: 75.8702 bits (185), Expect = 4.678e-21
Identity = 69/251 (27.49%), Postives = 111/251 (44.22%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +     +    K L      +      +     R MT+  +  L  L   + N WPG  V ++V + W+             E+   F  +  H+ GR +D++  S+   SK    G L++LA+  AGFDW  Y+    +HCSVK +++ +A   GCF  ++ V ++   +   +K+L  GD+VL     G + FS  I F  +       F  I T    + I ++  H
Sbjct:   42 LAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNHWPG--VKLRVTEGWD-------------EDGHHFE-ESLHYEGRAVDIT-TSDRDKSK---YGTLSRLAV-EAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSALVSLQDGGQ-KAVKDLNPGDKVLAADSAGNLVFSDFIMFTDRDSTTRRVFYVIETQEPVEKITLTAAH 270          

HSP 2 Score: 45.4394 bits (106), Expect = 4.678e-21
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 2
Query: 1127 IHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQ-GKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYP---YFMISKF 1384
            +H     +ASSV  G  + +VD    L+   V ++  Y  +Q G  AP+T  G ++V+ I  SC +  +++  A LA  P   Y+ +S F
Sbjct:  282 LHTMTAAYASSVRAGQKVMVVDDSGQLKSVIVQRI--YTEEQRGSFAPVTAHGTIVVDRILASCYAVIEDQGLAHLAFAPARLYYYVSSF 369          
BLAST of hedgehog-like protein vs. Ensembl Zebrafish
Match: shha (sonic hedgehog signaling molecule a [Source:NCBI gene;Acc:30269])

HSP 1 Score: 75.8702 bits (185), Expect = 4.678e-21
Identity = 69/251 (27.49%), Postives = 111/251 (44.22%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +     +    K L      +      +     R MT+  +  L  L   + N WPG  V ++V + W+             E+   F  +  H+ GR +D++  S+   SK    G L++LA+  AGFDW  Y+    +HCSVK +++ +A   GCF  ++ V ++   +   +K+L  GD+VL     G + FS  I F  +       F  I T    + I ++  H
Sbjct:   42 LAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNHWPG--VKLRVTEGWD-------------EDGHHFE-ESLHYEGRAVDIT-TSDRDKSK---YGTLSRLAV-EAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSALVSLQDGGQ-KAVKDLNPGDKVLAADSAGNLVFSDFIMFTDRDSTTRRVFYVIETQEPVEKITLTAAH 270          

HSP 2 Score: 45.4394 bits (106), Expect = 4.678e-21
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 2
Query: 1127 IHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQ-GKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYP---YFMISKF 1384
            +H     +ASSV  G  + +VD    L+   V ++  Y  +Q G  AP+T  G ++V+ I  SC +  +++  A LA  P   Y+ +S F
Sbjct:  282 LHTMTAAYASSVRAGQKVMVVDDSGQLKSVIVQRI--YTEEQRGSFAPVTAHGTIVVDRILASCYAVIEDQGLAHLAFAPARLYYYVSSF 369          
BLAST of hedgehog-like protein vs. Ensembl Zebrafish
Match: ihha (Indian hedgehog signaling molecule a [Source:ZFIN;Acc:ZDB-GENE-051010-1])

HSP 1 Score: 78.9518 bits (193), Expect = 2.584e-15
Identity = 74/275 (26.91%), Postives = 122/275 (44.36%), Query Frame = 3
Query:  210 ALLFIWPVELCVKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHP-GKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAK---NGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQ 1016
            AL+F    E C     H  +    +   L YK+F P   E + GASG I+     +    K L      +      +     R MT+  +  L  L   + N WPG  V ++V + W+             E+   F  D  H+ GR +D++        +D +  G LA+LA+  AGFDW  Y+    +HCSVK + + +A   GCF  ++ V VE       + +L+ G++VL  ++   +G + +S VI F  +     ++F  I T + ++
Sbjct:   14 ALIFAPVNEGCGPGRGHGKRRPPKKLTPLNYKQFSPNVAEKTLGASGRIEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNMWPG--VKLRVTEGWD-------------EDGNHFE-DSLHYEGRAVDITTSD-----RDRNKYGMLARLAV-EAGFDWVYYESKAHIHCSVKSEHSVAAKTGGCFPASALVTVED-GSLKTLDSLQPGEKVLASSESDGSGTLVYSEVIAFLDRDPSARKQFFTIETDSGAK 265          
BLAST of hedgehog-like protein vs. Ensembl Xenopus
Match: IHH (indian hedgehog [Source:NCBI gene;Acc:100145111])

HSP 1 Score: 82.4185 bits (202), Expect = 1.532e-22
Identity = 70/252 (27.78%), Postives = 111/252 (44.05%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHP-GKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +     +    K L      +      +     R MT+  +  L  L   + NQWPG  V ++V + W+             + H S   +  H+ GR +D++        +D +  G LA+LA+  AGFDW  Y+    +HCSVK + + +A   GCF   +   +E   E I +  L+ G RVL +  +G   FS  + F      E   F  I+T +  + + ++P H
Sbjct:   42 LSYKQFSPNVPEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPG--VKLRVTEGWD------------EDGHHS--EESLHYEGRAVDITTSD-----RDRNKYGMLARLAV-EAGFDWVYYESKAHIHCSVKSEHSAAAKTGGCFPGGALATLE-SGEKIPVSQLRPGLRVLAMDDSGRPTFSDFLSFLDHHPKEEHVFQVIKTQDPHRQLFLTPAH 270          

HSP 2 Score: 44.669 bits (104), Expect = 1.532e-22
Identity = 26/78 (33.33%), Postives = 40/78 (51.28%), Query Frame = 2
Query: 1139 EVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQ---GKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYP 1363
            + +FASSV PG +I +  +     V  +   I  V  Q   G  APLTQ G L+V+ + VSC +  + +  A +  +P
Sbjct:  286 QAVFASSVRPGQYILVSSV-----VGLIPAKIMSVSAQTDYGAYAPLTQHGTLVVDDVVVSCFALVQKQRLAQMVYWP 358          
BLAST of hedgehog-like protein vs. Ensembl Xenopus
Match: kpna2 (karyopherin alpha-2 subunit like [Source:Xenbase;Acc:XB-GENE-979796])

HSP 1 Score: 81.6481 bits (200), Expect = 3.674e-20
Identity = 77/282 (27.30%), Postives = 123/282 (43.62%), Query Frame = 3
Query:  216 LFIWPVELCVKSPEHYYKSYKMRSHV-LVYKEFQPVELENSYGASGPID------ATDLVDRVPHKRLVRXXXXXXXXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L + PV  C        +   MR  V L YK+F P   E + GASG  +      +   ++ VP+           K        R MT+  +  +  L   + N WPG  V ++V + W+             + H +   D  H+ GR +D++  S+   SK    G LA+LA+  AGFDW  Y+    +H SVK D++      GCF   + V +    E   +  L++GD V T  + G++  S V+ F H+   +T  FV I    ++  + ++P H
Sbjct:   15 LLLVPVCCCGPGRGPVGRRRYMRKLVPLRYKQFVPNVPEKTLGASGKSEGKIRRGSERFIELVPNYN----PDIIFKDEENTGADRLMTERCKDRVNALAISVMNMWPG--VKLRVTEGWD------------EDGHHAH--DSLHYEGRALDIT-TSDRDRSKY---GMLARLAV-EAGFDWVYYESKAHIHVSVKADNSLGVRSGGCFPGTAMVMMAS-GEKKSLSELQLGDTVFTTDETGQLIPSVVLLFLHRDLYKTATFVLIEAEGHTSKLLVTPNH 270          

HSP 2 Score: 37.3502 bits (85), Expect = 3.674e-20
Identity = 23/72 (31.94%), Postives = 36/72 (50.00%), Query Frame = 2
Query: 1148 FASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYP 1363
            FA  V  GD + I      LQ  KV +V     + G  AP+T+ G L+V+ +  SC ++ ++   A  +L P
Sbjct:  286 FAYRVQIGDLVQIYVNGTQLQPSKVVRV-SVEEQTGVYAPMTEHGTLLVDGVLTSCYATVESHTLAHASLAP 356          
BLAST of hedgehog-like protein vs. Ensembl Mouse
Match: Ihh (Indian hedgehog [Source:MGI Symbol;Acc:MGI:96533])

HSP 1 Score: 87.8113 bits (216), Expect = 1.406e-26
Identity = 71/252 (28.17%), Postives = 113/252 (44.84%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHP-GKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +          K L      +      +     R MT+  +  L  L   + NQWPG  V ++V + W+             + H S   +  H+ GR +D++        +D +  G LA+LA+  AGFDW  Y+    +HCSVK + + +A   GCF   + V +E   E + +  +K GDRVL + ++G   FS V+ F  +       F  I T +  + + ++P H
Sbjct:   47 LAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPG--VKLRVTEGWD------------EDGHHS--EESLHYEGRAVDITTSD-----RDRNKYGLLARLAV-EAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLEN-GERVALSAVKPGDRVLAMGEDGTPTFSDVLIFLDREPNRLRAFQVIETQDPPRRLALTPAH 275          

HSP 2 Score: 51.9878 bits (123), Expect = 1.406e-26
Identity = 32/110 (29.09%), Postives = 51/110 (46.36%), Query Frame = 2
Query: 1133 HKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGA---SNFLCYYTSFLIKLAELFF 1453
            H    FAS V PG ++ +  +   LQ  +V  V  +V   G  APLT+ G L+V  +  SC ++  + + A LA +P  +      G+   S  + +Y   L +L  L  
Sbjct:  289 HFRATFASHVQPGQYVLVSGVP-GLQPARVAAVSTHVA-LGSYAPLTRHGTLVVEDVVASCFAAVADHHLAQLAFWPLRLFPSLAWGSWTPSEGVHWYPQMLYRLGRLLL 396          
BLAST of hedgehog-like protein vs. Ensembl Mouse
Match: Shh (sonic hedgehog [Source:MGI Symbol;Acc:MGI:98297])

HSP 1 Score: 89.3521 bits (220), Expect = 2.724e-24
Identity = 76/284 (26.76%), Postives = 129/284 (45.42%), Query Frame = 3
Query:  195 IALLYALLFIWPVELCVKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            + +L + L + P   C        + +  +   L YK+F P   E + GASG  +     +    K L      +      +     R MT+  +  L  L   + NQWPG  V ++V + W+             + H S   +  H+ GR +D++  S+   SK    G LA+LA+  AGFDW  Y+    +HCSVK +++ +A   GCF  ++TV++EQ    + +K+L+ GDRVL     G + +S  + F  +     + F  I T+   + + ++  H
Sbjct:   10 LVILASSLLVCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG--VKLRVTEGWD------------EDGHHS--EESLHYEGRAVDIT-TSDRDRSKY---GMLARLAV-EAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKL-VKDLRPGDRVLAADDQGRLLYSDFLTFLDRDEGAKKVFYVIETLEPRERLLLTAAH 271          

HSP 2 Score: 42.743 bits (99), Expect = 2.724e-24
Identity = 23/78 (29.49%), Postives = 37/78 (47.44%), Query Frame = 2
Query: 1142 VIFASSVIPGDFIFIV---DLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPY 1366
             +FAS V PG  +++V      R L    V  V     + G  APLT  G +++N +  SC +  +  ++A  A  P+
Sbjct:  289 ALFASRVRPGQRVYVVAERGGDRRLLPAAVHSVTLREEEAGAYAPLTAHGTILINRVLASCYAVIEEHSWAHRAFAPF 366          
BLAST of hedgehog-like protein vs. Ensembl Mouse
Match: Dhh (desert hedgehog [Source:MGI Symbol;Acc:MGI:94891])

HSP 1 Score: 85.1149 bits (209), Expect = 2.192e-17
Identity = 70/252 (27.78%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHP-GKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L+YK+F P   E + GASGP +          + LV     +      + +   R MT+  ++ +  L   + N WPG  V ++V + W+             + H +   D  H+ GR +D++        +D +  G LA+LA+  AGFDW  Y+  N +H SVK D++ +    GCF  N+TV + +  E   ++ L  GD VL     G V  +PV+ F  +       FV + T    + + ++P H
Sbjct:   43 LLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG--VRLRVTEGWD------------EDGHHA--QDSLHYEGRALDITTSD-----RDRNKYGLLARLAV-EAGFDWVYYESRNHIHVSVKADNSLAVRAGGCFPGNATVRL-RSGERKGLRELHRGDWVLAADAAGRVVPTPVLLFLDRDLQRRASFVAVETERPPRKLLLTPWH 271          
BLAST of hedgehog-like protein vs. UniProt/SwissProt
Match: sp|B4NJP3|HH_DROWI (Protein hedgehog OS=Drosophila willistoni OX=7260 GN=hh PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.077e-27
Identity = 78/252 (30.95%), Postives = 119/252 (47.22%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHP-GKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            LV K+  P   E+  GASGP++     D    K LV     +      +     R MTK  R+ L  L   + N+WPG  V + V ++W+             E+H     +  H+ GR + +     G   +D    G LA+LA+  AGFDW  Y     ++CSVK DS+  +  +GCF   ST  +E   E   +  L IGDRVL++  NG+  +S VI F  ++  + E FV++ T +    + ++P H
Sbjct:   94 LVLKQTVPNLSEHQLGASGPLEGEIPRDSPKFKDLVPNYNRDIVFKDEEGTGADRLMTKRCREKLNALAYSVMNEWPG--VRLLVIESWD-------------EDHD-HGQESLHYEGRAVTI-----GTNDRDLSKYGMLARLAV-EAGFDWVSYVSRRHIYCSVKSDSSTISHVHGCFTPESTAQME-NGEKKPLSQLSIGDRVLSMGSNGQPVYSEVILFMDRNLEQLENFVQLHT-DGGAVLTVTPAH 321          

HSP 2 Score: 46.595 bits (109), Expect = 2.077e-27
Identity = 26/81 (32.10%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1145 IFASSVIPGDFIFIVDL-HRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKF 1384
            +FA  V   +++ + D+   +L  Q+V KV   V  +G +APLT+EG ++VNS+  SC +   +++ A   L P  ++S  
Sbjct:  336 VFADRVEEMNYVLVNDVVTGELLPQRVIKVTS-VHSKGVVAPLTREGTIVVNSVVASCYAVINSQSLAHWGLAPMRLLSSL 415          
BLAST of hedgehog-like protein vs. UniProt/SwissProt
Match: sp|P56674|HH_DROHY (Protein hedgehog OS=Drosophila hydei OX=7224 GN=hh PE=3 SV=4)

HSP 1 Score: 85.8853 bits (211), Expect = 6.031e-26
Identity = 77/252 (30.56%), Postives = 121/252 (48.02%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKS-ADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            LV K+  P   E    ASGP++     D    K LV     + +    +     R M+K  R+ L  L   + N+WPG  V ++V ++W+             E+ Q    +  H+ GR + ++  S+   SK    G LA+LA+  AGFDW  Y     ++CSVK DS+ S +  +GCF   ST  +E   E   +  L IGDRVL++   G+  +S VI F  ++  + E FV++ T +    + ++P H
Sbjct:  108 LVLKQTVPNLSEYHNSASGPLEGAIQRDSPKFKNLVLNYNRDIEFRDEEGTGADRVMSKRCREKLNMLAYSVMNEWPG--VRLRVTESWD-------------EDRQ-HGQESLHYEGRAVTIA-TSDHDQSK---YGMLARLAV-EAGFDWVSYVSRRHIYCSVKSDSSPSISHMHGCFTPESTALLESGAEK-ALGELAIGDRVLSMDVKGQPVYSEVILFMDRNLEQVENFVQLHT-DGGAVLTVTPAH 336          

HSP 2 Score: 54.299 bits (129), Expect = 6.031e-26
Identity = 27/80 (33.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 1145 IFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKF 1384
            IFA  V   D++ + D   +LQ Q+V + +  V  +G +APLT+EG ++VNS+  SC +   +++ A   L P  ++S  
Sbjct:  351 IFADRVEELDYVLVRDATGELQPQRVLR-LGSVQSRGVVAPLTREGTIVVNSVAASCYAVISSQSLAHWGLAPMRLLSTL 429          
BLAST of hedgehog-like protein vs. UniProt/SwissProt
Match: sp|P97812|IHH_MOUSE (Indian hedgehog protein OS=Mus musculus OX=10090 GN=Ihh PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 8.478e-26
Identity = 71/252 (28.17%), Postives = 113/252 (44.84%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHP-GKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +          K L      +      +     R MT+  +  L  L   + NQWPG  V ++V + W+             + H S   +  H+ GR +D++        +D +  G LA+LA+  AGFDW  Y+    +HCSVK + + +A   GCF   + V +E   E + +  +K GDRVL + ++G   FS V+ F  +       F  I T +  + + ++P H
Sbjct:   47 LAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPG--VKLRVTEGWD------------EDGHHS--EESLHYEGRAVDITTSD-----RDRNKYGLLARLAV-EAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLEN-GERVALSAVKPGDRVLAMGEDGTPTFSDVLIFLDREPNRLRAFQVIETQDPPRRLALTPAH 275          

HSP 2 Score: 51.9878 bits (123), Expect = 8.478e-26
Identity = 32/110 (29.09%), Postives = 51/110 (46.36%), Query Frame = 2
Query: 1133 HKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGA---SNFLCYYTSFLIKLAELFF 1453
            H    FAS V PG ++ +  +   LQ  +V  V  +V   G  APLT+ G L+V  +  SC ++  + + A LA +P  +      G+   S  + +Y   L +L  L  
Sbjct:  289 HFRATFASHVQPGQYVLVSGVP-GLQPARVAAVSTHVA-LGSYAPLTRHGTLVVEDVVASCFAAVADHHLAQLAFWPLRLFPSLAWGSWTPSEGVHWYPQMLYRLGRLLL 396          
BLAST of hedgehog-like protein vs. UniProt/SwissProt
Match: sp|B4K4M0|HH_DROMO (Protein hedgehog OS=Drosophila mojavensis OX=7230 GN=hh PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.140e-24
Identity = 78/252 (30.95%), Postives = 121/252 (48.02%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKS-ADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            LV K+  P   E   GASGP++     D    K LV     +      +     R M+K  R+ L  L   + N+WPG  V + V ++W+             E+HQ    +  H+ GR + ++  S+   SK    G LA+LA+  AGFDW  Y     ++CSVK DS+ S +  +GCF   ST  +E   E   +  L IGDRVL++   G+  +S VI F  ++  + + FV++ T +    + ++P H
Sbjct:  103 LVLKQTVPNLSEYHNGASGPLEGVIHRDSPKFKNLVLNYNKDILFRDEEGTGADRVMSKRCREKLNMLAYSVMNEWPG--VRLLVTESWD-------------EDHQ-HGQESLHYEGRAVTIA-TSDRDQSKY---GMLARLAV-EAGFDWVSYVSRRHIYCSVKSDSSPSISHVHGCFTPESTALLESGAEK-ALSELAIGDRVLSMDTKGQPVYSEVILFMDRNLEQVQNFVQLHT-DGGAVLTVTPAH 331          

HSP 2 Score: 47.3654 bits (111), Expect = 1.140e-24
Identity = 26/82 (31.71%), Postives = 44/82 (53.66%), Query Frame = 2
Query: 1139 EVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKF 1384
            E +FA  V     + + D   +L+ Q+V +V   V  +G +APLT+EG ++VNS+  SC +   +++ A   L P  + S  
Sbjct:  344 EFVFADRVEELSQVLVHDATGELRPQRVLRV-DSVQSRGVVAPLTREGTIVVNSVAASCYAVISSQSLAHWGLAPMRLWSTL 424          
BLAST of hedgehog-like protein vs. UniProt/SwissProt
Match: sp|B4LZT9|HH_DROVI (Protein hedgehog OS=Drosophila virilis OX=7244 GN=hh PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 7.567e-24
Identity = 77/252 (30.56%), Postives = 122/252 (48.41%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAK-SADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            LV K+  P   E   GASGPI+     D    K LV     +      +     R M+K  R+ L  L+  + N+WPG  V + V ++W+             E+HQ    +  H+ GR + ++  S+   SK    G LA+LA+  AGFDW  Y     ++CSVK DS+   +  +GCF   ST  +E   +   +  L IGDRVL++   G+  +S VI F  ++  + + FV++ T ++   + ++P H
Sbjct:  110 LVLKQTVPNLSEYMSGASGPIEGVIQRDSPNFKDLVPNYNRDIIFRDEEGTGADRLMSKRCREKLNTLSYSVMNEWPG--VRLLVTESWD-------------EDHQ-HGQESLHYEGRAVTIA-TSDRDQSKY---GMLARLAV-EAGFDWVSYVSRRHIYCSVKSDSSPFISHVHGCFTPESTALLESGAKK-PLSELAIGDRVLSMNGKGQAVYSEVILFMDRNLEQMQNFVQLHT-DSGAVLTVTPAH 338          

HSP 2 Score: 45.0542 bits (105), Expect = 7.567e-24
Identity = 22/77 (28.57%), Postives = 44/77 (57.14%), Query Frame = 2
Query: 1145 IFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMI 1375
            +FA  V   +++ + D   +L+  +V +V   V  +G +APLT+EG ++V+S+  SC +   +++ A   L P  ++
Sbjct:  353 VFADRVEELNYVLVHDATGELRPHRVIRV-SSVRSRGVVAPLTREGTIVVDSVAASCYAVISSQSLAHWGLAPMRLL 428          
BLAST of hedgehog-like protein vs. TrEMBL
Match: D2ILR9 (Hedgehog protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 299/302 (99.01%), Postives = 301/302 (99.67%), Query Frame = 3
Query:  135 MILTLGRMLFGFYKRSDCKRIALLYALLFIWPVELCVKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            M+LTLGR+LFGFYKRSDCK IALLYALLFIWPVELCVKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRFNINNTKIIFIKENARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH
Sbjct:    1 MVLTLGRILFGFYKRSDCKCIALLYALLFIWPVELCVKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRFNINNTKIIFIKENARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 302          

HSP 2 Score: 295.049 bits (754), Expect = 0.000e+0
Identity = 144/146 (98.63%), Postives = 145/146 (99.32%), Query Frame = 2
Query: 1040 LIYRVSRSNFTYRNTFTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFFPFYFYKET 1477
            LIYRVSRSNFTYRN FTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLH+DLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFFPFYFYKET
Sbjct:  303 LIYRVSRSNFTYRNPFTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLHKDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFFPFYFYKET 448          
BLAST of hedgehog-like protein vs. TrEMBL
Match: D0VYP2 (Hedgehog protein (Fragment) OS=Dugesia japonica OX=6161 GN=Djhh PE=2 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 0.000e+0
Identity = 219/316 (69.30%), Postives = 263/316 (83.23%), Query Frame = 3
Query:   93 FSPSLFLFITPHQKMILTLGRMLFGFYKRSDCKRIALLYALLFIWPVELCVKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            FSP+L   I  +QKM+L  GR++F  +K+  C  + LLYA +FI  VELC KSP HYY+ Y+M+SH+LV  E+QP +LENS  ASGPID +DLV+ VPH+ LV+F++NNTKI F KENA+WMTKTLRK LLDL QHIENQWP ++VYI+V DTWNPR +++    +GTE HQ+ TMDHFHWAGRGIDMSLVSE FI++D HPGKLAQLALYSAGFDWCIYKY N LHCSVKRDSAKSADWYGCF NN+TVYVEQ  +F+KMKNLKIGD+VLT+ +NGE+RFSP+IGFFH+++ ETER+VEI TVNNS SI ISPEH
Sbjct:   19 FSPTLVNSIFLNQKMLLRFGRIMFELHKQLTCLYMTLLYAAVFIGSVELCSKSPHHYYRPYRMKSHILVLGEYQPGDLENSRSASGPIDTSDLVNHVPHRGLVKFDVNNTKIFFDKENAKWMTKTLRKRLLDLCQHIENQWPDKNVYIRVRDTWNPRKYQRIDGSIGTERHQNSTMDHFHWAGRGIDMSLVSEKFINRDIHPGKLAQLALYSAGFDWCIYKYVNYLHCSVKRDSAKSADWYGCFTNNATVYVEQTKKFVKMKNLKIGDKVLTLTQNGELRFSPIIGFFHRNYKETERYVEISTVNNSYSIEISPEH 334          

HSP 2 Score: 224.172 bits (570), Expect = 0.000e+0
Identity = 110/145 (75.86%), Postives = 122/145 (84.14%), Query Frame = 2
Query: 1040 LIYRVSRSNFTYRNTFTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFFPFYFYKE 1474
            LIYRVSRSNFTYR     TEREK   ELF+H+KEVIFASSV+ GDFIF+ D H  LQ+ KVD VIKYVVKQGKIAPLTQEG L+VN IFVSCISSF+NENYA LAL PYF++SKFW+GASN L YYTSFLIK+A+L FP YFYKE
Sbjct:  335 LIYRVSRSNFTYRTLNKITEREKTIKELFLHNKEVIFASSVVNGDFIFVTDNHMKLQIHKVDNVIKYVVKQGKIAPLTQEGTLLVNQIFVSCISSFQNENYALLALSPYFVVSKFWNGASNVLYYYTSFLIKIADLLFPNYFYKE 479          
BLAST of hedgehog-like protein vs. TrEMBL
Match: A0A1J1HKS3 (Hedgehog protein OS=Clunio marinus OX=568069 GN=putative Protein hedgehog PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.021e-29
Identity = 93/291 (31.96%), Postives = 147/291 (50.52%), Query Frame = 3
Query:  198 ALLYALLFIWPVELC--VKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASG----PIDATD--LVDRVPH--KRLVRXXXXXXXXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            + +  LL I  V+ C   +      +S K+    LV+K+  P  LEN+ GASG     I   D    D +P+  K ++       K        R MT+ L++ L  L   + NQWP   V ++V + W+  +F               ++D  H+ GR +D++  S+   SK    G LA+LA+  AGFDW  Y+    +HCSVK DS++++   GCFA++STV  E   E  ++  LK+G+++L++  NGE  FS VI F  +   +T  FV+I+T  +  +I  +P H
Sbjct:   20 SFIIILLLINAVQCCGPARGIGGSRRSRKLTP--LVFKQHVPNVLENTLGASGLHEGKISREDPRFRDLIPNYNKDII------FKDEEGTGADRLMTQRLKEKLNILAISVMNQWPS--VKLRVTEGWDEDDFH--------------SIDSLHYEGRAVDIT-TSDRDRSK---YGMLARLAV-EAGFDWVYYESRAHIHCSVKSDSSQASHSSGCFASDSTVQTES-GEIRRLSQLKVGEKILSVNSNGETVFSEVIMFLDRDINQTREFVQIKT-RSGATIRTTPAH 279          

HSP 2 Score: 51.2174 bits (121), Expect = 1.021e-29
Identity = 26/79 (32.91%), Postives = 51/79 (64.56%), Query Frame = 2
Query: 1130 HHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPY 1366
            H  + ++A  V   DF+ +V+++ +L+ Q+V +V   V+ +G IAPLT+EG ++V+S+  SC +   +++ A ++  PY
Sbjct:  289 HETKYLYADEVEENDFL-LVNVNNNLEPQRVTEV-SAVLSRGFIAPLTREGTVVVDSVAASCYALVNSQSLAHISFMPY 365          
BLAST of hedgehog-like protein vs. TrEMBL
Match: A0A2P1K6G4 (Hedgehog protein OS=Urechis unicinctus OX=6432 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.221e-27
Identity = 90/297 (30.30%), Postives = 147/297 (49.49%), Query Frame = 3
Query:  171 YKRS--DCKRIALLYALLFIWPVELCVKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASGPIDATDLVDRVPH---KRLVRXXXXXX--XXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            Y+RS   C   +    LL + P   C   P    +  + R+  LV+K+  P   EN+ GASGP D    + R      K L+     +   K     ++ R MT+  +  +  L   + NQWP  +V +++ + W+ +   ++  P+          D  H+ GR +D++  S+   SK    G LA+LA Y AGFDW  Y+    +HCSVK DS+ +    GCF+    V V      + M ++++GD VLT++ +G + +  VI FFHQ+ IET  ++ + T N  Q + ++P+H
Sbjct:    7 YRRSHRKCILASCFLFLLLVTPSMQCGPGPRAGRRHPRKRT-PLVFKQHLPNVSENNLGASGPTDERGPILRSDSRFKKELLMNTNPDIVFKEEEGNQDDRLMTQRCKDKVNTLAISVMNQWP--NVKLRITEAWDEK---RETGPI------MHARDSLHYEGRAVDIT-TSDRDRSKY---GMLARLA-YEAGFDWVYYESRGHIHCSVKSDSSIAVKTGGCFSGQMEVTVPGGTS-LPMSHIQVGDNVLTLSDDGRLVYDMVIAFFHQNPIETAYYLTLHTANGKQ-VSMTPDH 284          

HSP 2 Score: 37.7354 bits (86), Expect = 1.221e-27
Identity = 22/75 (29.33%), Postives = 39/75 (52.00%), Query Frame = 2
Query: 1139 EVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYP 1363
            + IF  +V+ GDF+      +  +   V   +K  V++G  APLT+ G ++VN +  SC +   + + A  +L P
Sbjct:  299 DPIFTRNVLIGDFVLTKSGDKYEKSMVVG--VKESVQKGLYAPLTKHGTVVVNHVITSCYAVIYSHDIAHASLAP 371          
BLAST of hedgehog-like protein vs. TrEMBL
Match: A0A336MEZ2 (CSON000702 protein OS=Culicoides sonorensis OX=179676 GN=CSON000702 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.756e-27
Identity = 59/193 (30.57%), Postives = 103/193 (53.37%), Query Frame = 3
Query:  501 IENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH*SIAFLAQISHIE 1079
            + N WPG  V ++V + W+  ++                 D  H+ GR +D++  S+   SK    G LA+LA+  AGFDW  Y+  + +HCSVK DS+ ++   GCF   STV +   ++  ++ +L+IG++V ++   G +  S V+ F  +   +T  FV + T ++SQSI ++P H  + +L  +  I+
Sbjct:   18 VMNHWPG--VRLRVTEGWDDDDYHSP--------------DSLHYEGRAVDIT-TSDRDRSK---YGMLARLAV-EAGFDWVYYESRSHIHCSVKSDSSHTSHLMGCFTAESTVTMANGDKR-RLADLEIGEKVQSVDAKGNIILSEVLTFLDRDVNQTREFVRLET-SDSQSITVTPSHLVMVWLPNLHQIQ 187          

HSP 2 Score: 59.6918 bits (143), Expect = 2.756e-27
Identity = 31/88 (35.23%), Postives = 54/88 (61.36%), Query Frame = 2
Query: 1127 IHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWH 1390
            +H  + +FA  V  GD++ +V+++ +L+ +KV +V   V+ QG  APLT EG LIV+SI  SC +   ++  A  +  PY ++++ W 
Sbjct:  183 LHQIQYVFADKVEEGDYL-LVNVNNNLEPRKVRRV-SAVLSQGVYAPLTSEGTLIVDSIAASCYAVVDSQKVAHWSFAPYRVVNQVWR 268          
BLAST of hedgehog-like protein vs. Ensembl Cavefish
Match: ihhb (indian hedgehog B protein-like [Source:NCBI gene;Acc:103035832])

HSP 1 Score: 83.9593 bits (206), Expect = 2.294e-24
Identity = 79/294 (26.87%), Postives = 124/294 (42.18%), Query Frame = 3
Query:  177 RSDCKRIALLYA-LLFIWPVELCVKSPEHYYKSYKMRSHV-LVYKEFQPVELENSYGASGPIDA--TDLVDRVPHKRLVRXXXXXXXXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYS--AGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            R    R+ LL A +L +     C    + Y K    R    L YK+F P   E + GASG  +   T   DR              K        R MT+  +  L  L   + N WPG  V ++V + W+             + H S   +  H+ GR +D++       + D    K A LA  +  AGFDW  Y+    +HCSVK + + +A   GCF   + V +E       M++L+ GDRVL   ++  + +S V+ F  +  +  + F  I T  + +S+ ++  H
Sbjct:    2 RPSSARVPLLIACVLLLASAGACCGPGKGYGKRRHPRKLAPLAYKQFSPNVAEKTLGASGRYEGKITRSSDRFKELTANYNPDIIFKDEENTGADRMMTQRCKDKLNSLAISVMNLWPG--VRLRVTEGWD------------EDGHHS--EESLHYEGRAVDIT-------TSDRDRNKYAMLARLAVEAGFDWVYYESKGHIHCSVKSEHSAAAKTGGCFPGRAWVMLESGGR-KAMRDLQAGDRVLVSKESRNLLYSEVLTFLDRDPMTRKLFYVIST-EDGESLSLTAAH 270          

HSP 2 Score: 48.1358 bits (113), Expect = 2.294e-24
Identity = 26/90 (28.89%), Postives = 43/90 (47.78%), Query Frame = 2
Query: 1139 EVIFASSVIPGDFIFIVDLHRD-LQVQKVDKVIKYVV--KQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGAS 1399
              IFAS   PG  +  V+  +D L  +++ ++ +  +    G  APLT +G L+VN +  SC ++ +    A     P  M+   W G S
Sbjct:  291 RTIFASDASPGQCVLTVEGEKDGLLKERLSRISRLRIWEDSGAYAPLTAQGTLLVNGVMTSCYAAVEKHQLAHWVFGPLRMLHS-WTGPS 379          
BLAST of hedgehog-like protein vs. Ensembl Cavefish
Match: dhh (desert hedgehog signaling molecule [Source:NCBI gene;Acc:103041447])

HSP 1 Score: 89.7373 bits (221), Expect = 4.535e-23
Identity = 83/295 (28.14%), Postives = 137/295 (46.44%), Query Frame = 3
Query:  192 RIALLYALLFIW--PVELCVKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASGPIDA--TDLVDRVPHKRLVRXXXXXXXXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH*SIAFLAQ 1064
            ++ LL A    W    + C   P +  +S   +   L  ++  P   E + GASG  ++  T   +R            + K     +  R MTK  +  L  L   + NQWPG  V ++V + W+             +NH + ++   H+ GR +D++  S+  I K    G LAQLA+  AGFDW  Y+    +HCSVK D + + +  GCF+ +  V V    +   M  L++GD VL +++ GE+ FS V+ F H        F+ I +  + + + ++P H  + F+AQ
Sbjct:    8 QLGLLAACACTWLLAAQGCGPGPGYGARSRSRKLTPLALRQHVPGVSETNLGASGRAESKITRHSERFNELVCNYNPDIDFKDEEKTKADRLMTKRCKDCLNKLAIAVMNQWPG--VRLRVTEAWDE-----------DDNHPAGSL---HYEGRAVDIT-TSDRDIKK---YGLLAQLAV-EAGFDWVHYESKYHVHCSVKADHSVAVEKGGCFSASGLVTVAGGLQ-KPMSCLQLGDSVLALSEAGEMVFSRVLLFLHLDISRRSTFL-ILSTEDGKELALTPNH--LIFVAQ 277          

HSP 2 Score: 38.1206 bits (87), Expect = 4.535e-23
Identity = 22/72 (30.56%), Postives = 35/72 (48.61%), Query Frame = 2
Query: 1148 FASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYP 1363
            FAS V  GD + +     ++ + K+   I    + G  APLT+ GNL V+ +  S  +S ++   A  A  P
Sbjct:  290 FASRVRRGDCVLVSGKDGEVHLSKI-VSISLEKRTGVYAPLTEHGNLFVDGVLASSYASVEDHRLAHWAFGP 360          
BLAST of hedgehog-like protein vs. Ensembl Cavefish
Match: shhb (tiggy-winkle hedgehog protein [Source:NCBI gene;Acc:103032897])

HSP 1 Score: 83.5741 bits (205), Expect = 8.172e-21
Identity = 76/285 (26.67%), Postives = 124/285 (43.51%), Query Frame = 3
Query:  192 RIALLYALLFIWPVELCVKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXX--XXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            R +LL  L        C     +  + +  +   L YK+F P   E + GASG  +     +    K L      +   K        R MT+  +  L  L   + N WPG  V ++V + W+              NH     +  H+ GR +D++  S+   SK    G L++LA+  AGFDW  Y+    +HCSVK +++ +    GCF   +TV +E       +++L++GDRVL   + G   FS  I F  ++     +F+ I T    + + ++P H
Sbjct:    9 RASLLLCLFLASCGLACGPGRGYGRRRHPKKLTPLAYKQFIPNVAEKTLGASGKYEGKITRNSERFKELTPNYNPDIIFKDEENTNADRLMTQRCKDKLNSLAISVMNHWPG--VKLRVTEGWDEDG-----------NHLE---ESLHYEGRAVDIT-TSDRDKSK---YGMLSRLAV-EAGFDWVYYESKAHIHCSVKAENSLAVKAGGCFPGWATVQLEDGGT-KPVRDLRVGDRVLAADEEGRAVFSDFIMFMDEAPRARRQFIVIETAEPVRRLVLTPAH 271          

HSP 2 Score: 36.5798 bits (83), Expect = 8.172e-21
Identity = 27/109 (24.77%), Postives = 48/109 (44.04%), Query Frame = 2
Query: 1148 FASSVIPGDFIFIVD------LHRDLQVQKVDKVIKYVVK-QGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFF 1453
            FAS V  G  +F+ D      + R LQ  +V +V    ++ +G  AP+T  G ++V+ +  SC ++ +    A  AL P  +         + L +Y   L ++     
Sbjct:  293 FASRVQVGHEVFVTDGITEEGVGRVLQSARVVRVYSTELEHEGAYAPVTVHGTVVVDQVLASCYAAVEQHWLAHSALVPARLSYATEGHEGSGLHWYARLLTQVGSWLL 401          
BLAST of hedgehog-like protein vs. Ensembl Cavefish
Match: shhb (tiggy-winkle hedgehog protein [Source:NCBI gene;Acc:103032897])

HSP 1 Score: 83.1889 bits (204), Expect = 9.779e-21
Identity = 71/251 (28.29%), Postives = 113/251 (45.02%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXX--XXXXXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +     +    K L          K        R MT+  +  L  L   + N WPG  V ++V + W+              NH     +  H+ GR +D++  S+   SK    G L++LA+  AGFDW  Y+    +HCSVK +++ +    GCF   +TV +E       +++L++GDRVL   + G   FS  I F  ++     +F+ I T    + + ++P H
Sbjct:   43 LAYKQFIPNVAEKTLGASGKYEGKITRNSERFKELTPNYNPDIIFKDEENTNADRLMTQRCKDKLNSLAISVMNHWPG--VKLRVTEGWDEDG-----------NHLE---ESLHYEGRAVDIT-TSDRDKSK---YGMLSRLAV-EAGFDWVYYESKAHIHCSVKAENSLAVKAGGCFPGWATVQLEDGGT-KPVRDLRVGDRVLAADEEGRAVFSDFIMFMDEAPRARRQFIVIETAEPVRRLVLTPAH 271          

HSP 2 Score: 36.965 bits (84), Expect = 9.779e-21
Identity = 24/79 (30.38%), Postives = 40/79 (50.63%), Query Frame = 2
Query: 1148 FASSVIPGDFIFIVD------LHRDLQVQKVDKVIKYVVK-QGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYP 1363
            FAS V  G  +F+ D      + R LQ  +V +V    ++ +G  AP+T  G ++V+ +  SC ++ +    A  AL P
Sbjct:  293 FASRVQVGHEVFVTDGITEEGVGRVLQSARVVRVYSTELEHEGAYAPVTVHGTVVVDQVLASCYAAVEQHWLAHSALVP 371          
BLAST of hedgehog-like protein vs. Ensembl Cavefish
Match: shh (Astyanax mexicanus sonic hedgehog (shh), mRNA. [Source:RefSeq mRNA;Acc:NM_001291255])

HSP 1 Score: 79.337 bits (194), Expect = 1.231e-20
Identity = 72/251 (28.69%), Postives = 115/251 (45.82%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +     +    K L+     +      +     R MT+  +  L  L   + NQWPG  V ++V + W+             E+   F  +  H+ GR +D++  S+   SK    G L++LA+  AGFDW  Y+    +HCSVK +++ +A   GCF  +S V ++   +   +K+LK GD VL   ++G + +S  I F  +       F  I T    Q I ++  H
Sbjct:   39 LAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELIPNYNPDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNQWPG--VKLRVTEGWD-------------EDGHHFE-ESLHYEGRAVDIT-TSDRDKSKY---GTLSRLAV-EAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSSHVRLKDGRQ-KALKDLKPGDSVLAADESGNLVYSDFIMFTDRDPSTRRVFYVIETKAPVQKITLTAAH 267          

HSP 2 Score: 40.4318 bits (93), Expect = 1.231e-20
Identity = 21/73 (28.77%), Postives = 36/73 (49.32%), Query Frame = 2
Query: 1145 IFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYP 1363
             FAS+++PG  + +VD +       V + I     QG  AP+T  G ++V+ +  SC +  ++   A  A  P
Sbjct:  297 TFASNIVPGQKVLVVDRNGGQLNPVVVERIYMEEHQGSYAPVTSHGTIVVDQVLASCYAVIQDHWLAHWAFAP 369          
BLAST of hedgehog-like protein vs. Ensembl Sea Lamprey
Match: SHH (sonic hedgehog signaling molecule [Source:HGNC Symbol;Acc:HGNC:10848])

HSP 1 Score: 70.8626 bits (172), Expect = 8.424e-19
Identity = 52/191 (27.23%), Postives = 91/191 (47.64%), Query Frame = 3
Query:  471 RKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNS-QSIHISPEH 1040
            +  L  L   + NQWPG  V ++V + W+             + H S   +  H+ GR +D++             G LA+LA   AGFDW  Y+    +HCSVK +++ +A   GCF   ++V++E       +++++ G RVL+    G + +SPV+ F  +     + +  I T  N  + + ++P H
Sbjct:    4 KDRLNALAISVMNQWPG--VKLRVTEGWD------------EDGHHS--EESLHFEGRALDITTSDRDRAKY----GMLARLAA-EAGFDWVYYESKAHVHCSVKAENSVAAKSGGCFPGEASVWLE-GGVAAPLRDVQPGQRVLSADGTGALLYSPVLLFLDRQPRVRQLYYVIETGENPRRRLKLTPAH 172          

HSP 2 Score: 40.4318 bits (93), Expect = 8.424e-19
Identity = 23/83 (27.71%), Postives = 40/83 (48.19%), Query Frame = 2
Query: 1142 VIFASSVIPGDFIFIVDLHRDLQVQ---KVDKVIKYVVKQ--GKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMI 1375
             IFASSV PG F+F+ +           + ++V     ++  G  APL   G ++V+ +  SC ++  +   A  AL P  ++
Sbjct:  191 AIFASSVRPGHFVFVRETAATPGHPGRVRPERVAAVYTEEALGAYAPLVSSGTVLVDGVLASCYAAVSSHELAHAALGPVRLL 273          
BLAST of hedgehog-like protein vs. Ensembl Sea Lamprey
Match: SHH (sonic hedgehog signaling molecule [Source:HGNC Symbol;Acc:HGNC:10848])

HSP 1 Score: 51.6026 bits (122), Expect = 1.229e-7
Identity = 30/89 (33.71%), Postives = 46/89 (51.69%), Query Frame = 2
Query: 1109 AATELFIHHKEVIFASSVIPGDFIFIVDLHRD----LQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYP 1363
            AA      H   +FAS V PG  +F++D  RD    L+  +V++V  +V   G +APLT  G L+V+    SC +  +  ++A  A  P
Sbjct:   78 AANSSDPRHARPVFASRVRPGMHVFVLD-DRDGGARLRAARVERV-SWVEAWGSLAPLTAHGTLVVDGFLASCYAVVELHDWAHAAFAP 164          
BLAST of hedgehog-like protein vs. Ensembl Nematostella
Match: EDO44349 (Hedgehog2; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW45])

HSP 1 Score: 78.1814 bits (191), Expect = 8.550e-23
Identity = 64/221 (28.96%), Postives = 104/221 (47.06%), Query Frame = 3
Query:  450 RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKS-ADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH*SIAFLAQISHIEILLQRLSERK 1109
            R M+K   + L  L+  +  +W G DV ++V   ++           GT   +       H++GR +D++   E    +D  P  L +LA Y AGFDW +Y+    +H SVK D      +  GCF   ST  +    E + M +L++GD+V ++   G + +SPVI F H+S      F++IRT N ++             +   SH+   + R S+RK
Sbjct:   69 RRMSKRCERKLKILSSLVRKEWIG-DVKVRVIRAYDD----------GTSKKRHHGPHSLHFSGRALDITTSDE---KRDKLP-MLGRLA-YRAGFDW-VYRAKAYIHASVKSDDEDDYRENTGCFPAASTARLAT-GEQVPMVDLRLGDKVASVDDRGGIIYSPVIMFLHRSPELIMDFLKIRTENQTE------------LVITASHLIYKINRQSKRK 259          

HSP 2 Score: 46.9802 bits (110), Expect = 8.550e-23
Identity = 28/84 (33.33%), Postives = 42/84 (50.00%), Query Frame = 2
Query: 1133 HKEVIFASSVIPGDFIFIVDLH--RDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMIS 1378
             KE  FA  V  GD +F+      + L   +V  V +    +G  APLTQ GNL V+ I VSC +   +++ A  +L P  ++ 
Sbjct:  258 RKEACFAKDVTVGDLVFVGGRSSTKSLSPGRVTSV-ERTRSRGVFAPLTQAGNLFVDDILVSCYAITSSDSIAHWSLAPVRLVG 340          
BLAST of hedgehog-like protein vs. Ensembl Nematostella
Match: EDO43615 (Hedgehog protein [Source:UniProtKB/TrEMBL;Acc:A7RY14])

HSP 1 Score: 78.5666 bits (192), Expect = 1.041e-15
Identity = 51/171 (29.82%), Postives = 84/171 (49.12%), Query Frame = 3
Query:  450 RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYS--AGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFF 956
            R M+K  R+ L +L   ++ +W G  V ++V + W+             E+ Q  ++D  H+ GR +D+S       + D  P KL  L   +  AGFDW  Y   + +H SV+ D  +   W  CF + + V +E   E I +K+LK G RV ++ + G + +S V+ F 
Sbjct:   96 RLMSKRCREKLRNLATKVKQKWKG--VKLRVTEAWD-------------EDGQ-HSLDSLHYEGRAVDIS-------TSDKDPKKLPDLGSLAVDAGFDWVYYDRRSSIHASVRSDDDRKDSWGSCFHSEALVTIEN-GERIAIKDLKTGQRVQSMDETGRLLYSEVLIFL 242          
BLAST of hedgehog-like protein vs. Ensembl Nematostella
Match: EDO30579 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0C8])

HSP 1 Score: 45.4394 bits (106), Expect = 2.495e-11
Identity = 28/74 (37.84%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  819 CFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            CF  +STV +   N  I MK LKIGDRV T+   G   +S VIGF H+       ++ I+ + N + + +S +H
Sbjct:    8 CFPESSTVQLSD-NHRIPMKELKIGDRVKTLDARGYHGYSDVIGFLHRVDGHVIDYLSIK-LANGKHLRVSDKH 79          

HSP 2 Score: 40.817 bits (94), Expect = 2.495e-11
Identity = 21/61 (34.43%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 1139 EVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGK--IAPLTQEGNLIVNSIFVSC 1315
            E IFAS V  GD +   +   + +  ++ +V++  +  GK   APLT++G ++V+ I VSC
Sbjct:   92 EEIFASQVKEGDCLVTEEGSENSKGVRLSRVLQVTMTTGKGVYAPLTRDGTMLVDGILVSC 152          
BLAST of hedgehog-like protein vs. Ensembl Nematostella
Match: EDO46995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN28])

HSP 1 Score: 40.817 bits (94), Expect = 8.290e-10
Identity = 23/74 (31.08%), Postives = 40/74 (54.05%), Query Frame = 3
Query:  819 CFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            CF  N    +E   + + +++L+IGDR+ T+  +G+V +S VI F H++      FV +  +     I IS +H
Sbjct:    1 CFPGNGKSELESGVQ-MYIRDLRIGDRIKTVGSSGDVIYSDVIAFLHKNTNIVVEFVALH-LTGEHRIIISAKH 72          

HSP 2 Score: 40.4318 bits (93), Expect = 8.290e-10
Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 2
Query: 1139 EVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSC 1315
            E IFA  V   D +++++  + L  +KV +V   V + G  APLT+EG L+VN +F SC
Sbjct:   85 EAIFADRVHVDDTVYVLEGGK-LVGKKVVRV-AMVTESGIYAPLTREGTLVVNGVFASC 141          
BLAST of hedgehog-like protein vs. Ensembl Nematostella
Match: EDO46996 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN29])

HSP 1 Score: 43.8986 bits (102), Expect = 3.040e-9
Identity = 24/74 (32.43%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  819 CFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            CF  N  V +E   + + +++L+IGDR+ T+  +G+V +S VI F H++      FV +  +     I IS +H
Sbjct:    1 CFPGNGKVELESGVQ-MYIRDLRIGDRIKTVGSSGDVIYSDVIAFLHKNTTIVVEFVALH-LTGEHRIIISAKH 72          

HSP 2 Score: 35.4242 bits (80), Expect = 3.040e-9
Identity = 23/60 (38.33%), Postives = 31/60 (51.67%), Query Frame = 2
Query: 1136 KEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSC 1315
             E IFA  V   D +++  L     V K    +  V + G  APLT+EG L+VN +F SC
Sbjct:   84 SEAIFADRVHVDDTVYV--LEGGKLVVKKVVRVAMVTESGIYAPLTREGTLVVNGVFASC 141          
BLAST of hedgehog-like protein vs. Ensembl Medaka
Match: dhh (desert hedgehog signaling molecule [Source:NCBI gene;Acc:105354368])

HSP 1 Score: 100.523 bits (249), Expect = 2.136e-22
Identity = 89/319 (27.90%), Postives = 145/319 (45.45%), Query Frame = 3
Query:  192 RIALLYALLFIWPVELCVKSPEHYYKSYKMRSHVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLV--RXXXXXXXXXXXXXXARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH*SIAFLA-QISH-IEILLQRLSERKLPQNCSFIT 1136
            ++ LL A   +W VE C   P +  +S   +   + YK+F P   EN+ GASG  +     D      LV         K     +  R MTK  +  L  L   + NQWPG  V+++V + W+         P G+           H+ GR +D++  ++   ++ +  G LAQLA+  AGFDW  Y+    +HCSVK D + + +  GCF   + V +    +   + +L  GDRV+ ++  G+V ++ V+ F HQ       F+ + T     ++ ++P H  + FLA    H I     R + R    +C  I+
Sbjct:   11 QLCLLAAWTCVWLVEGCGPGPGYGIRSRPRKLTAMHYKQFFPNFSENNLGASGRAEGKITRDSERFNELVCNYNPDIVFKDEENTDADRLMTKRCKDCLNRLAIAVMNQWPG--VHLRVTEAWDEDGHH----PQGS----------LHYEGRAVDIT--TDDRETEKY--GLLAQLAV-EAGFDWVHYESKYHVHCSVKADHSVAVERGGCFPGWARVTLAGGRQ-KTLSSLAPGDRVMALSDTGQVVYTRVLSFLHQDQESVSTFLSLET-EEGYTLVLTPHH--LVFLAPNCGHDISEYQARFASRAKTGDCVLIS 304          
BLAST of hedgehog-like protein vs. Ensembl Medaka
Match: shha (sonic hedgehog signaling molecule [Source:NCBI gene;Acc:100049186])

HSP 1 Score: 81.2629 bits (199), Expect = 3.557e-16
Identity = 72/251 (28.69%), Postives = 116/251 (46.22%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +     +    K L      +      +     R MT+  +  L  L   + NQWPG  V ++V + W+             E+   F  +  H+ GR +D++  S+   SK    G L++LA+  AGFDW  Y+    +HCSVK +++ +A   GCF  +STV +E   +   +K+L+ GDRVL    +G   ++  I F  +    +  F  I T  + Q + ++  H
Sbjct:   42 LAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNTDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNQWPG--VKLRVTEGWD-------------EDGHHFE-ESLHYEGRAVDIT-TSDRDKSKY---GTLSRLAV-EAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSSTVTLENGTQR-PVKDLQPGDRVLAADYDGNPVYTDFIMFIDRDSSTSRIFYVIET-ESGQKVTLTAAH 269          
BLAST of hedgehog-like protein vs. Ensembl Medaka
Match: shha (sonic hedgehog signaling molecule [Source:NCBI gene;Acc:100049186])

HSP 1 Score: 81.2629 bits (199), Expect = 3.835e-16
Identity = 72/251 (28.69%), Postives = 116/251 (46.22%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            L YK+F P   E + GASG  +     +    K L      +      +     R MT+  +  L  L   + NQWPG  V ++V + W+             E+   F  +  H+ GR +D++  S+   SK    G L++LA+  AGFDW  Y+    +HCSVK +++ +A   GCF  +STV +E   +   +K+L+ GDRVL    +G   ++  I F  +    +  F  I T  + Q + ++  H
Sbjct:   44 LAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNTDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNQWPG--VKLRVTEGWD-------------EDGHHFE-ESLHYEGRAVDIT-TSDRDKSKY---GTLSRLAV-EAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSSTVTLENGTQR-PVKDLQPGDRVLAADYDGNPVYTDFIMFIDRDSSTSRIFYVIET-ESGQKVTLTAAH 271          
BLAST of hedgehog-like protein vs. Ensembl Medaka
Match: ENSORLT00000020230.2 (indian hedgehog B protein [Source:NCBI gene;Acc:100125500])

HSP 1 Score: 76.2554 bits (186), Expect = 1.525e-14
Identity = 66/226 (29.20%), Postives = 103/226 (45.58%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIA-KNGEVR--FSPVIGFF 956
            L YK+F P   E + GASG  +          K L      +      ++    R MT+  +  L  L   + N WPG  V ++V + W+             + H S   D  H+ GR +D++         +     LA+LA+  AGFDW  Y+    +HCSVK + + +A   GCF  ++ V++E      +M++L  GDRVL+ + K+G     +SPVI F 
Sbjct:   44 LAYKQFSPNVAEKTLGASGRPEGKITRSSERFKELTPNYNTDIIFKDEEDTGADRLMTQRCKDKLNSLAISVMNMWPG--VKLRVTEGWD------------EDGHHS--EDSLHYEGRAVDITTSDRDRNKYNM----LARLAV-EAGFDWVYYESKAHVHCSVKSEHSVAAKTGGCFPGDAQVFLEGGGT-KQMRHLLPGDRVLSSSTKDGHTSLLYSPVISFL 247          
BLAST of hedgehog-like protein vs. Ensembl Medaka
Match: ENSORLT00000046875.1 (indian hedgehog B protein [Source:NCBI gene;Acc:100125500])

HSP 1 Score: 76.2554 bits (186), Expect = 1.564e-14
Identity = 66/226 (29.20%), Postives = 103/226 (45.58%), Query Frame = 3
Query:  294 LVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRXXXXXXXXXXXXXXA--RWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVTPMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIA-KNGEVR--FSPVIGFF 956
            L YK+F P   E + GASG  +          K L      +      ++    R MT+  +  L  L   + N WPG  V ++V + W+             + H S   D  H+ GR +D++         +     LA+LA+  AGFDW  Y+    +HCSVK + + +A   GCF  ++ V++E      +M++L  GDRVL+ + K+G     +SPVI F 
Sbjct:   44 LAYKQFSPNVAEKTLGASGRPEGKITRSSERFKELTPNYNTDIIFKDEEDTGADRLMTQRCKDKLNSLAISVMNMWPG--VKLRVTEGWD------------EDGHHS--EDSLHYEGRAVDITTSDRDRNKYNM----LARLAV-EAGFDWVYYESKAHVHCSVKSEHSVAAKTGGCFPGDAQVFLEGGGT-KQMRHLLPGDRVLSSSTKDGHTSLLYSPVISFL 247          
BLAST of hedgehog-like protein vs. Planmine SMEST
Match: SMESG000002733.1 (SMESG000002733.1)

HSP 1 Score: 322.013 bits (824), Expect = 4.845e-171
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:  588 MGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            MGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH
Sbjct:    1 MGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 151          

HSP 2 Score: 299.671 bits (766), Expect = 4.845e-171
Identity = 146/146 (100.00%), Postives = 146/146 (100.00%), Query Frame = 2
Query: 1040 LIYRVSRSNFTYRNTFTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFFPFYFYKET 1477
            LIYRVSRSNFTYRNTFTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFFPFYFYKET
Sbjct:  152 LIYRVSRSNFTYRNTFTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFFPFYFYKET 297          
BLAST of hedgehog-like protein vs. Planmine SMEST
Match: SMESG000002733.1 (SMESG000002733.1)

HSP 1 Score: 300.827 bits (769), Expect = 1.690e-164
Identity = 141/141 (100.00%), Postives = 141/141 (100.00%), Query Frame = 3
Query:  618 MDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 1040
            MDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH
Sbjct:    1 MDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAGFDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNLKIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISPEH 141          

HSP 2 Score: 298.901 bits (764), Expect = 1.690e-164
Identity = 146/146 (100.00%), Postives = 146/146 (100.00%), Query Frame = 2
Query: 1040 LIYRVSRSNFTYRNTFTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFFPFYFYKET 1477
            LIYRVSRSNFTYRNTFTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFFPFYFYKET
Sbjct:  142 LIYRVSRSNFTYRNTFTKTEREKAATELFIHHKEVIFASSVIPGDFIFIVDLHRDLQVQKVDKVIKYVVKQGKIAPLTQEGNLIVNSIFVSCISSFKNENYAFLALYPYFMISKFWHGASNFLCYYTSFLIKLAELFFPFYFYKET 287          
The following BLAST results are available for this feature:
BLAST of hedgehog-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
IHH4.952e-2427.38Indian hedgehog signaling molecule [Source:HGNC Sy... [more]
SHH1.827e-2328.69sonic hedgehog signaling molecule [Source:HGNC Sym... [more]
DHH3.567e-1627.78desert hedgehog signaling molecule [Source:HGNC Sy... [more]
back to top
BLAST of hedgehog-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wrt-74.912e-829.76WaRThog (Hedgehog-like family) [Source:UniProtKB/... [more]
wrt-41.283e-627.35Warthog protein 4 Warthog protein 4 N-product Wart... [more]
back to top
BLAST of hedgehog-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hh1.631e-2129.11gene:FBgn0004644 transcript:FBtr0100506[more]
back to top
BLAST of hedgehog-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhh1.512e-2629.37desert hedgehog signaling molecule [Source:NCBI ge... [more]
shhb1.269e-2227.74sonic hedgehog signaling molecule b [Source:NCBI g... [more]
shha4.678e-2127.49sonic hedgehog signaling molecule a [Source:NCBI g... [more]
shha4.678e-2127.49sonic hedgehog signaling molecule a [Source:NCBI g... [more]
ihha2.584e-1526.91Indian hedgehog signaling molecule a [Source:ZFIN;... [more]
back to top
BLAST of hedgehog-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
IHH1.532e-2227.78indian hedgehog [Source:NCBI gene;Acc:100145111][more]
kpna23.674e-2027.30karyopherin alpha-2 subunit like [Source:Xenbase;A... [more]
back to top
BLAST of hedgehog-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ihh1.406e-2628.17Indian hedgehog [Source:MGI Symbol;Acc:MGI:96533][more]
Shh2.724e-2426.76sonic hedgehog [Source:MGI Symbol;Acc:MGI:98297][more]
Dhh2.192e-1727.78desert hedgehog [Source:MGI Symbol;Acc:MGI:94891][more]
back to top
BLAST of hedgehog-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4NJP3|HH_DROWI2.077e-2730.95Protein hedgehog OS=Drosophila willistoni OX=7260 ... [more]
sp|P56674|HH_DROHY6.031e-2630.56Protein hedgehog OS=Drosophila hydei OX=7224 GN=hh... [more]
sp|P97812|IHH_MOUSE8.478e-2628.17Indian hedgehog protein OS=Mus musculus OX=10090 G... [more]
sp|B4K4M0|HH_DROMO1.140e-2430.95Protein hedgehog OS=Drosophila mojavensis OX=7230 ... [more]
sp|B4LZT9|HH_DROVI7.567e-2430.56Protein hedgehog OS=Drosophila virilis OX=7244 GN=... [more]
back to top
BLAST of hedgehog-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2ILR90.000e+099.01Hedgehog protein OS=Schmidtea mediterranea OX=7932... [more]
D0VYP20.000e+069.30Hedgehog protein (Fragment) OS=Dugesia japonica OX... [more]
A0A1J1HKS31.021e-2931.96Hedgehog protein OS=Clunio marinus OX=568069 GN=pu... [more]
A0A2P1K6G41.221e-2730.30Hedgehog protein OS=Urechis unicinctus OX=6432 PE=... [more]
A0A336MEZ22.756e-2730.57CSON000702 protein OS=Culicoides sonorensis OX=179... [more]
back to top
BLAST of hedgehog-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ihhb2.294e-2426.87indian hedgehog B protein-like [Source:NCBI gene;A... [more]
dhh4.535e-2328.14desert hedgehog signaling molecule [Source:NCBI ge... [more]
shhb8.172e-2126.67tiggy-winkle hedgehog protein [Source:NCBI gene;Ac... [more]
shhb9.779e-2128.29tiggy-winkle hedgehog protein [Source:NCBI gene;Ac... [more]
shh1.231e-2028.69Astyanax mexicanus sonic hedgehog (shh), mRNA. [So... [more]
back to top
BLAST of hedgehog-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SHH8.424e-1927.23sonic hedgehog signaling molecule [Source:HGNC Sym... [more]
SHH1.229e-733.71sonic hedgehog signaling molecule [Source:HGNC Sym... [more]
back to top
BLAST of hedgehog-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hedgehog-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443498.550e-2328.96Hedgehog2; Predicted protein [Source:UniProtKB/Tr... [more]
EDO436151.041e-1529.82Hedgehog protein [Source:UniProtKB/TrEMBL;Acc:A7R... [more]
EDO305792.495e-1137.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469958.290e-1031.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469963.040e-932.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of hedgehog-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhh2.136e-2227.90desert hedgehog signaling molecule [Source:NCBI ge... [more]
shha3.557e-1628.69sonic hedgehog signaling molecule [Source:NCBI gen... [more]
shha3.835e-1628.69sonic hedgehog signaling molecule [Source:NCBI gen... [more]
ENSORLT00000020230.21.525e-1429.20indian hedgehog B protein [Source:NCBI gene;Acc:10... [more]
ENSORLT00000046875.11.564e-1429.20indian hedgehog B protein [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of hedgehog-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000002733.14.845e-171100.00SMESG000002733.1[more]
SMESG000002733.11.690e-164100.00SMESG000002733.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026929
GenBankACZ64510.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026929 ID=SMED30026929|Name=hedgehog-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1524bp
TTGATTGGATCAAAATAAATATTAACAAATCAAATTTCGTCTCGCTCTAT
AAAAACAATTCCTTTTGAAAATGGGAATCACTTTATTGAAATTTTAGCCC
CTCCCTATTTTTATTTATTACTCCACATCAAAAAATGATTTTGACACTCG
GTAGAATGTTGTTTGGATTTTACAAAAGGTCTGACTGTAAACGCATTGCA
TTGTTGTACGCTCTATTATTCATTTGGCCAGTGGAATTATGCGTCAAATC
ACCTGAACATTATTATAAATCCTATAAAATGAGATCACACGTGTTGGTAT
ATAAAGAGTTTCAACCTGTCGAGCTGGAAAACAGCTACGGTGCCAGTGGA
CCAATTGATGCGACTGACTTGGTTGATAGAGTTCCTCACAAAAGATTAGT
GAGGTTCAATATAAATAACACAAAGATTATTTTTATCAAAGAAAATGCAC
GATGGATGACTAAGACGTTAAGAAAACACCTCCTAGATCTTAATCAACAT
ATCGAAAACCAGTGGCCAGGAAGAGATGTTTATATTCAAGTCCATGACAC
TTGGAATCCCAGAAATTTTCGAAAGAAAGTCACTCCTATGGGGACAGAAA
ATCATCAAAGCTTTACAATGGATCATTTTCATTGGGCTGGTCGAGGCATC
GACATGAGTTTGGTCAGTGAGGGATTTATCAGTAAGGATTTCCATCCCGG
GAAATTAGCACAATTGGCGCTTTATTCTGCGGGTTTTGATTGGTGCATAT
ACAAATATACCAATTTACTTCATTGTTCGGTGAAGAGAGATTCTGCAAAA
TCTGCGGATTGGTACGGTTGCTTTGCGAACAATTCAACTGTATATGTTGA
ACAGAAAAACGAATTTATCAAAATGAAAAACTTGAAAATCGGCGATCGAG
TTCTGACAATAGCGAAAAACGGTGAAGTTCGCTTTAGTCCGGTGATTGGA
TTTTTCCATCAAAGCTTTATTGAGACAGAGAGATTCGTGGAAATTAGAAC
AGTGAACAATTCTCAGTCCATTCATATCTCTCCTGAACATTAATCTATCG
CGTTTCTCGCTCAAATTTCACATATCGAAATACTTTTACAAAGACTGAGC
GAGAGAAAGCTGCCACAGAATTGTTCATTCATCACAAAGAAGTTATATTT
GCTTCATCAGTAATTCCCGGTGATTTCATATTCATAGTTGACCTCCATAG
AGACCTTCAAGTTCAAAAAGTAGATAAGGTTATTAAATACGTTGTCAAGC
AAGGCAAAATTGCACCTCTCACTCAAGAAGGGAATCTAATTGTAAACAGT
ATTTTTGTTTCGTGTATATCGAGTTTTAAGAATGAAAACTATGCATTTCT
AGCACTGTATCCATATTTCATGATTTCAAAATTCTGGCATGGGGCGTCAA
ATTTCTTGTGCTACTACACATCGTTCCTCATCAAACTTGCTGAATTGTTT
TTCCCATTTTATTTTTACAAAGAGACTTGATTGAGCAACTCTGACAATTA
CAATCTGTGTATTTCTCGTCCACC
back to top

protein sequence of SMED30026929-orf-1

>SMED30026929-orf-1 ID=SMED30026929-orf-1|Name=SMED30026929-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=303bp
MILTLGRMLFGFYKRSDCKRIALLYALLFIWPVELCVKSPEHYYKSYKMR
SHVLVYKEFQPVELENSYGASGPIDATDLVDRVPHKRLVRFNINNTKIIF
IKENARWMTKTLRKHLLDLNQHIENQWPGRDVYIQVHDTWNPRNFRKKVT
PMGTENHQSFTMDHFHWAGRGIDMSLVSEGFISKDFHPGKLAQLALYSAG
FDWCIYKYTNLLHCSVKRDSAKSADWYGCFANNSTVYVEQKNEFIKMKNL
KIGDRVLTIAKNGEVRFSPVIGFFHQSFIETERFVEIRTVNNSQSIHISP
EH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016540protein autoprocessing
GO:0006508proteolysis
GO:0007267cell-cell signaling
GO:0016539intein-mediated protein splicing
GO:0007275multicellular organism development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000062esophagus
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036844Hint_dom_sf
IPR009045Hedgehog_sig/DD-Pept_Zn-bd_sf
IPR028992Hedgehog/Intein_dom
IPR001767Hedgehog_Hint
IPR000320Hedgehog_signalling_dom
IPR006141Intein_N
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001767Hedgehog protein, Hint domainPFAMPF01079Hintcoord: 219..303
e-value: 1.6E-16
score: 60.4
NoneNo IPR availableGENE3DG3DSA:2.170.16.10coord: 230..303
e-value: 7.9E-15
score: 57.4
NoneNo IPR availablePANTHERPTHR11889HEDGEHOGcoord: 23..303
NoneNo IPR availableCDDcd00081Hintcoord: 229..303
e-value: 3.45464E-9
score: 52.2714
IPR009045Hedgehog signalling/DD-peptidase zinc-binding domain superfamilyGENE3DG3DSA:3.30.1380.10coord: 52..229
e-value: 2.1E-38
score: 133.5
IPR009045Hedgehog signalling/DD-peptidase zinc-binding domain superfamilySUPERFAMILYSSF55166Hedgehog/DD-peptidasecoord: 53..219
IPR000320Hedgehog, N-terminal signalling domainPFAMPF01085HH_signalcoord: 47..215
e-value: 2.3E-15
score: 56.6
IPR006141Intein N-terminal splicing regionPROSITEPS50817INTEIN_N_TERcoord: 229..303
score: 9.586
IPR036844Hint domain superfamilySUPERFAMILYSSF51294Hedgehog/intein (Hint) domaincoord: 229..303