GCR044

Overview
NameGCR044
Smed IDSMED30026927
Length (bp)1324
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR044 (SMED30026927) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR044 (SMED30026927) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR044 (SMED30026927) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR044 (SMED30026927) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026927

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026927SMESG000046087.1 SMESG000046084.1 SmedASXL_008175SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026927SMESG000020870.1 SMESG000046087.1 SMESG000046084.1 dd_Smed_v4_2768_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026927SMESG000020870.1 SMESG000046087.1 SMESG000046084.1 dd_Smed_v4_2768_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30026927SMESG000020870.1 SMESG000046087.1 SMESG000046084.1 dd_Smed_v4_2768_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026927SMESG000020870.1 SMESG000046087.1 SMESG000046084.1 dd_Smed_v4_2768_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026927SMESG000020870.1 SMESG000046087.1 SMESG000046084.1 dd_Smed_v4_2768_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR044 vs. Ensembl Human
Match: NMUR2 (neuromedin U receptor 2 [Source:HGNC Symbol;Acc:HGNC:16454])

HSP 1 Score: 172.555 bits (436), Expect = 1.321e-48
Identity = 108/334 (32.34%), Postives = 182/334 (54.49%), Query Frame = 3
Query:   48 TDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV 1046
            + +E+++   GP+R   +  +P + +YV +  VGV GN + C VIL  + M+TPTNYYL +L ++DL VL+LG+  + Y  W +YP+ FG  GC  K+ L E     S+L+ T  ++ERY+AI HP     +S  R+R ++I+  +W  S L SLP     G++     + S      L+  S  CT I+   + N  +      F    + ++SVLY  + L ++      + + + + E     Q   RK+  KML  +V++F +C APFH +RL  + + E  W     L  V   ++ +SG+ +Y + A+NPI+YN++S +F+  F +++
Sbjct:   28 STEEYLAFLCGPRRS--HFFLPVSVVYVPIFVVGVIGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCYFKTALFETVCFASILSITTVSVERYVAILHPFRAKLQS-TRRRALRILGIVWGFSVLFSLPNTSIHGIKFHYFPNGS------LVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMALRLK------KDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEE--WSES--LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVI 342          
BLAST of GCR044 vs. Ensembl Human
Match: NMUR1 (neuromedin U receptor 1 [Source:HGNC Symbol;Acc:HGNC:4518])

HSP 1 Score: 160.999 bits (406), Expect = 3.777e-44
Identity = 121/353 (34.28%), Postives = 183/353 (51.84%), Query Frame = 3
Query:   42 NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXX-XXXXXMSV--------LYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF----CDIVKCRRL 1061
            NLTD+       GPQ+    L +P    Y+++  VG  GN +TC VIL  K MRTPTNYYL +L ++DL VL++GL  + Y  W +YP+  G  GC  ++LL EM    SVL  T  ++ERY+A+ HP L+      R    +++  +W  + LCSLP     G++QL          +  + DS VC  +  +AL N  + +  + F   P+ +MSV        L     L ++ +  RG     S    + +   R R+   KML  +V++F +C APFHA+R+M +++  S W     L    + ++ +SGI +Y   A NP+LY++MS +FR  F    C    C RL
Sbjct:   41 NLTDEALRLKYLGPQQT--ELFMPICATYLLIFVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYEMWHNYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHP-LQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIRQLHVP------CRGPVPDSAVCMLVRPRALYNMVVQTTALLFFCLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLFVLVVVFGICWAPFHADRVMWSVV--SQWTDGLHL--AFQHVHVISGIFFYLGSAANPVLYSLMSSRFRETFQEALCLGACCHRL 380          
BLAST of GCR044 vs. Ensembl Human
Match: GHSR (growth hormone secretagogue receptor [Source:HGNC Symbol;Acc:HGNC:4267])

HSP 1 Score: 125.561 bits (314), Expect = 1.296e-31
Identity = 107/343 (31.20%), Postives = 160/343 (46.65%), Query Frame = 3
Query:   84 QRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIE---QKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKR 1103
            Q  P  LL       V L  VG+ GN +T  V+  F+ +RT TN YL ++  +DL ++ L +  D    W + P+ FG+  C +   +SE     +VLT T  ++ERY AIC P L+      + R   +I  IW  +F  + P+ + +G++     D           D+  C   E   +  L    +    IFF  P+  ++VLY  IG   R    R     +  A  + +N     K  VKMLA +V  F LC  PFH  R + +   E    S +I  ++ ++   +S +L+Y + AINPILYNIMS K+R     +   R L   P  Q  LST +
Sbjct:   36 QLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDL-LIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFP-LRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDP---------WDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIG---RKLWRRRRGDAVVGASLRDQNH----KQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPG--SLEIA-QISQYCNLVSFVLFYLSAAINPILYNIMSKKYR-----VAVFRLLGFEPFSQRKLSTLK 352          
BLAST of GCR044 vs. Ensembl Human
Match: NTSR1 (neurotensin receptor 1 [Source:HGNC Symbol;Acc:HGNC:8039])

HSP 1 Score: 122.479 bits (306), Expect = 4.223e-30
Identity = 102/364 (28.02%), Postives = 172/364 (47.25%), Query Frame = 3
Query:  117 NTIYVVLIFVGVFGNCITCRVILHFKVMRT---PTNYYLLNLGIADLSVLILGLTQDFY-LTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHS-----VCR--GEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKC-----RRLSSTPKIQMSLSTKRYMIISKEPLKQSSIKKCQY 1160
              +Y+ L  VG  GN +T   +   K +++     +Y+L +L ++DL  L+L +  + Y   W H+P+ FG+ GC     L +     + L     ++ERY+AICHP  K     +R RT K I+ IW+ S L ++P+   MG Q    +         L+   T+ T   +  +  +  +SFI   +   +L +++  ++ + +R +     VC   GE    S A    R Q  A +  V++L A+VI F +C  P+H  RLM   I +  W     L+  + + Y ++  L+Y +  INPILYN++S  FR+ F   + C     RR    P    + S K   + S   L  ++ ++  Y
Sbjct:   67 TAVYLALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHP-FKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAG---GLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHSTFSMAIEPGRVQ--ALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWT--PFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRP----AFSRKADSVSSNHTLSSNATRETLY 418          
BLAST of GCR044 vs. Ensembl Human
Match: NTSR2 (neurotensin receptor 2 [Source:HGNC Symbol;Acc:HGNC:8040])

HSP 1 Score: 114.005 bits (284), Expect = 3.525e-27
Identity = 88/352 (25.00%), Postives = 157/352 (44.60%), Query Frame = 3
Query:  114 FNTIYVVLIFVGVFGNCITCRVILHFKVMRTPT--NYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQ-QLKRNDSSTNFTQRL-------------------------------LEDSTV------CTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVK 1049
            F  +Y ++  +G  GN ++  V+L  +  R     ++ L       L +L+    + +   W HYP+ FG+ GC     + E+    +VL+  G + ER +A+C PL   S    R RT  ++A  W  S   +LP+A+ MG + +L+  D       R+                               L   TV      C+Q+   + P S   S +       +L  +++       + +  +G Q  +S   HK   ++R+ + +V++L AIV+++ +C  P+HA RLM   +P+ AW     L+  + + Y ++  L+Y + A+ P+LYN +S  FR  F + V 
Sbjct:   35 FTALYALIWALGAAGNALSAHVVLKARAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAYATVLSVAGLSAERCLAVCQPLRARSLLTPR-RTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVW-------KKTFIQGGQ--VSLVRHKDVRRIRSLQRSVQVLRAIVVMYVICWLPYHARRLMYCYVPDDAWTDP--LYNFYHYFYMVTNTLFYVSSAVTPLLYNAVSSSFRKLFLEAVS 374          
BLAST of GCR044 vs. Ensembl Celegans
Match: nmur-2 (NMUR (NeuroMedin U Receptor) homolog [Source:UniProtKB/TrEMBL;Acc:O17239])

HSP 1 Score: 158.303 bits (399), Expect = 9.102e-44
Identity = 112/347 (32.28%), Postives = 177/347 (51.01%), Query Frame = 3
Query:   57 EFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSH-YPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLA--LQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNS--------XXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVC--RGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFL----YSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV 1046
            E++    G +     ++IP   IY  +  +G+FGN  TC VI   K M  PTNYYL +L ++D+  LILGL  +FY +  + YPY F    C  ++ L E     S++    F+ ER++AICHPL     S   +  + II   W  SF+C+LP+A  +Q+    L  +     +T ++  D       E  A+  S         + +F +FF+ P I + ++Y  I + +  S    +G++ +      KRRN  ++ +  +KML ++VI FF+C  PFH +RL+      + W     +    +FL    + +SG  YY N A NPILYNI+S K+R+ FC  +
Sbjct:   15 EYVLSTLGERCQSAGIVIPTVIIYGTIFLLGLFGNICTCIVIAANKSMHNPTNYYLFSLAVSDIIALILGLPMEFYQSLDYSYPYRFSEGICKARAFLIEFTSYASIMIICCFSFERWLAICHPLRSKIFSTLWRANVLIILA-WTISFVCALPIAFIVQINKLPLPEDAKYQPWTNKVSTDGIFVLHTEFCAMNQSRPDQQKMIIIFAFTVFFVIPAIAIVIMYAHIAVQLESSEIDLKGDKMV-----KKRRN--KSNRTVLKMLLSVVITFFICWLPFHIQRLLSVY---TTWSETTTISPPVQFLSMIVFYISGFCYYSNSAANPILYNILSQKYRSAFCRTI 350          
BLAST of GCR044 vs. Ensembl Celegans
Match: nmur-1 (NMUR (NeuroMedin U Receptor) homolog; Neuromedin U receptor [Source:UniProtKB/TrEMBL;Acc:Q18701])

HSP 1 Score: 155.606 bits (392), Expect = 8.785e-43
Identity = 104/344 (30.23%), Postives = 171/344 (49.71%), Query Frame = 3
Query:  117 NTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCR-GEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV--KCRRLSSTPKIQMSLSTKRYMIISKEPLKQS 1139
              +Y+ +  VGV GN  TC V+    +M+T  + YL+NL ++DL  L +GL  +  + W+ YP+PF ++ C +K+L++E     S+LT   F IERY+A+CHPL        ++    II   WI S LC++P A+      + ++   T+   R+   S+    I     P       I+F  + +   ++    I +      C+    + I   E     +++ R  A+  L AIV  FF+C  PF  +RL+        +D++ IL  V++++Y +SG L+Y    INPI YN+ S +FR  F DI+   C R  S    + S S      ++  PL+Q+
Sbjct:   55 TALYIFIFLVGVIGNTTTCLVMKKHPMMKTHASMYLMNLAVSDLVTLCVGLPFEVMMNWNQYPWPFPDYICNLKALIAETTSSVSILTILIFAIERYVAVCHPLFLMKVQPFKRNIGTIIGFTWIFSILCAMPFAIHHRADYIMKSWPGTD--NRIPVKSSKMCMIAVMFEPKLASTFKILFHFSAIAFFALPLFTIVILYARIACKVSSNRTIQPGELDITEELQMRINAI--LCAIVSAFFICYLPFQLQRLLFFY-----FDNEVILTWVNQYMYFISGFLFYLATIINPIAYNLASSRFRRAFKDILIDYCWRGGSERYPRSSFSKYS---LAHTPLRQA 386          
BLAST of GCR044 vs. Ensembl Celegans
Match: trhr-1 (Thyrotropin-Releasing Hormone Receptor [Source:UniProtKB/TrEMBL;Acc:Q95YD7])

HSP 1 Score: 117.857 bits (294), Expect = 4.248e-29
Identity = 106/358 (29.61%), Postives = 165/358 (46.09%), Query Frame = 3
Query:   78 GPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDF-YLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRH-------------------------SVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLI--PESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSS 1067
            G Q   I L   F+ I V+    GV GN +   V+L  + M+TPTN YL++L  +D       +  +  YL   +  Y FG+ GC++ + L  + M TS L+   FTIERY  IC+P  K       +R   II  IWI S L     +  + L  L ++D  T+ + RL  +S         A    FL+ F+++++ P++   ++Y +IG+T+                           S   G      S    +RN  + R   VKMLA +V +F +C  P+    +  + +  P+ +W      W ++     LS  L + NCAINPILYN+MS +FR  F  ++  R+ S 
Sbjct:   27 GTQPMDITLAFVFSAISVI----GVLGNLLVITVVLKVRGMKTPTNCYLVSLAASDTLFFFASMPHEMMYLLGPNDHYLFGSLGCVLLTYLPYLAMNTSSLSILAFTIERYYGICNP-YKARTMCTVKRATCIICGIWIFSMLYH---SYWLFLATLIKDDIGTSCSFRLERNS--------HAYKIVFLLDFVLWYVLPIMCDIIIYAKIGITLSQCGDKIKKSVKPKIPNEVIVEKSKTSSTSMGHYSGRDSHISGKRNSAKGRNQVVKMLAIVVAVFAVCWLPYRGMVVYNSFVSDPKYSWSPD---WYIN-----LSKTLVFINCAINPILYNLMSARFRAAFRSLLSKRKNSG 360          
BLAST of GCR044 vs. Ensembl Celegans
Match: tkr-2 (TachyKinin Receptor family [Source:UniProtKB/TrEMBL;Acc:O44148])

HSP 1 Score: 107.457 bits (267), Expect = 1.819e-25
Identity = 94/346 (27.17%), Postives = 159/346 (45.95%), Query Frame = 3
Query:   27 EMYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWS---HYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRL-LEDS------TVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            +MY+   T   +   E  P   PI   I +  ++ + IF+ + GN     +IL+ + MR+ TNYYL NL +AD S+ +         +WS   +Y + FG+F C + +L+    +C SV T    +IERY AI HPL K      R+ T+ II  IW  +FL  +P  L   +      D  T +   L L D+      ++  Q+    L         + ++ PL ++S  Y R+G+ +R     G+         +    + A+K A  MLA +V +F +   P++A  L + L+         +   ++ +   +S  ++      NP++Y  M+ +FR GF
Sbjct:   38 QMYQ---THGVYFIFEPTPFVHPIVSQIFYGILFTLTIFLALMGNFTVMWIILYHRQMRSVTNYYLFNLAVADASISVFNTG----FSWSYNYYYVWKFGSFYCRINNLMGITPICASVFTMIVMSIERYYAIIHPLKK---RPGRRSTVTIIIMIWFMAFLFGVPAFLASKVDVYYFYDGYTLYENPLCLADNYPGGNESLLGQVYNNGL-------ITVQYILPLCILSAAYYRVGVELRKDKTVGDV--------RHAKSVAAKKKASIMLAVVVFIFMIVWFPYNAYYLTLHLVEPIGNKMLSLYIYINIYWLGMSSTVF------NPVIYYFMNKRFRVGF 352          
BLAST of GCR044 vs. Ensembl Celegans
Match: nmur-3 (NMUR (NeuroMedin U Receptor) homolog [Source:UniProtKB/TrEMBL;Acc:Q7JNX1])

HSP 1 Score: 104.76 bits (260), Expect = 2.459e-24
Identity = 90/344 (26.16%), Postives = 155/344 (45.06%), Query Frame = 3
Query:  123 IYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFG-CIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVL-----YMRIGLTIR-------------------------HSVCRGEQQIISSAEHKRRNQ----MRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVK 1049
            I+V +  VG+ GN +T  VI     + + TNY+L NL  +D  ++++G++ D    W+    P   FG C + S    +    S+LT    T ER+ AIC+P    +  + + R  + I  IW   F+  LP ++ +G    + +     F +++    T   + +    P+SF        +T   ++ +      Y RI +T+                          H+      Q      H +  Q     +A+K  +KML  +  +FF+C  P+HA+RL+V    +   +S        + LY ++GIL Y + ++NPI YN+MS +FRNGF  ++K
Sbjct:   81 IFVFVGLVGLIGNLLTVIVIFKTNSLHSHTNYFLANLATSDFCLIVVGVSFDLVNIWNDEE-PLDIFGYCSLTSTFISLFTFASILTIVLLTAERFTAICYPFSHRTIFDEK-RVKRFILLIW---FVALLP-SIFIGSMFKRVSQDFCGFNRQM----TYIGRCDLVTSPDSFFRYPFESAITITFVLPLFFIIYCYFRILVTLNEMSNSTHVHTPVGTARSDSGAFPFPHTSNNSNTQSFPLTVHTKNVQPPRSQQAQKMVIKMLVTVTAVFFVCYLPYHAQRLIVKYNSKDCSNSDFC-----KLLYPIAGILQYISASLNPIFYNLMSVRFRNGFKKLIK 409          
BLAST of GCR044 vs. Ensembl Fly
Match: PK2-R1 (gene:FBgn0038140 transcript:FBtr0082745)

HSP 1 Score: 179.489 bits (454), Expect = 1.240e-49
Identity = 122/323 (37.77%), Postives = 174/323 (53.87%), Query Frame = 3
Query:   81 PQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLM----VTLIPES-AWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            P  + + L       Y ++   GV GN ITC VI     M T TN+YL NL ++DL +L+ G+ Q+ Y  W    YPF +  CI+ S+LSEM    +VLT T FT+ERYIAICHP  + + S    R IK I  IW+ +FL +LP A+Q              F+     +   CT +E     + F +S  IFF  P+  + VLY+ IG+ ++ S  R  Q +        R  + A+   ++ML A+ + FFLC APFHA+RLM    + LI    + D+    +R+ ++    SG+LY+ +  INP+LYNIMSHKFR  F
Sbjct:   99 PVDESLTLRTALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSK-LSRAIKFIFAIWLAAFLLALPQAMQ--------------FSVVYQNEGYSCT-MENDFYAHVFAVSGFIFFGGPMTAICVLYVLIGVKLKRS--RLLQSLPRRTFDANRG-LNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYT---SGVLYFLSTCINPLLYNIMSHKFREAF 399          
BLAST of GCR044 vs. Ensembl Fly
Match: CapaR (gene:FBgn0037100 transcript:FBtr0078379)

HSP 1 Score: 171.4 bits (433), Expect = 6.278e-48
Identity = 115/340 (33.82%), Postives = 183/340 (53.82%), Query Frame = 3
Query:   42 NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXM---SVLYMRIGLTIRHSVCR--GEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV 1046
            N + KEF++   GPQ  P+   +    I+  +   GV GN + C VI+    M T TNYYL +L ++DL  L+ GL  + +L W  YP  FG   C +++ +SE     SV T   F++ER++AICHPL   +    + R I+II  +WI SF+ ++P  L   +Q L             +E+S  C+      + N   +  + F +  +I M    +LY R+G  IR    +  G QQ  ++ E  R +QMR +K  ++MLAA+VI FF+C  PFH +RL+       A +    L  ++E L+S++G  YY +C +NPI+Y++MS ++R  F +++
Sbjct:   47 NCSPKEFVAFVLGPQTLPLYKAVLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLFGLPTEVFLYWHQYPDLFGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFK-RAIRIITALWIVSFISAIPFGLLSDIQYLNY-----PLDHSRIEESAFCSM--SPKIVNEIPVFEVSFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQQGTNNRE-TRNSQMR-KKTVIRMLAAVVITFFVCWFPFHLQRLIFLY----AKNMDNYL-DINEALFSIAGFAYYVSCTVNPIVYSVMSRRYRVAFRELL 371          
BLAST of GCR044 vs. Ensembl Fly
Match: PK2-R2 (gene:FBgn0038139 transcript:FBtr0082773)

HSP 1 Score: 169.474 bits (428), Expect = 2.788e-46
Identity = 125/343 (36.44%), Postives = 179/343 (52.19%), Query Frame = 3
Query:   42 NLTDKEFISLEQGPQRD----------PINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILW--RVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            N++     SL QG + +          P++LL   +  Y ++   GV GN ITC VI     M T TN+YL NL I+D+ +L  G+ QD Y  W    YPF +  CI++S+LSE     +VLT T FT+ERYIAICHP  + + S    R +K I  IWI + L +LP A+Q              F+  +    T CT ++     + F +S  +FF  P+  + VLY+ IG+ ++ S      Q +    +     + A+   ++ML A+ + FF+C APFHA+RLM      S  +SQ   W   V   L   SG+LY+ +  INP+LYNIMSHKFR  F
Sbjct:   35 NISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSK-LSRAVKFIFAIWIAALLLALPQAIQ--------------FSVVMQGMGTSCT-MKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRL---LQALPRRCYDVNRGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQ---WFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAF 355          
BLAST of GCR044 vs. Ensembl Fly
Match: PK2-R2 (gene:FBgn0038139 transcript:FBtr0082774)

HSP 1 Score: 169.474 bits (428), Expect = 2.788e-46
Identity = 125/343 (36.44%), Postives = 179/343 (52.19%), Query Frame = 3
Query:   42 NLTDKEFISLEQGPQRD----------PINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILW--RVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            N++     SL QG + +          P++LL   +  Y ++   GV GN ITC VI     M T TN+YL NL I+D+ +L  G+ QD Y  W    YPF +  CI++S+LSE     +VLT T FT+ERYIAICHP  + + S    R +K I  IWI + L +LP A+Q              F+  +    T CT ++     + F +S  +FF  P+  + VLY+ IG+ ++ S      Q +    +     + A+   ++ML A+ + FF+C APFHA+RLM      S  +SQ   W   V   L   SG+LY+ +  INP+LYNIMSHKFR  F
Sbjct:   35 NISADNLTSLLQGLEPEELLPTVTPMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSK-LSRAVKFIFAIWIAALLLALPQAIQ--------------FSVVMQGMGTSCT-MKNDFFAHVFAVSGFLFFGGPMTAICVLYVLIGVKLKRSRL---LQALPRRCYDVNRGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGSTSGIESQ---WFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAF 355          
BLAST of GCR044 vs. Ensembl Fly
Match: PK1-R (gene:FBgn0038201 transcript:FBtr0305681)

HSP 1 Score: 144.05 bits (362), Expect = 4.094e-38
Identity = 69/160 (43.12%), Postives = 98/160 (61.25%), Query Frame = 3
Query:   63 ISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQ 542
            +S + GP RDP+ ++IP   +Y ++   GV GN  TC VI   + M T TNYYL +L I+D  +L+ G+ Q+    WS YPY FG + CI + LL+E     +VLT T FT+ERYIAICHP L  + S    R I+II  +WI + + ++P A Q G++ 
Sbjct:    6 MSHDLGPPRDPLAIVIPVTVVYSLIFITGVVGNISTCIVIKKNRSMHTATNYYLFSLAISDFLLLLSGVPQEVSYIWSKYPYVFGEYICIGRGLLAETSANATVLTITAFTVERYIAICHPFLGQAMS-KLSRAIRIIVLVWIMAIVTAIPQAAQFGIEH 164          

HSP 2 Score: 85.1149 bits (209), Expect = 1.236e-17
Identity = 45/106 (42.45%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  759 SAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSL----SGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLS 1064
            S+   R N    R+  ++ML A+V+ FFLC APFHA+RL+    P         L   HEF+Y++    SG+LYY +  INP+LYNIMSHKFR  F  ++  +++S
Sbjct:  268 SSVRGRLNHYGTRRV-LRMLVAVVVCFFLCWAPFHAQRLIAIYAPARGAK----LRDQHEFVYTVMTYVSGVLYYLSTCINPLLYNIMSHKFREAFKAVLFGKKVS 368          
BLAST of GCR044 vs. Ensembl Zebrafish
Match: nmur1a (neuromedin U receptor 1a [Source:ZFIN;Acc:ZDB-GENE-081104-220])

HSP 1 Score: 192.971 bits (489), Expect = 4.858e-57
Identity = 119/362 (32.87%), Postives = 199/362 (54.97%), Query Frame = 3
Query:   57 EFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIRHSV------CRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKI-LWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIIS 1118
            E++    GP+R P+   +P    Y+++  VG  GN +TC VI   KVMRTPTN+YL +L I+DL VL+LG+  + Y  WS+YP+  G  GC  K+LL E     S+L  T  ++ERYIA+ HP L+      R    ++I  +W  S LC++P  +  G+  L            ++ DS  C  ++ + + N  +    + F    ++ +SVLY+ IG+ ++          +    + SS+  + + Q   R+   KML  +V++F +C APFH +RLM + + +   DS+ I ++ V+E+++ +SG+ +Y + AINP+LYN+MS +FR  F +++   +    P+ + SLS  R  + S
Sbjct:    2 EYLEKYLGPRRSPV--FLPVCLTYLLIFLVGAVGNILTCIVIAKNKVMRTPTNFYLFSLAISDLLVLLLGMPLELYEMWSNYPFLLGKGGCYFKTLLFETVCFASILNVTALSVERYIAVIHP-LRAKYVVTRTHAKRLILSVWSISVLCAIPNTILHGIFTLPPPKGK---AAGVMLDSATCMLVKPRWMYNLIIQITTLLFFLLPMLTISVLYLLIGMQLKREKMLQVLEAKASSGLDSSSNVRSQQQKTRRQQVTKMLFVLVVMFGICWAPFHTDRLMWSFMDQK--DSEHIEIFEVYEYVHVISGVFFYLSSAINPVLYNLMSTRFREMFKEVMCHHKWRPVPR-KRSLSMTRVTVRS 354          
BLAST of GCR044 vs. Ensembl Zebrafish
Match: nmur3 (neuromedin U receptor 3 [Source:ZFIN;Acc:ZDB-GENE-130530-567])

HSP 1 Score: 187.963 bits (476), Expect = 8.981e-55
Identity = 120/358 (33.52%), Postives = 188/358 (52.51%), Query Frame = 3
Query:   78 GPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXM-SVLYMRIGLTIRHSVCRGEQQIISSAEHKRRN-------QMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKEP 1127
            GP+R P     P    Y+++   GV GN +TC VI   + M+TPTN YL +L I+DL VL+ G+  + Y  W +YP+PFG   C  K  L E     SVL  T  ++ERYIA+ HP LK   +   +   ++IA +W  S LC++P     GLQ          +    +++S  C  ++ K + N  +    + F    ++M SVLY+ IGLT+     RG++Q          N         R R+   KM   +V++F +C APFH +RL+ + I  ++W     +  + E+++ +SG+L+Y + A+NPI+YN++S +FR  F  +V C RLS+      S+    + II K+P
Sbjct:   50 GPRRSP--FFFPVTCTYILIFMTGVLGNLLTCAVITKDRKMQTPTNLYLFSLAISDLLVLLFGMPLEIYELWQNYPFPFGESICCFKIFLFETVCFASVLNVTVLSVERYIAVIHP-LKTRYAITNKHARRVIAGVWAMSLLCAVPNTSLHGLQY--------QYLPERVQESATCNLLKPKWMYNLVIQITTVLFYFVPMMMISVLYLMIGLTLG----RGQKQKKDKLGSNHSNDSWKIHLDSRRRRQVTKMHFVVVLVFAICWAPFHIDRLLWSFI--TSWTDH--MHNIFEYVHIISGVLFYLSSAVNPIIYNLLSSRFRERFQALV-CSRLSTRSSRNDSMP---FYIIPKDP 384          
BLAST of GCR044 vs. Ensembl Zebrafish
Match: nmur3 (neuromedin U receptor 3 [Source:ZFIN;Acc:ZDB-GENE-130530-567])

HSP 1 Score: 187.963 bits (476), Expect = 1.711e-54
Identity = 120/358 (33.52%), Postives = 188/358 (52.51%), Query Frame = 3
Query:   78 GPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXM-SVLYMRIGLTIRHSVCRGEQQIISSAEHKRRN-------QMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKEP 1127
            GP+R P     P    Y+++   GV GN +TC VI   + M+TPTN YL +L I+DL VL+ G+  + Y  W +YP+PFG   C  K  L E     SVL  T  ++ERYIA+ HP LK   +   +   ++IA +W  S LC++P     GLQ          +    +++S  C  ++ K + N  +    + F    ++M SVLY+ IGLT+     RG++Q          N         R R+   KM   +V++F +C APFH +RL+ + I  ++W     +  + E+++ +SG+L+Y + A+NPI+YN++S +FR  F  +V C RLS+      S+    + II K+P
Sbjct:   82 GPRRSP--FFFPVTCTYILIFMTGVLGNLLTCAVITKDRKMQTPTNLYLFSLAISDLLVLLFGMPLEIYELWQNYPFPFGESICCFKIFLFETVCFASVLNVTVLSVERYIAVIHP-LKTRYAITNKHARRVIAGVWAMSLLCAVPNTSLHGLQY--------QYLPERVQESATCNLLKPKWMYNLVIQITTVLFYFVPMMMISVLYLMIGLTLG----RGQKQKKDKLGSNHSNDSWKIHLDSRRRRQVTKMHFVVVLVFAICWAPFHIDRLLWSFI--TSWTDH--MHNIFEYVHIISGVLFYLSSAVNPIIYNLLSSRFRERFQALV-CSRLSTRSSRNDSMP---FYIIPKDP 416          
BLAST of GCR044 vs. Ensembl Zebrafish
Match: nmur1b (neuromedin U receptor 1b [Source:ZFIN;Acc:ZDB-GENE-131121-154])

HSP 1 Score: 171.785 bits (434), Expect = 1.257e-48
Identity = 118/336 (35.12%), Postives = 180/336 (53.57%), Query Frame = 3
Query:   45 LTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTI-RHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV 1046
            L+   ++    GP R P    +P    Y+++  VGV GN +TC VI   ++MRT TNYYL +L I+DL VL+LGL  + Y  WS+YP+ FG  GC  K+ L E     SVL  T  + ERY AI HPL     + +     ++I  +W  S LC+LP     G++ LK     T        +S VCT +  + + N  +    + F    ++ +SVLY+ IGL + R   C   + +++       NQ    +   KML A+VI+F +C APFH +R+M + I +   ++  I     E+++ LSG+ +Y +  +NPILYN+MS +FR  F ++V
Sbjct:   41 LSRSAYLEKYLGPCRSP--FFLPICVTYLLIFVVGVVGNILTCIVITRHRIMRTTTNYYLFSLAISDLLVLLLGLPLELYELWSNYPFLFGISGCYFKTCLFETVCFASVLNVTALSAERYRAIIHPLHTKHVATSAHAK-RVILVLWAVSLLCALPNTSIHGVEMLKPRFGLT------FPESGVCTVVHDRWIYNLLVQVTALLFFILPMLTISVLYVLIGLQLHRERECFDSKIVLN---QDGVNQRARHRQVTKMLCALVIVFGICWAPFHIDRVMWSYIDDWTAENHHIF----EYVHLLSGVFFYLSSVVNPILYNLMSSRFREMFREVV 360          
BLAST of GCR044 vs. Ensembl Zebrafish
Match: ghsra (growth hormone secretagogue receptor a [Source:ZFIN;Acc:ZDB-GENE-070912-238])

HSP 1 Score: 142.51 bits (358), Expect = 4.585e-38
Identity = 108/346 (31.21%), Postives = 167/346 (48.27%), Query Frame = 3
Query:   33 YKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIE---QKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRL 1061
            + DN T   +  +EQ     PI +L       V+  FVGV GN +T  V+  +K MRT TN YL ++  +DL ++ L +  D Y  W + P+ FGN  C +   +SE    +++L  T  ++ERY AIC P L+      + R   +I  +WI SF  + P+ + +G++     +S          D+  C   E   +  L    +    IFF  P+  ++VLY  IG   R    R  + I  +A  + ++     +  VKMLA +V  F LC  PFH  R    LI +S      ++  +  +   +S +L+Y + AINPILYNIMS K+R   C +   R +
Sbjct:   16 WDDNAT---YWGIEQPVNIFPIPVLTGVTVTCVLFFFVGVTGNLMTILVVTKYKDMRTTTNLYLSSMAFSDL-LIFLCMPLDLYRIWRYRPWNFGNILCKLFQFVSECCTYSTILNITALSVERYFAICFP-LRAKVVVTKGRVRGVILVLWIVSFFSAGPVFVLVGVEHENGTNS---------WDTNECKATEYAIRSGLLTIMVWVSSIFFFLPVFCLTVLYSLIG---RKLWKRKRETIGENASSRDKSN----RQTVKMLAVVVFAFVLCWLPFHVGRY---LISKSTEMGSPVMSIISHYCNLISFVLFYLSAAINPILYNIMSKKYRMAACKLFGLRNI 337          
BLAST of GCR044 vs. Ensembl Xenopus
Match: cdk16 (cyclin-dependent kinase 16 [Source:Xenbase;Acc:XB-GENE-5856779])

HSP 1 Score: 189.119 bits (479), Expect = 4.660e-55
Identity = 124/355 (34.93%), Postives = 192/355 (54.08%), Query Frame = 3
Query:   36 KD-NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRA------RKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV---KCRRLSS 1067
            KD N+T +E +    GP+R       P   IY+ +  VG  GN +TC VI+  K+MRTPTNYYLL+L I+DL VL+LG+  + Y  WS+YP+ FG  GC  K+LL E     S+L  T  ++ERYIA+ HP L+      R    ++I  +W+ S LCS+P     G+  L+           ++  S  CT +  + + N  +    IFF    +  +SVLY+ IGL ++        +  S  E      +R       R+   KML  +V++F +C APFH ERLM + I     D  +++ ++  F++ +SG+L+Y +  +NPILYN++S +FR  F +++   + +RL S
Sbjct:    6 KDCNMTMEELLFKYLGPRRS--TYFTPICIIYLFIFAVGAVGNTLTCIVIIKHKIMRTPTNYYLLSLAISDLLVLLLGMPLELYELWSNYPFVFGQSGCSFKTLLFETVCFASILNVTALSVERYIAVVHP-LRAKYVVTRNHAKRVIFSVWVISILCSIPNTSLNGILHLRVLGIG------IVPGSATCTVVRPRWIYNLIIQITTIFFFFLPMGTISVLYLLIGLQLKKEKMLQVLETKSGKEGDGYQNVRLQQEKIRRRQVTKMLFILVVVFGICWAPFHTERLMWSFIN----DWTEVMHQIFSFVHVISGVLFYLSSVVNPILYNLLSTRFREMFKEVMCHGRTKRLGS 347          
BLAST of GCR044 vs. Ensembl Xenopus
Match: cdk16 (cyclin-dependent kinase 16 [Source:Xenbase;Acc:XB-GENE-5856779])

HSP 1 Score: 188.734 bits (478), Expect = 7.649e-55
Identity = 123/358 (34.36%), Postives = 192/358 (53.63%), Query Frame = 3
Query:   24 YEMYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRA------RKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV---KCRRLSS 1067
            + M   N+T +E +    GP+R       P   IY+ +  VG  GN +TC VI+  K+MRTPTNYYLL+L I+DL VL+LG+  + Y  WS+YP+ FG  GC  K+LL E     S+L  T  ++ERYIA+ HP L+      R    ++I  +W+ S LCS+P     G+  L+           ++  S  CT +  + + N  +    IFF    +  +SVLY+ IGL ++        +  S  E      +R       R+   KML  +V++F +C APFH ERLM + I     D  +++ ++  F++ +SG+L+Y +  +NPILYN++S +FR  F +++   + +RL S
Sbjct:   14 HGMTDCNMTMEELLFKYLGPRRS--TYFTPICIIYLFIFAVGAVGNTLTCIVIIKHKIMRTPTNYYLLSLAISDLLVLLLGMPLELYELWSNYPFVFGQSGCSFKTLLFETVCFASILNVTALSVERYIAVVHP-LRAKYVVTRNHAKRVIFSVWVISILCSIPNTSLNGILHLRVLGIG------IVPGSATCTVVRPRWIYNLIIQITTIFFFFLPMGTISVLYLLIGLQLKKEKMLQVLETKSGKEGDGYQNVRLQQEKIRRRQVTKMLFILVVVFGICWAPFHTERLMWSFIN----DWTEVMHQIFSFVHVISGVLFYLSSVVNPILYNLLSTRFREMFKEVMCHGRTKRLGS 358          
BLAST of GCR044 vs. Ensembl Xenopus
Match: cdk16 (cyclin-dependent kinase 16 [Source:Xenbase;Acc:XB-GENE-5856779])

HSP 1 Score: 187.578 bits (475), Expect = 1.314e-54
Identity = 120/346 (34.68%), Postives = 189/346 (54.62%), Query Frame = 3
Query:   42 NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV---KCRRLSS 1067
            N+T +E +    GP+R       P   IY+ +  VG  GN +TC VI+  K+MRTPTNYYLL+L I+DL VL+LG+  + Y  WS+YP+ FG  GC  K+LL E     S+L  T  ++ERYIA+ HP L+      R    ++I  +W+ S LCS+P     G+  L+           ++  S  CT +  + + N  +    IFF    +  +SVLY+ IGL ++      +++I              R+   KML  +V++F +C APFH ERLM + I     D  +++ ++  F++ +SG+L+Y +  +NPILYN++S +FR  F +++   + +RL S
Sbjct:   15 NMTMEELLFKYLGPRRS--TYFTPICIIYLFIFAVGAVGNTLTCIVIIKHKIMRTPTNYYLLSLAISDLLVLLLGMPLELYELWSNYPFVFGQSGCSFKTLLFETVCFASILNVTALSVERYIAVVHP-LRAKYVVTRNHAKRVIFSVWVISILCSIPNTSLNGILHLRVLGIG------IVPGSATCTVVRPRWIYNLIIQITTIFFFFLPMGTISVLYLLIGLQLKKEKMLQQEKI-------------RRRQVTKMLFILVVVFGICWAPFHTERLMWSFIN----DWTEVMHQIFSFVHVISGVLFYLSSVVNPILYNLLSTRFREMFKEVMCHGRTKRLGS 334          
BLAST of GCR044 vs. Ensembl Xenopus
Match: cdk16 (cyclin-dependent kinase 16 [Source:Xenbase;Acc:XB-GENE-5856779])

HSP 1 Score: 187.963 bits (476), Expect = 1.405e-54
Identity = 122/352 (34.66%), Postives = 190/352 (53.98%), Query Frame = 3
Query:   42 NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRA------RKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV---KCRRLSS 1067
            N+T +E +    GP+R       P   IY+ +  VG  GN +TC VI+  K+MRTPTNYYLL+L I+DL VL+LG+  + Y  WS+YP+ FG  GC  K+LL E     S+L  T  ++ERYIA+ HP L+      R    ++I  +W+ S LCS+P     G+  L+           ++  S  CT +  + + N  +    IFF    +  +SVLY+ IGL ++        +  S  E      +R       R+   KML  +V++F +C APFH ERLM + I     D  +++ ++  F++ +SG+L+Y +  +NPILYN++S +FR  F +++   + +RL S
Sbjct:   22 NMTMEELLFKYLGPRRS--TYFTPICIIYLFIFAVGAVGNTLTCIVIIKHKIMRTPTNYYLLSLAISDLLVLLLGMPLELYELWSNYPFVFGQSGCSFKTLLFETVCFASILNVTALSVERYIAVVHP-LRAKYVVTRNHAKRVIFSVWVISILCSIPNTSLNGILHLRV------LGIGIVPGSATCTVVRPRWIYNLIIQITTIFFFFLPMGTISVLYLLIGLQLKKEKMLQVLETKSGKEGDGYQNVRLQQEKIRRRQVTKMLFILVVVFGICWAPFHTERLMWSFIN----DWTEVMHQIFSFVHVISGVLFYLSSVVNPILYNLLSTRFREMFKEVMCHGRTKRLGS 360          
BLAST of GCR044 vs. Ensembl Xenopus
Match: cdk16 (cyclin-dependent kinase 16 [Source:Xenbase;Acc:XB-GENE-5856779])

HSP 1 Score: 188.348 bits (477), Expect = 1.570e-54
Identity = 122/352 (34.66%), Postives = 190/352 (53.98%), Query Frame = 3
Query:   42 NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRA------RKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV---KCRRLSS 1067
            N+T +E +    GP+R       P   IY+ +  VG  GN +TC VI+  K+MRTPTNYYLL+L I+DL VL+LG+  + Y  WS+YP+ FG  GC  K+LL E     S+L  T  ++ERYIA+ HP L+      R    ++I  +W+ S LCS+P     G+  L+           ++  S  CT +  + + N  +    IFF    +  +SVLY+ IGL ++        +  S  E      +R       R+   KML  +V++F +C APFH ERLM + I     D  +++ ++  F++ +SG+L+Y +  +NPILYN++S +FR  F +++   + +RL S
Sbjct:   32 NMTMEELLFKYLGPRRS--TYFTPICIIYLFIFAVGAVGNTLTCIVIIKHKIMRTPTNYYLLSLAISDLLVLLLGMPLELYELWSNYPFVFGQSGCSFKTLLFETVCFASILNVTALSVERYIAVVHP-LRAKYVVTRNHAKRVIFSVWVISILCSIPNTSLNGILHLRVLGIG------IVPGSATCTVVRPRWIYNLIIQITTIFFFFLPMGTISVLYLLIGLQLKKEKMLQVLETKSGKEGDGYQNVRLQQEKIRRRQVTKMLFILVVVFGICWAPFHTERLMWSFIN----DWTEVMHQIFSFVHVISGVLFYLSSVVNPILYNLLSTRFREMFKEVMCHGRTKRLGS 370          
BLAST of GCR044 vs. Ensembl Mouse
Match: Nmur2 (neuromedin U receptor 2 [Source:MGI Symbol;Acc:MGI:2441765])

HSP 1 Score: 169.859 bits (429), Expect = 7.306e-48
Identity = 113/337 (33.53%), Postives = 184/337 (54.60%), Query Frame = 3
Query:   48 TDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQ-QLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXM-SVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMR-ARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVK 1049
            + +E+++   GP+R   +L +P + +Y ++  VGV GN + C VI   + ++TPTNYYL +L ++DL VL+LG+  + Y  W +YP+ FG  GC  K+ L E     S+L+ T  +IERY+AI HP     ES  R+R ++I++ +W  S + SLP     G++ Q   N SS       +  S  CT  +   + N  + +    F    + + SVLY  +GL ++    R E      A+    N  R +RK+  KML  +V++F +C  PFH +RL  + + E  W     L  V   ++ +SG+ +Y + A+NPI+YN++S +FR  F ++V 
Sbjct:   20 STEEYLAYLCGPKRS--DLSLPVSVVYALIFVVGVIGNLLVCLVIARHQTLKTPTNYYLFSLAVSDLLVLLLGMPLEVYELWHNYPFLFGPVGCYFKTALFETVCFASILSVTTVSIERYVAIVHPFRAKLES-TRRRALRILSLVWSFSVVFSLPNTSIHGIKFQQFPNGSS-------VPGSATCTVTKPIWVYNFIIQATSFLFYILPMTLISVLYYLMGLRLK----RDESL---EADKVTVNIHRPSRKSVTKMLFVLVLVFAICWTPFHVDRLFFSFVDE--WTES--LAAVFNLIHVVSGVFFYLSSAVNPIIYNLLSRRFRAAFRNVVS 335          
BLAST of GCR044 vs. Ensembl Mouse
Match: Nmur1 (neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI:1341898])

HSP 1 Score: 167.548 bits (423), Expect = 9.044e-47
Identity = 114/346 (32.95%), Postives = 181/346 (52.31%), Query Frame = 3
Query:   24 YEMYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXX-XXXXXMSVLYMRIGLTIRHSV------CRGEQQIISSAEHKRRNQM--RARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            Y+    NLTD+       GPQ+  +   +P    Y+++  VG  GN +TC VIL  K MRTPTN+YL +L ++D+ VL++GL  + Y    +YP+  G   C  + LL E     SVL  T  ++ERY+A+  P L+      R    +++  IW+ + L SLP     GL QL      T   +  + DS +C+ +         +++  + F   P++ +SVLY+ IGL +R          +G +   +     RR Q+  R R+   KML A+V++F +C APFHA+R+M +L+      S + L   ++ ++  SGI +Y   A NP+LY++MS +FR  F
Sbjct:   35 YQPEDLNLTDEALRLKYLGPQQ--MKQFVPICVTYLLIFVVGTLGNGLTCTVILRNKTMRTPTNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPFQLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRP-LQAKSVMTRAHVRRMVGAIWVLATLFSLPNTSLHGLSQL------TVPCRGPVPDSAICSLVGPMDFYKLVVLTTALLFFCLPMVTISVLYLLIGLRLRRERMLLQVEVKGRKTAATQETSHRRIQLQDRGRRQVTKMLFALVVVFGICWAPFHADRIMWSLV---YGHSTEGLHLAYQCVHIASGIFFYLGSAANPVLYSLMSTRFRETF 368          
BLAST of GCR044 vs. Ensembl Mouse
Match: Nmur1 (neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI:1341898])

HSP 1 Score: 167.162 bits (422), Expect = 9.343e-47
Identity = 114/346 (32.95%), Postives = 181/346 (52.31%), Query Frame = 3
Query:   24 YEMYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXX-XXXXXMSVLYMRIGLTIRHSV------CRGEQQIISSAEHKRRNQM--RARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            Y+    NLTD+       GPQ+  +   +P    Y+++  VG  GN +TC VIL  K MRTPTN+YL +L ++D+ VL++GL  + Y    +YP+  G   C  + LL E     SVL  T  ++ERY+A+  P L+      R    +++  IW+ + L SLP     GL QL      T   +  + DS +C+ +         +++  + F   P++ +SVLY+ IGL +R          +G +   +     RR Q+  R R+   KML A+V++F +C APFHA+R+M +L+      S + L   ++ ++  SGI +Y   A NP+LY++MS +FR  F
Sbjct:   12 YQPEDLNLTDEALRLKYLGPQQ--MKQFVPICVTYLLIFVVGTLGNGLTCTVILRNKTMRTPTNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPFQLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRP-LQAKSVMTRAHVRRMVGAIWVLATLFSLPNTSLHGLSQL------TVPCRGPVPDSAICSLVGPMDFYKLVVLTTALLFFCLPMVTISVLYLLIGLRLRRERMLLQVEVKGRKTAATQETSHRRIQLQDRGRRQVTKMLFALVVVFGICWAPFHADRIMWSLV---YGHSTEGLHLAYQCVHIASGIFFYLGSAANPVLYSLMSTRFRETF 345          
BLAST of GCR044 vs. Ensembl Mouse
Match: Nmur1 (neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI:1341898])

HSP 1 Score: 159.844 bits (403), Expect = 2.082e-44
Identity = 106/318 (33.33%), Postives = 169/318 (53.14%), Query Frame = 3
Query:  108 IPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXX-XXXXXMSVLYMRIGLTIRHSV------CRGEQQIISSAEHKRRNQM--RARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            +P    Y+++  VG  GN +TC VIL  K MRTPTN+YL +L ++D+ VL++GL  + Y    +YP+  G   C  + LL E     SVL  T  ++ERY+A+  P L+      R    +++  IW+ + L SLP     GL QL      T   +  + DS +C+ +         +++  + F   P++ +SVLY+ IGL +R          +G +   +     RR Q+  R R+   KML A+V++F +C APFHA+R+M +L+      S + L   ++ ++  SGI +Y   A NP+LY++MS +FR  F
Sbjct:    5 VPICVTYLLIFVVGTLGNGLTCTVILRNKTMRTPTNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPFQLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRP-LQAKSVMTRAHVRRMVGAIWVLATLFSLPNTSLHGLSQL------TVPCRGPVPDSAICSLVGPMDFYKLVVLTTALLFFCLPMVTISVLYLLIGLRLRRERMLLQVEVKGRKTAATQETSHRRIQLQDRGRRQVTKMLFALVVVFGICWAPFHADRIMWSLV---YGHSTEGLHLAYQCVHIASGIFFYLGSAANPVLYSLMSTRFRETF 312          
BLAST of GCR044 vs. Ensembl Mouse
Match: Ghsr (growth hormone secretagogue receptor [Source:MGI Symbol;Acc:MGI:2441906])

HSP 1 Score: 125.561 bits (314), Expect = 7.617e-32
Identity = 95/302 (31.46%), Postives = 148/302 (49.01%), Query Frame = 3
Query:  129 VVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIE---QKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFR 1025
            V L  VG+ GN +T  V+  F+ +RT TN YL ++  +DL ++ L +  D    W + P+ FG+  C +   +SE     +VLT T  ++ERY AIC P L+      + R   +I  IW  +F  + P+ + +G++     D           D+  C   E   +  L    +    +FF  P+  ++VLY  IG  +     RG+  + SS   +   Q       VKMLA +V  F LC  PFH  R + +   E    S +I  ++ ++   +S +L+Y + AINPILYNIMS K+R
Sbjct:   50 VALFVVGISGNLLTMLVVSRFRELRTTTNLYLSSMAFSDL-LIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFP-LRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHENGTDP---------RDTNECRATEFAVRSGLLTVMVWVSSVFFFLPVFCLTVLYSLIGRKLWRR--RGDAAVGSSLRDQNHKQ------TVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPG--SLEIA-QISQYCNLVSFVLFYLSAAINPILYNIMSKKYR 329          
BLAST of GCR044 vs. UniProt/SwissProt
Match: sp|Q9GZQ4|NMUR2_HUMAN (Neuromedin-U receptor 2 OS=Homo sapiens OX=9606 GN=NMUR2 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 6.343e-48
Identity = 108/334 (32.34%), Postives = 182/334 (54.49%), Query Frame = 3
Query:   48 TDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV 1046
            + +E+++   GP+R   +  +P + +YV +  VGV GN + C VIL  + M+TPTNYYL +L ++DL VL+LG+  + Y  W +YP+ FG  GC  K+ L E     S+L+ T  ++ERY+AI HP     +S  R+R ++I+  +W  S L SLP     G++     + S      L+  S  CT I+   + N  +      F    + ++SVLY  + L ++      + + + + E     Q   RK+  KML  +V++F +C APFH +RL  + + E  W     L  V   ++ +SG+ +Y + A+NPI+YN++S +F+  F +++
Sbjct:   28 STEEYLAFLCGPRRS--HFFLPVSVVYVPIFVVGVIGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCYFKTALFETVCFASILSITTVSVERYVAILHPFRAKLQS-TRRRALRILGIVWGFSVLFSLPNTSIHGIKFHYFPNGS------LVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMALRLK------KDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEE--WSES--LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVI 342          
BLAST of GCR044 vs. UniProt/SwissProt
Match: sp|Q8BZ39|NMUR2_MOUSE (Neuromedin-U receptor 2 OS=Mus musculus OX=10090 GN=Nmur2 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 5.110e-47
Identity = 113/337 (33.53%), Postives = 184/337 (54.60%), Query Frame = 3
Query:   48 TDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQ-QLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXM-SVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMR-ARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVK 1049
            + +E+++   GP+R   +L +P + +Y ++  VGV GN + C VI   + ++TPTNYYL +L ++DL VL+LG+  + Y  W +YP+ FG  GC  K+ L E     S+L+ T  +IERY+AI HP     ES  R+R ++I++ +W  S + SLP     G++ Q   N SS       +  S  CT  +   + N  + +    F    + + SVLY  +GL ++    R E      A+    N  R +RK+  KML  +V++F +C  PFH +RL  + + E  W     L  V   ++ +SG+ +Y + A+NPI+YN++S +FR  F ++V 
Sbjct:   20 STEEYLAYLCGPKRS--DLSLPVSVVYALIFVVGVIGNLLVCLVIARHQTLKTPTNYYLFSLAVSDLLVLLLGMPLEVYELWHNYPFLFGPVGCYFKTALFETVCFASILSVTTVSIERYVAIVHPFRAKLES-TRRRALRILSLVWSFSVVFSLPNTSIHGIKFQQFPNGSS-------VPGSATCTVTKPIWVYNFIIQATSFLFYILPMTLISVLYYLMGLRLK----RDESL---EADKVTVNIHRPSRKSVTKMLFVLVLVFAICWTPFHVDRLFFSFVDE--WTES--LAAVFNLIHVVSGVFFYLSSAVNPIIYNLLSRRFRAAFRNVVS 335          
BLAST of GCR044 vs. UniProt/SwissProt
Match: sp|Q8ITC7|CAPAR_DROME (Neuropeptides capa receptor OS=Drosophila melanogaster OX=7227 GN=CapaR PE=2 SV=3)

HSP 1 Score: 171.4 bits (433), Expect = 6.293e-47
Identity = 115/340 (33.82%), Postives = 183/340 (53.82%), Query Frame = 3
Query:   42 NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXM---SVLYMRIGLTIRHSVCR--GEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV 1046
            N + KEF++   GPQ  P+   +    I+  +   GV GN + C VI+    M T TNYYL +L ++DL  L+ GL  + +L W  YP  FG   C +++ +SE     SV T   F++ER++AICHPL   +    + R I+II  +WI SF+ ++P  L   +Q L             +E+S  C+      + N   +  + F +  +I M    +LY R+G  IR    +  G QQ  ++ E  R +QMR +K  ++MLAA+VI FF+C  PFH +RL+       A +    L  ++E L+S++G  YY +C +NPI+Y++MS ++R  F +++
Sbjct:   47 NCSPKEFVAFVLGPQTLPLYKAVLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLFGLPTEVFLYWHQYPDLFGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFK-RAIRIITALWIVSFISAIPFGLLSDIQYLNY-----PLDHSRIEESAFCSM--SPKIVNEIPVFEVSFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQQGTNNRE-TRNSQMR-KKTVIRMLAAVVITFFVCWFPFHLQRLIFLY----AKNMDNYL-DINEALFSIAGFAYYVSCTVNPIVYSVMSRRYRVAFRELL 371          
BLAST of GCR044 vs. UniProt/SwissProt
Match: sp|Q9ESQ4|NMUR2_RAT (Neuromedin-U receptor 2 OS=Rattus norvegicus OX=10116 GN=Nmur2 PE=1 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 1.572e-46
Identity = 107/336 (31.85%), Postives = 181/336 (53.87%), Query Frame = 3
Query:   48 TDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQ-QLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXM-SVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVK 1049
            + +E+++   GP+R   +L +P +  Y ++  VGV GN + C VI+  + ++TPTNYYL +L ++DL VL+LG+  + Y  W +YP+ FG  GC  K+ L E     S+L+ T  ++ERY+AI HP     ES  R+R ++I++ +W  S + SLP     G++ Q   N SS       +  S  CT  +   + N  + +    F    + + SVLY  +GL ++        ++  +          +RK+  KML  +V++F +C  PFH +RL  + + E  W     L  V   ++ +SG+ +Y + A+NPI+YN++S +FR  F ++V 
Sbjct:   20 STEEYLAHLCGPKRS--DLSLPVSVAYALIFLVGVMGNLLVCMVIVRHQTLKTPTNYYLFSLAVSDLLVLLLGMPLEIYEMWHNYPFLFGPVGCYFKTALFETVCFASILSVTTVSVERYVAIVHPFRAKLES-TRRRALRILSLVWSFSVVFSLPNTSIHGIKFQHFPNGSS-------VPGSATCTVTKPMWVYNLIIQATSFLFYILPMTLISVLYYLMGLRLKRDESLEANKVAVNIHRP------SRKSVTKMLFVLVLVFAICWTPFHVDRLFFSFVEE--WTES--LAAVFNLIHVVSGVFFYLSSAVNPIIYNLLSRRFRAAFRNVVS 335          
BLAST of GCR044 vs. UniProt/SwissProt
Match: sp|O55040|NMUR1_MOUSE (Neuromedin-U receptor 1 OS=Mus musculus OX=10090 GN=Nmur1 PE=2 SV=2)

HSP 1 Score: 167.548 bits (423), Expect = 6.327e-46
Identity = 114/346 (32.95%), Postives = 181/346 (52.31%), Query Frame = 3
Query:   24 YEMYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXX-XXXXXMSVLYMRIGLTIRHSV------CRGEQQIISSAEHKRRNQM--RARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            Y+    NLTD+       GPQ+  +   +P    Y+++  VG  GN +TC VIL  K MRTPTN+YL +L ++D+ VL++GL  + Y    +YP+  G   C  + LL E     SVL  T  ++ERY+A+  P L+      R    +++  IW+ + L SLP     GL QL      T   +  + DS +C+ +         +++  + F   P++ +SVLY+ IGL +R          +G +   +     RR Q+  R R+   KML A+V++F +C APFHA+R+M +L+      S + L   ++ ++  SGI +Y   A NP+LY++MS +FR  F
Sbjct:   35 YQPEDLNLTDEALRLKYLGPQQ--MKQFVPICVTYLLIFVVGTLGNGLTCTVILRNKTMRTPTNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPFQLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRP-LQAKSVMTRAHVRRMVGAIWVLATLFSLPNTSLHGLSQL------TVPCRGPVPDSAICSLVGPMDFYKLVVLTTALLFFCLPMVTISVLYLLIGLRLRRERMLLQVEVKGRKTAATQETSHRRIQLQDRGRRQVTKMLFALVVVFGICWAPFHADRIMWSLV---YGHSTEGLHLAYQCVHIASGIFFYLGSAANPVLYSLMSTRFRETF 368          
BLAST of GCR044 vs. TrEMBL
Match: A0A193KUI4 (GCR044 OS=Schmidtea mediterranea OX=79327 GN=gcr044 PE=2 SV=1)

HSP 1 Score: 847.81 bits (2189), Expect = 0.000e+0
Identity = 425/425 (100.00%), Postives = 425/425 (100.00%), Query Frame = 3
Query:   21 MYEMYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKEPLKQSSIKKCQYIFSQNRSEDRPERSECCFCVPKYDNREHYQDSVDAFNVTINSIHD 1295
            MYEMYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSFLISFIIFFLTPLILMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKEPLKQSSIKKCQYIFSQNRSEDRPERSECCFCVPKYDNREHYQDSVDAFNVTINSIHD
Sbjct:    1 MYEMYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSFLISFIIFFLTPLILMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKEPLKQSSIKKCQYIFSQNRSEDRPERSECCFCVPKYDNREHYQDSVDAFNVTINSIHD 425          
BLAST of GCR044 vs. TrEMBL
Match: A0A193KUB1 (GCR092 OS=Schmidtea mediterranea OX=79327 GN=gcr092 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 5.942e-82
Identity = 149/347 (42.94%), Postives = 217/347 (62.54%), Query Frame = 3
Query:   36 KDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLL-------KPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEH--KRRNQ-MRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIV 1046
            K NL+D E+++ + GP RD + LLIP N IY ++  +G+ GN  TC VI   K M++PTN+YLLNL + DL +LI+ L QD Y  W HYPYPFG+  C +KS + E+ +CTSVLT   FT+ERY AIC P          P++    +RT KII  +W+ SF+ +LPL+LQ+ +  L RNDS+TN+   +L  S  CT  +  +     ++S I+ F+ PL ++ ++Y  IG+ IR S+ +       S EH     NQ +RARKA +K+L A+VI+FF+C  P ++ RLMV +IP   W  +  L+++H  ++ +SGIL++ N  INPILYN+ S KFR     I+
Sbjct:    2 KTNLSDSEYLNQKMGPPRDNLFLLIPLNIIYSIIFVLGILGNTATCLVISRVKFMQSPTNFYLLNLSVTDLLILIIILPQDLYQFWVHYPYPFGHTICFLKSYIGEICVCTSVLTVIAFTVERYCAICQPHRCSQAVSGSPNDVQGIKRTFKIIILLWLISFIVTLPLSLQIDIDILTRNDSTTNYKTTILPTSAQCTFYDSVSAKYLSILSTILLFVLPLAVIIIMYTMIGIVIRKSMLQRRHS--HSIEHFYDVNNQTVRARKAILKILIAVVIVFFVCFLPHNSLRLMVAMIPNDKWTPR--LYQLHNIMFYVSGILFFLNSVINPILYNVFSLKFRKALQKII 344          
BLAST of GCR044 vs. TrEMBL
Match: A1X4Q3 (Capa receptor-like GPCR OS=Apis mellifera OX=7460 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 6.776e-69
Identity = 132/348 (37.93%), Postives = 209/348 (60.06%), Query Frame = 3
Query:   24 YEMYKD----NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCR 1055
            Y+ +K+    NLT+ E+++   GP+   + ++IP   IY+++   G+FGN  TC VI+    M+T TNYYL +L I+DL +L+LGL  +  L W  YP+  G   C +++ +SEM    SVLT   F++ERY+AICHP L+    +  +R I+ I   W+ + + ++P A+   +  ++    S N++     DS +C  +   A    + +S IIFFL P++++ V+Y R+GL IR+S       ++  A H    Q+++RK+ +KML+A+VILFF+C APFH +RL+     ES +        ++E+LY LSG LYYF+  INPILYN+MS K+RN F   + C+
Sbjct:    9 YDFWKNWDLKNLTEAEYLAKVLGPKYLSMRMVIPLTIIYMIIFVTGIFGNITTCTVIIKNPAMQTATNYYLFSLAISDLILLVLGLPNELSLFWQQYPWVLGVSLCKIRAYVSEMSSYVSVLTIVAFSMERYLAICHP-LRVYTISGLKRPIRFILAAWLIALISAIPFAIYTKVNLVEYPPESGNYS----ADSAMCAMLTIYADFPLYELSTIIFFLIPMLIILVVYTRMGLKIRNSTKDTLNSVVQGAIHGDSRQIQSRKSVIKMLSAVVILFFICWAPFHTQRLLYVYAQESDYYPD-----LNEWLYILSGCLYYFSTTINPILYNLMSIKYRNAFKQTICCK 346          
BLAST of GCR044 vs. TrEMBL
Match: A0A1B6C172 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Clastoptera arizonana OX=38151 GN=g.4808 PE=3 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 6.466e-66
Identity = 134/334 (40.12%), Postives = 193/334 (57.78%), Query Frame = 3
Query:   42 NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQ---KALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            N+T  EF+    GP+   ++++IP   +YVV+   GV GN   C VI     M T TNYYL +L ++DL++LILGL  D  + W  YP+ FG+  C  ++L+SEM   TSVLT   F++ERY+AICHPL   + S  R R ++IIA +WI SF C+LP A+   +  L    +S NF    + +S  C  +E    K  P   L     F +  L++M VLYMRIG  IR +    +  +     H    + ++RK  ++ML+A+VI FFLC APFH +RL+   +    W+        +E++Y ++G LYYF+  INPILYN+MS K+RN F
Sbjct:    7 NITLDEFLMEMLGPKHLDMSVVIPITVVYVVIFVTGVVGNISVCVVIATNTAMHTATNYYLFSLSVSDLTLLILGLPNDLSVYWEQYPWTFGDGICKCRALVSEMTSYTSVLTIVAFSMERYLAICHPLHSYAMSGLR-RAVRIIAGLWIVSFFCALPFAIFTKVNYLDFPPNSGNF----VNESAFCGMLEHNVPKNFPVYELSFISFFLIPMLMIM-VLYMRIGAQIRDNSLSVDGTV-----HGETRRSQSRKTIIRMLSAVVITFFLCWAPFHVQRLL--YLYGRNWEHFT---EFNEWMYYITGCLYYFSSTINPILYNLMSMKYRNAF 324          
BLAST of GCR044 vs. TrEMBL
Match: A0A2A3ERA9 (Neuropeptides capa receptor OS=Apis cerana cerana OX=94128 GN=APICC_06327 PE=3 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 9.857e-66
Identity = 125/350 (35.71%), Postives = 201/350 (57.43%), Query Frame = 3
Query:   24 YEMYKD----NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVL--YMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCR 1055
            Y+ +K+    NLT+ E+++   GP+   + ++IP   IY+++   G+FGN  TC VI+    M+T TNYYL +L I+DL +L+LGL  +  L W  YP+  G   C +++ +SEM    SVLT   F++ERY+AICHP L+    +  +R I+ I   W  + + ++P A+   +  ++    S N++     DS +C  +    +P+  L          + ++ +L  Y R+GL IR+S       ++  A H    Q+++R++ +KML+A+VILFF+C APFH +RL+     ES +        ++E+LY LSG LYYF+  INPILYN+MS K+RN F   + C+
Sbjct:    9 YDFWKNWDLKNLTETEYLAKVLGPKYLSMRMVIPLTIIYMIIFVTGIFGNITTCIVIIKNPAMQTATNYYLFSLAISDLILLVLGLPNELSLFWQQYPWVLGVSLCKIRAYVSEMSSYVSVLTIVAFSMERYLAICHP-LRVYTISGLKRPIRFILAAWSIALISAIPFAIYTKVNLVEYPPESGNYS----ADSAICAML-LPYMPDFPLYELSTIIFFLIPMLIILVVYTRMGLRIRNSTKDTLNSVVQGAIHGDSRQIQSRRSVIKMLSAVVILFFICWAPFHTQRLLYVYAQESDYYPD-----LNEWLYILSGCLYYFSTTINPILYNLMSIKYRNAFKQTICCK 347          
BLAST of GCR044 vs. Ensembl Cavefish
Match: nmur1a (neuromedin U receptor 1 [Source:NCBI gene;Acc:103024787])

HSP 1 Score: 197.593 bits (501), Expect = 3.042e-58
Identity = 129/387 (33.33%), Postives = 212/387 (54.78%), Query Frame = 3
Query:   45 LTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPN-SXXXXXXXXXXXXXXXMSVLYMRIGLTIRHS-----VCRGEQQIISSAEHKRRNQMRARKAAV-KMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKI-LWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQ---MSLSTKRYMIISKEPLKQSSIKKCQYIFSQ 1172
            L   E++    GP+R P+   +P    Y+++ FVGV GN +TC VI   +VMRTPTN+YL +L ++DL VL+LG+  + Y  WS+YP+  G  GC  K+ L E     S+L  T  ++ERYIA+ HP L+      R    ++I C+W  S +C+LP     G+  L +           L  S  C  ++ + + N +  I+ ++FFL P++ +SVLY+ IGL +R       +   + Q +      R  Q +AR+  V KML  +V++F +C APFH +RLM + + +  W S ++ +++ +E+++ +SG+ +Y + A+NPILYN+MS +FR  F +++        P+ Q   M+  T R ++    P   + I    Y F +
Sbjct:   37 LDPDEYLERYLGPRRSPV--FLPVCITYLLIFFVGVLGNILTCTVITRHRVMRTPTNFYLFSLAVSDLLVLLLGMPLELYELWSNYPFLLGESGCYFKTFLFETVCFASILNVTALSVERYIAVVHP-LRAKYVVTRTHARRVILCVWTISVVCALPNTSLHGIFMLPQPKGRGPGG---LPGSDTCMLVKPRWMYNLTIQITTVVFFLLPMLTLSVLYLLIGLRLRRERMLQMLQATDHQQLDGYSRVRCQQQKARRQQVTKMLFVLVVMFGICWAPFHTDRLMWSFMDQ--WASGQVEIFQAYEYVHVISGVFFYLSSAVNPILYNLMSTRFREMFKEVMCRHPRRPVPRKQSLSMTRVTLRSVVSEVAPGNGAVIADRDYDFYE 415          
BLAST of GCR044 vs. Ensembl Cavefish
Match: nmur1a (neuromedin U receptor 1 [Source:NCBI gene;Acc:103024787])

HSP 1 Score: 197.978 bits (502), Expect = 3.625e-58
Identity = 126/361 (34.90%), Postives = 204/361 (56.51%), Query Frame = 3
Query:   45 LTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPN-SXXXXXXXXXXXXXXXMSVLYMRIGLTIRHS-----VCRGEQQIISSAEHKRRNQMRARKAAV-KMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKI-LWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKR 1103
            L   E++    GP+R P+   +P    Y+++ FVGV GN +TC VI   +VMRTPTN+YL +L ++DL VL+LG+  + Y  WS+YP+  G  GC  K+ L E     S+L  T  ++ERYIA+ HP L+      R    ++I C+W  S +C+LP     G+  L +           L  S  C  ++ + + N +  I+ ++FFL P++ +SVLY+ IGL +R       +   + Q +      R  Q +AR+  V KML  +V++F +C APFH +RLM + + +  W S ++ +++ +E+++ +SG+ +Y + A+NPILYN+MS +FR  F +++ CR        + SLS  R
Sbjct:   47 LDPDEYLERYLGPRRSPV--FLPVCITYLLIFFVGVLGNILTCTVITRHRVMRTPTNFYLFSLAVSDLLVLLLGMPLELYELWSNYPFLLGESGCYFKTFLFETVCFASILNVTALSVERYIAVVHP-LRAKYVVTRTHARRVILCVWTISVVCALPNTSLHGIFMLPQPKGRGPGG---LPGSDTCMLVKPRWMYNLTIQITTVVFFLLPMLTLSVLYLLIGLRLRRERMLQMLQATDHQQLDGYSRVRCQQQKARRQQVTKMLFVLVVMFGICWAPFHTDRLMWSFMDQ--WASGQVEIFQAYEYVHVISGVFFYLSSAVNPILYNLMSTRFREMFKEVM-CRHPRRPVPRKQSLSMTR 398          
BLAST of GCR044 vs. Ensembl Cavefish
Match: nmur3 (neuromedin-U receptor 2-like [Source:NCBI gene;Acc:103035443])

HSP 1 Score: 183.726 bits (465), Expect = 5.606e-53
Identity = 113/347 (32.56%), Postives = 196/347 (56.48%), Query Frame = 3
Query:   78 GPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPN-SXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIIS--SAEHKRRNQMRA--RKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKR 1103
            GP+R P    +P    Y+++   GV GN +TC VI+  + MRTPTN YL +L ++DL VL+ G+  + Y  W +YP+PFG   C  K  L E     SVL  T  ++ERY+A+ HP LK   +   +   K+I  +WI S +C++P     G+             +++LE +T C  ++ + + N    ++ ++F+  P++++  LY+ IG+ +     +  +++    SA+  RR Q+ +  R+   KMLA +V++F +C APFH +RL+ + I  + W  +  ++ V E+++ LSG+L+Y + A+NPI+YN++S +FR  F +++  R   +T +     S KR
Sbjct:   49 GPRRSP--FFLPVTLTYILIFITGVLGNLLTCIVIIKHRKMRTPTNLYLFSLAVSDLLVLLFGMPLEIYELWQNYPFPFGESVCCFKVFLFETVCFASVLNVTVLSVERYVAVVHP-LKTRYALTNKHAQKMIGGVWIVSLVCAVPNTSLHGIHYYY-------LPEKVLESAT-CNLLKPQWIYNLVIQVTTVLFYFVPMMVICGLYLVIGMKLGREQKQQGRKLGRNCSADVSRRVQVESGRRRQVTKMLAVVVLVFAICWAPFHTDRLLWSFI--TQWTDR--MYSVFEYVHILSGVLFYLSSAVNPIIYNLLSSRFRERFLELMCARGDGNTSRNSSPPSYKR 380          
BLAST of GCR044 vs. Ensembl Cavefish
Match: nmur1b (neuromedin-U receptor 1-like [Source:NCBI gene;Acc:103043415])

HSP 1 Score: 166.777 bits (421), Expect = 1.101e-46
Identity = 120/366 (32.79%), Postives = 187/366 (51.09%), Query Frame = 3
Query:   60 FISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRN--------QMRARKAAV-KMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILW-RVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKEP 1127
            ++  E G QR P    +P   +Y+++  VGV GN +TC VI   +VMRTPTNYYL +L ++DL VL+LGL  + Y  WS+YP+  G  GC  K+ L EM    SVL  T  + ERY+A+ HP L+      +    ++I  +W  SF+C+LP     G+  L      T        DS +C  +     P       +        L+ +L + +   +     R E+ I ++ +   ++        Q RA+   V KML  +VI+F +C APFH +R+M + I    W  +   W R+ EF++  SGI +Y +  +NPILYN+MS +FR  F + V C++  +  +  ++  T+R  +  K P
Sbjct:   47 YLEKELGHQRSP--FFLPMCIVYLLIFLVGVVGNALTCIVIARHRVMRTPTNYYLFSLAMSDLLVLVLGLPLEIYELWSNYPFLLGTGGCYFKTCLFEMVCLASVLNVTCLSAERYVAVVHP-LRAKHVVTKTHAKRVILALWTASFICALPNTSLNGVAVLPPRFGQT------FPDSAMCGLVR----PIWIYNLLVQVTALLFFLLPMLTISLLYLLIGLQLRREKLIDNTKDWPGQSRIYIAHSIQQRAKHRQVTKMLVVLVIVFGICWAPFHIDRVMWSYI--YPWTKE---WHRIFEFVHLASGIFFYLSSVVNPILYNLMSSRFREMFRE-VACQK--TYHRSSVTQVTQRSTVYEKTP 391          
BLAST of GCR044 vs. Ensembl Cavefish
Match: nmur1b (neuromedin-U receptor 1-like [Source:NCBI gene;Acc:103043415])

HSP 1 Score: 166.777 bits (421), Expect = 1.101e-46
Identity = 120/366 (32.79%), Postives = 187/366 (51.09%), Query Frame = 3
Query:   60 FISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRN--------QMRARKAAV-KMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILW-RVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKEP 1127
            ++  E G QR P    +P   +Y+++  VGV GN +TC VI   +VMRTPTNYYL +L ++DL VL+LGL  + Y  WS+YP+  G  GC  K+ L EM    SVL  T  + ERY+A+ HP L+      +    ++I  +W  SF+C+LP     G+  L      T        DS +C  +     P       +        L+ +L + +   +     R E+ I ++ +   ++        Q RA+   V KML  +VI+F +C APFH +R+M + I    W  +   W R+ EF++  SGI +Y +  +NPILYN+MS +FR  F + V C++  +  +  ++  T+R  +  K P
Sbjct:   47 YLEKELGHQRSP--FFLPMCIVYLLIFLVGVVGNALTCIVIARHRVMRTPTNYYLFSLAMSDLLVLVLGLPLEIYELWSNYPFLLGTGGCYFKTCLFEMVCLASVLNVTCLSAERYVAVVHP-LRAKHVVTKTHAKRVILALWTASFICALPNTSLNGVAVLPPRFGQT------FPDSAMCGLVR----PIWIYNLLVQVTALLFFLLPMLTISLLYLLIGLQLRREKLIDNTKDWPGQSRIYIAHSIQQRAKHRQVTKMLVVLVIVFGICWAPFHIDRVMWSYI--YPWTKE---WHRIFEFVHLASGIFFYLSSVVNPILYNLMSSRFREMFRE-VACQK--TYHRSSVTQVTQRSTVYEKTP 391          
BLAST of GCR044 vs. Ensembl Sea Lamprey
Match: nmur1a (neuromedin U receptor 1a [Source:ZFIN;Acc:ZDB-GENE-081104-220])

HSP 1 Score: 186.037 bits (471), Expect = 4.331e-55
Identity = 115/346 (33.24%), Postives = 184/346 (53.18%), Query Frame = 3
Query:   45 LTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIRHS-------VCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRR 1058
            +T  + I+   GP+  P    +P   IY+++   GV GN +TC VI   ++MRTPTN+YL +L ++DL VL+LG+  + Y  W +YP  FG  GC  K++L E     SVL  T  ++ERYIA+ HP LK      R    ++IAC+W+ S  CS+P     G+  ++             E+ST+C   + + + N  +    +FF    +  +SVLY+ IG  +R          C G        +  R N+ + R+   KML  +VI+F +C APFH +RL+ + +     DS  +   VH     +SG+ +Y +  +NP++YN++S +FR+ F +++ CRR
Sbjct:   35 MTRGQVITELLGPRTSP--FFVPVLAIYLLIFVTGVVGNFLTCIVISRHRLMRTPTNFYLFSLAVSDLLVLVLGMPLELYEMWENYPSLFGEGGCYFKTMLFETVCFASVLNVTALSVERYIAVVHP-LKARWLVTRTHARRVIACLWVASVCCSVPNTSLHGIHYIRSPLGEP------YEESTICIVTQPRWIYNVVVQLTALFFFLVPMATISVLYLLIGRQLRREKSLAVPHECEGRGTF--GNQRIRTNRSKCRQVT-KMLYVLVIVFGICWAPFHTDRLVWSFVHRWTADSHGMFQCVH----LVSGVFFYLSSVVNPVIYNLLSTRFRDMFREVM-CRR 363          
BLAST of GCR044 vs. Ensembl Sea Lamprey
Match: NMUR2 (neuromedin U receptor 2 [Source:HGNC Symbol;Acc:HGNC:16454])

HSP 1 Score: 105.145 bits (261), Expect = 3.560e-26
Identity = 88/229 (38.43%), Postives = 128/229 (55.90%), Query Frame = 3
Query:   42 NLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHS 728
            NLT  E +  E+G  R   +  +P    Y ++  VGV GN +TC VI   K M+TPTN+YL +L I+DL VL+LG+  + Y  WS+YP+ FG  GC  ++ L E     SVL  T  ++ERY+A+ HPL     S+ R+R +++IA +W+ S L SLP  L   L  L   D S       L++S VCT +          ++  +F++ P+ L+SVLY  +GL  R S
Sbjct:   27 NLTQDELLLRERG--RRQSDFFVPICLTYSLIFAVGVGGNVLTCTVIASRKGMKTPTNFYLFSLAISDLLVLLLGMPLELYEMWSNYPFLFGRLGCYFRTALFETVCFASVLNVTALSLERYVAVVHPLRA-RSSSTRRRAVRVIAALWLLSGLLSLPNTLTHDLNFLVLPDGSP------LDESAVCTVVHFWPYKYIVAVTAFLFYVLPMALISVLYCLMGLEYRCS 246          
BLAST of GCR044 vs. Ensembl Sea Lamprey
Match: ntsr1 (neurotensin receptor 1 (high affinity) [Source:ZFIN;Acc:ZDB-GENE-090313-372])

HSP 1 Score: 98.5969 bits (244), Expect = 1.508e-23
Identity = 53/146 (36.30%), Postives = 83/146 (56.85%), Query Frame = 3
Query:  117 NTIYVVLIFVGVFGNCITCRVILHFKVMR----TPTNYYLLNLGIADLSVLILGLTQDFY-LTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQ 539
              +Y+ L  VG  GN +T  V+L  +  R       +Y+L+++  +DL  L+LGL  + Y   W H  + FG+ GC     L +     +VL  T  ++ERY+A+CHPL   + ++ R RT +++A +W TSFL +LP+AL MG Q
Sbjct:   48 TALYMALFVVGTVGNAVTLYVVLRKRSARHLQHGTAHYHLVSMAASDLLTLMLGLPVELYNFIWVHDQWAFGDLGCRGYYYLRDSCTYATVLNITSLSVERYLAVCHPLRAMTVASPR-RTRRLVAAVWFTSFLLALPMALVMGQQ 192          
BLAST of GCR044 vs. Ensembl Sea Lamprey
Match: mlnr (motilin receptor [Source:ZFIN;Acc:ZDB-GENE-130530-1015])

HSP 1 Score: 97.4413 bits (241), Expect = 7.173e-23
Identity = 92/313 (29.39%), Postives = 143/313 (45.69%), Query Frame = 3
Query:  102 LLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHE---FLYSLSGILYYFNCAINPILYNIMSHKFRNG 1031
            LL    T  V+L   GV GN +T  V      MRT T  YL ++ ++DL ++   +  D Y  W + P+ FG+F C     +SE     ++L  T  ++ERY+AIC PL     +  R+R   +I  +W  +   + P+   + +Q  KR                V  +  +             +F  P+  ++VLY  IG   R  + R E  +    +H+     +A +  V+ML A+V+ F +C  PFH  RL+       AW   K    VH+   +L   S +L+Y + AINP+LYN MS K+R  
Sbjct:   42 LLAVVTTTSVLLFAFGVLGNSMTIAVFSRTHEMRTTTYLYLSSMAVSDL-LIFSCMPFDLYRLWRYRPWLFGDFLCRCFQYVSESCTYATILHITALSVERYLAICFPLWA-KVAITRRRVRALILGLWALALGSAGPVISIVSVQVEKREPV-----------CKVTDEARKSGRLEIITWMSTAYFFLPVFCLAVLYGLIGR--RLWLRRTEAVVPCMVQHE-----KAHRQTVRMLVAVVVAFVVCWLPFHVGRLIF------AWHVTKRSQFVHDLSQYLNLTSFVLFYLSSAINPLLYNFMSRKYRAA 328          
BLAST of GCR044 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008040.1 (pep scaffold:Pmarinus_7.0:GL477351:476361:492361:-1 gene:ENSPMAG00000007251.1 transcript:ENSPMAT00000008040.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 2.050e-20
Identity = 91/344 (26.45%), Postives = 167/344 (48.55%), Query Frame = 3
Query:  114 FNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQ-LKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLM---VTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF------CDIVKCRRLSSTPKIQMSLSTKRYMII 1115
            ++  Y  ++ V  FGN +   +++  + MRT TNY+L+NL +AD ++  L  + +F     H  + FG   C  ++ +    +  S+ + T   ++RY+AI HPL KP  +   Q T  ++A IW  +   SLPL++   ++Q   R     ++  ++  DS    Q+    L           ++ PL++M+V Y  +G+T+      G+     S+EH R  Q+R+++  VKM+  +V+ F +C  P+H   L+   +  I    +  Q  L     F  ++S  +Y      NPI+Y  ++ +FR GF      C +V   R+SS   +++     R+ ++
Sbjct:   60 WSVAYGGIVAVAFFGNMVVIWIVVAHRRMRTVTNYFLVNLAVADSAMAALNTSINFVYA-VHNDWYFGGAYCRFQNFIPVAAVFASIYSMTAIAVDRYMAIRHPL-KPRMTA--QSTRLVMAGIWALAMCLSLPLSIYSRVEQRFGRFVCLVDWPGKMGGDSQFIYQLVVMTL----------VYVFPLLVMAVTYTIVGVTLWGGTIPGD-----SSEHFR-EQLRSKRKVVKMMIVVVVTFAVCWMPYHVYFLLGRTLNRIYHRKYIQQVYL---AIFWLAMSSTMY------NPIIYCCLNSRFRTGFKRAFRWCPLV---RVSSDEALELKSRRTRHSVM 371          
BLAST of GCR044 vs. Ensembl Nematostella
Match: EDO45884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU2])

HSP 1 Score: 104.375 bits (259), Expect = 2.959e-25
Identity = 88/307 (28.66%), Postives = 147/307 (47.88%), Query Frame = 3
Query:  120 TIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKR--NDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            T+Y  +  V + GN + C V+   + MRT TNYY++NL  ADL++ +L +  D  +  + Y +PFG F C V   +  M    SV T T   + RYIA+   +        ++R    I+ IW  SF   LP AL + + Q  +     S++++Q      T+   + Q  +P S              +++  Y+ IGL +R    R    +  +A H+R+++  A+   V+M+  +V++F +C+ P H   L +     S++D       + E L     IL Y N + NPI+Y+I   +FR  F
Sbjct:   20 TLYSAIFSVSLTGNTLVCLVVCRQQKMRTSTNYYIVNLACADLAITVLCIPFDIAIQKNSYVWPFGAFMCKVLYPIMTMSAFASVGTLTAIALNRYIAVMKAM---RVYGAKKRAKLAISLIWAFSFSAVLPYALALEVDQNAKCVETWSSSYSQCY----TLFIFVFQYVIPLS--------------VITAAYVAIGLQLR----RNRANL--AAAHRRQDRDVAK--VVRMMTIVVLIFAVCMLPNH--MLWIFRDFSSSFDDS-----LRETLQHWGEILIYANSSSNPIVYSICIEEFRMAF 290          
BLAST of GCR044 vs. Ensembl Nematostella
Match: EDO43998 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXA6])

HSP 1 Score: 102.834 bits (255), Expect = 1.920e-24
Identity = 93/351 (26.50%), Postives = 155/351 (44.16%), Query Frame = 3
Query:   75 QGPQRD--PINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNF--------TQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRN---GFCDIVKCRRLSSTPKIQMS 1088
             G Q D  P+ L      IY+ + F+G+ GN +    I+  K +RT  N + LNL IADL V+++ +        + + +PFGNF C V  ++  + +  S+      + +RY AI HP L+P  +    +   IIA IW  SF+ S+PL    G     R D S             R  E   +   + Q  +P + + +             V  M+I      S  R   QI+++A  +R  Q  + K A KML  +V+L+ +C+ P H     +       + +  +L     +++ L+ +    NCA+NPILY  ++ +F      F  I  C ++ +  +  M 
Sbjct:    4 SGSQHDLEPVGLRWSLRLIYIAVFFIGIVGNLVVGIAIILRKRLRTSNNIFTLNLCIADLIVIVIYVPTQMAAFENDHNWPFGNFMCQVAYIIIPLCLSASIGILLAISTDRYRAIAHP-LRPRLTLMNVKI--IIAIIWFLSFITSIPLLFVAGTD---RPDPSGKLYCSELWPRGTRYEEMYWIAIFVVQYVIPLAVIAALS----------RVTAMKIRQNSFFSSARKRSQIVTTAVRQRLKQ--STKIA-KMLIGLVLLYSICMLPQHVIYFWLK------YGNLNVL-SYKMYVFRLANVFPMANCALNPILYGTLNKEFAQVFKSFFAIFGCGKIKTGDEKNME 328          
BLAST of GCR044 vs. Ensembl Nematostella
Match: EDO46084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR06])

HSP 1 Score: 98.9821 bits (245), Expect = 6.433e-23
Identity = 89/336 (26.49%), Postives = 159/336 (47.32%), Query Frame = 3
Query:  120 TIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDS-TVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKE 1124
            ++Y ++  +   GN + C VI   + MRT TNY++LNL IADL++ ++ +  D  +  + Y +P+G F C +   L  M M  S+ T    ++ R+ AI +PL +  E +  Q TI II   +I+S L ++P    + L+    +D S ++ +     + T C  + Q  LP              L L++  Y++IG  +R   C G +   S+ E  ++   R     V+ML  + +LF +C+ P     +M   +     +  + +W     + +++ I+ + N A NP+ Y I + +FR  F     C      PKI  ++ T  +    +E
Sbjct:   40 SLYALIFLISTVGNSLVCIVIARRRRMRTVTNYFILNLAIADLAITLICIPFDIPVQENGYKWPYGAFMCKIMYPLQTMCMFASIFTLVAVSLNRFWAIVYPLRQ--EMSKSQATIIIILIWFISSGL-TVPYVTVLELKN--GDDCSESWPEPGYRKAYTACIFVVQYLLP--------------LTLIAFAYLKIGFELRK--CVGTRTANSALERAKQEDTR---KVVRMLIIVTLLFAMCVLP---NNVMWLWLDFGNGNDYEHIWE----MVAVTNIILFANSATNPVAYTICNERFREEFRLYFTC-----DPKIFHTMQTTIFKSFREE 339          
BLAST of GCR044 vs. Ensembl Nematostella
Match: EDO49619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFL1])

HSP 1 Score: 93.2041 bits (230), Expect = 2.134e-21
Identity = 84/327 (25.69%), Postives = 145/327 (44.34%), Query Frame = 3
Query:  123 IYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGC-IVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDS--TVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSA--EHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEF-----------LYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCR 1055
            ++ ++  VGV GN + C VI     MR   NY ++NL IAD++V ++ +  D  +      +  G   C +V   ++ +  C++  T    + +RY A+ HP  KP  S   ++T+ +I   W+ SFL  LP  L +G+       S T F  + +     TV   +   ALP              L++++  Y R+ L +R    R E+  ++S      + N +       KML  +V+++ LCL P                   ++LW   EF           L + +G+L Y N  +NP LY  ++ +F+ GF  ++ C+
Sbjct:    1 LFAIIFIVGVVGNSLVCLVIFKTPNMRNTRNYLIVNLAIADITVALVCIPFDVVIRVYGDTWVLGAAMCKMVWPSMTFVATCSAA-TLAAISFDRYRAVVHP-WKPRLS--MRQTLAVIVSTWLVSFLVVLPYILVLGMD----GHSCTEFWLKDIHRQLYTVFLFVFAYALP--------------LVIIAFAYSRVALKLREQSNRIEKNKLASGIPSSSKYNWI------TKMLVTVVLIYALCLLP------------------NQVLWLWMEFGTGNEFEHMNTLLTFTGMLVYINSIVNPFLYAGLNDEFKKGFARLLCCK 281          
BLAST of GCR044 vs. Ensembl Nematostella
Match: EDO33974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR4])

HSP 1 Score: 90.1225 bits (222), Expect = 2.430e-20
Identity = 86/308 (27.92%), Postives = 143/308 (46.43%), Query Frame = 3
Query:  126 YVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDS--TVCTQIEQKALPNSXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEF---LYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            YV++  +GV GN + C V+   + M+  TNY+++NL  ADL+VL++ +  DF    ++Y +P+G+  C +   L  M    SV T    ++ R++AI +P L+P  +    +  K+I  +W+ S     P    + + +++       F +R ++    T+   + Q  LP + +        T ++     YMR  L       RG QQ      HK           VK+L  +VI F L + P H   + +        D        HE+   + SL  IL YFN A NP++YN ++ +FR GF
Sbjct:    1 YVLIFIIGVIGNILVCLVVCRQRKMKNVTNYFIVNLAAADLAVLLICIPFDFGEIITNY-WPYGSIMCKLVYPLQTMATTASVGTLVAISLNRFMAIVYP-LRPQLTTTDAK--KVITVVWVLSLALVSP---YIAVLRMRGQHCQETFEERGMQAGAYTMAIFLLQYVLPLTLIGLSYTDPGTHILAH---YMRRSL-------RGHQQKALKKAHK----------VVKVLTGVVITFALLMLPNHVVFIWIDFGRGGGCD--------HEYVNQIVSLGQILVYFNSATNPLIYNAVNEQFREGF 273          
BLAST of GCR044 vs. Ensembl Medaka
Match: nmur1a (neuromedin U receptor 1 [Source:NCBI gene;Acc:101165785])

HSP 1 Score: 197.208 bits (500), Expect = 7.307e-58
Identity = 134/383 (34.99%), Postives = 211/383 (55.09%), Query Frame = 3
Query:   39 DN--LTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQ--QLKRNDSSTNFTQRLLEDSTVCTQIEQKALPN-SXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEH------KRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAW-DSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMI---ISKEPLKQSS 1142
            DN  LT++E++    GP+R  +   +P    Y+V+  VGV GN +TC VI   KVM TPTNYYL +L ++DL VL+LG+  + Y  W +YP+  G  GC  K+ L E     S+L  T  +IERYIA+ HP LK      R    ++I  +W  S LCS+P     G+    +     + N  +  + DS +CT ++ + + N +  ++  +FF+ P++ +SVLYM IGL ++        +  S          + R Q   R+   KML  +V++F +C APFH +RLM + I E  W DS +    + E+++ +SG+ +Y + A+NPILYN+MS +FR  F +++  R+ + TP+ + SLS  R  +   +S  PL   +
Sbjct:   39 DNACLTEEEYLEKYLGPRRSSV--FLPVFLSYLVIFLVGVVGNMLTCTVIARNKVMWTPTNYYLFSLAVSDLLVLLLGMPLELYELWQNYPFLLGKGGCYFKTFLFETVCLASILNVTALSIERYIAVVHP-LKAKYVVTRTHAKRVILTVWGVSVLCSVPNTSLHGISILHIPSTGPAGNRNEE-IPDSAICTLVKPRWIYNLTIQLTTFLFFILPMLTISVLYMLIGLQLKREKMHQALEAKSGFGQESFCNIRTRQQKIRRRQVTKMLFVLVVVFGICWAPFHTDRLMWSFINE--WTDSHR---EIFEYVHIISGVFFYLSSAVNPILYNLMSTRFREMFKEVMCHRQHNITPR-KNSLSVTRLTLRSTLSDAPLSNRT 411          
BLAST of GCR044 vs. Ensembl Medaka
Match: nmur3 (neuromedin-U receptor 2-like [Source:NCBI gene;Acc:101165474])

HSP 1 Score: 192.2 bits (487), Expect = 9.934e-56
Identity = 114/356 (32.02%), Postives = 201/356 (56.46%), Query Frame = 3
Query:   36 KDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXX-XXXXXXXXMSVLYMRIGLTI----RHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMS 1088
             ++LT+   + +  GP+R P    +P  T+Y+++  +G+ GN +TC VI   K MR PTN+YL++L ++DL VL+ G+  + Y  W +YP+PFG  GC  K+ L E     S+L  T  ++ERYIA+ HPL     S N Q   ++I  +W+ S +C++P     G+  L             +E+S +CT ++   + N  +      F+  P++++SVLY+ +G+ +    RH+     +   SS+      +   R+  +KML+ +V +F LC APFH ER++ + +  S W    ++  V+++++ LSGIL+Y + A+NPI+Y+++S +FR  F ++V C  +  +  ++ S
Sbjct:   70 NEHLTEINLLEI-LGPKRSP--FFLPVTTVYLLIFLIGLSGNVLTCAVIAKHKRMRNPTNFYLVSLAVSDLLVLMFGMPLEIYDLWQNYPFPFGEGGCYFKTFLFETVCFASILNVTALSVERYIAVVHPLKTRYLSTN-QHAKRVITVVWVVSMVCAIPNTSLHGIFYLPEK----------MEESAICTVLKPLWIYNLLMQITTACFYFIPMMIISVLYLVMGIHLGRERRHARRHLGKSCYSSSRRNLTVENGRRRQVIKMLSIVVAVFGLCWAPFHIERVLWSSV--SQWT--DLMHNVYQYVHILSGILFYLSSAVNPIIYSLLSTRFRECFRELV-CSHVEDSSSVRDS 406          
BLAST of GCR044 vs. Ensembl Medaka
Match: nmur1a (neuromedin U receptor 1 [Source:NCBI gene;Acc:101165785])

HSP 1 Score: 187.963 bits (476), Expect = 4.809e-55
Identity = 122/344 (35.47%), Postives = 191/344 (55.52%), Query Frame = 3
Query:   42 NLTDKE-FISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQ--QLKRNDSSTNFTQRLLEDSTVCTQIEQKALPN-SXXXXXXXXXXXXXXXMSVLYMRIGLTIRHSVCRGEQQIISSAEH------KRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDI 1043
            +LT+KE ++    GP+R  +   +P    Y+V+  VGV GN +TC VI   KVM TPTNYYL +L ++DL VL+LG+  + Y  W +YP+  G  GC  K+ L E     S+L  T  +IERYIA+ HP LK      R    ++I  +W  S LCS+P     G+    +     + N  +  + DS +CT ++ + + N +  ++  +FF+ P++ +SVLYM IGL ++        +  S          + R Q   R+   KML  +V++F +C APFH +RLM + I E   DS +    + E+++ +SG+ +Y + A+NPILYN+MS +FR  F ++
Sbjct:   11 SLTNKEEYLEKYLGPRRSSV--FLPVFLSYLVIFLVGVVGNMLTCTVIARNKVMWTPTNYYLFSLAVSDLLVLLLGMPLELYELWQNYPFLLGKGGCYFKTFLFETVCLASILNVTALSIERYIAVVHP-LKAKYVVTRTHAKRVILTVWGVSVLCSVPNTSLHGISILHIPSTGPAGNRNEE-IPDSAICTLVKPRWIYNLTIQLTTFLFFILPMLTISVLYMLIGLQLKREKMHQALEAKSGFGQESFCNIRTRQQKIRRRQVTKMLFVLVVVFGICWAPFHTDRLMWSFINEWT-DSHR---EIFEYVHIISGVFFYLSSAVNPILYNLMSTRFREMFKEM 346          
BLAST of GCR044 vs. Ensembl Medaka
Match: ENSORLT00000011317.2 (neuromedin-U receptor 1-like [Source:NCBI gene;Acc:101166005])

HSP 1 Score: 178.333 bits (451), Expect = 1.997e-51
Identity = 122/350 (34.86%), Postives = 185/350 (52.86%), Query Frame = 3
Query:   45 LTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIR-----------HSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRR 1058
            L+++E+++   GP+  P    +P    Y+++  VGV GN  TC VIL   VM+T TNYYLL+L ++DL VL+LG+  + Y    +YP+  G  GC  K  L E     S+L  T  ++ERY+A+  P LK      R    ++I  +W  S LC+LP     G++ L     S  F  R    S VC  I+   + N  ++   + F    ++++S+LY+ IGL +R           HS   G      S  H++R   R  +   KML  +V++F LC APFH +RLM + I +S+   QKI  +VH     +SG+ +Y + A+NPILYN+MS +FR  F  +  C +
Sbjct:   18 LSEEEYLTTHMGPRMSP--WFLPVCITYLIIFLVGVLGNSFTCAVILQHSVMQTATNYYLLSLAVSDLLVLLLGMPLEVYEMQENYPFLLGKGGCYFKIFLFETVCFASILNVTALSVERYVAVTEP-LKVKHVATRAHARRVIFMLWGLSMLCALPNTSVHGIKVL-----SPRF-GREFPRSAVCNLIKPDWMYNLIILISTLVFFMLPMLVISILYLLIGLRLRREKLMATMDANHSFGPGS----ISKSHRQRLTKRNLQVT-KMLCVLVVVFGLCWAPFHVDRLMWSYIDKSSIQHQKIFEKVH----IVSGVFFYLSSAVNPILYNLMSTRFREMFSHLTCCSK 349          
BLAST of GCR044 vs. Ensembl Medaka
Match: ENSORLT00000039093.1 (neuromedin-U receptor 1-like [Source:NCBI gene;Acc:101166005])

HSP 1 Score: 178.333 bits (451), Expect = 2.514e-51
Identity = 122/350 (34.86%), Postives = 185/350 (52.86%), Query Frame = 3
Query:   45 LTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTIR-----------HSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRR 1058
            L+++E+++   GP+  P    +P    Y+++  VGV GN  TC VIL   VM+T TNYYLL+L ++DL VL+LG+  + Y    +YP+  G  GC  K  L E     S+L  T  ++ERY+A+  P LK      R    ++I  +W  S LC+LP     G++ L     S  F  R    S VC  I+   + N  ++   + F    ++++S+LY+ IGL +R           HS   G      S  H++R   R  +   KML  +V++F LC APFH +RLM + I +S+   QKI  +VH     +SG+ +Y + A+NPILYN+MS +FR  F  +  C +
Sbjct:   21 LSEEEYLTTHMGPRMSP--WFLPVCITYLIIFLVGVLGNSFTCAVILQHSVMQTATNYYLLSLAVSDLLVLLLGMPLEVYEMQENYPFLLGKGGCYFKIFLFETVCFASILNVTALSVERYVAVTEP-LKVKHVATRAHARRVIFMLWGLSMLCALPNTSVHGIKVL-----SPRF-GREFPRSAVCNLIKPDWMYNLIILISTLVFFMLPMLVISILYLLIGLRLRREKLMATMDANHSFGPGS----ISKSHRQRLTKRNLQVT-KMLCVLVVVFGLCWAPFHVDRLMWSYIDKSSIQHQKIFEKVH----IVSGVFFYLSSAVNPILYNLMSTRFREMFSHLTCCSK 352          
BLAST of GCR044 vs. Planmine SMEST
Match: SMESG000046087.1 (SMESG000046087.1)

HSP 1 Score: 426.402 bits (1095), Expect = 1.066e-150
Identity = 204/204 (100.00%), Postives = 204/204 (100.00%), Query Frame = 3
Query:  684 MSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKEPLKQSSIKKCQYIFSQNRSEDRPERSECCFCVPKYDNREHYQDSVDAFNVTINSIHD 1295
            MSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKEPLKQSSIKKCQYIFSQNRSEDRPERSECCFCVPKYDNREHYQDSVDAFNVTINSIHD
Sbjct:    1 MSVLYMRIGLTIRHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSSTPKIQMSLSTKRYMIISKEPLKQSSIKKCQYIFSQNRSEDRPERSECCFCVPKYDNREHYQDSVDAFNVTINSIHD 204          
BLAST of GCR044 vs. Planmine SMEST
Match: SMESG000046084.1 (SMESG000046084.1)

HSP 1 Score: 405.601 bits (1041), Expect = 2.496e-142
Identity = 195/195 (100.00%), Postives = 195/195 (100.00%), Query Frame = 3
Query:   30 MYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQI 614
            MYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQI
Sbjct:    1 MYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQI 195          
BLAST of GCR044 vs. Planmine SMEST
Match: SMESG000044227.1 (SMESG000044227.1)

HSP 1 Score: 163.31 bits (412), Expect = 1.351e-45
Identity = 118/341 (34.60%), Postives = 171/341 (50.15%), Query Frame = 3
Query:   54 KEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGL-TQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLP------LALQMGLQQLKRN-----DSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTI-RHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            KE +    GP+  P+   I    IY  ++  G  GN  TC VI+  K + T TN YL NL ++D+ +L+ GL ++  Y   + YP+  GNF C ++++L EM    SVLT T FTIERYIAICHP LK    +  QR+  ++  IW+ S L SLP      L   +    +  N     D+  +   + +EDS +C      +  N  + +    F    L ++ VLY  I LT+ R  + R              N  R R   ++ML  +VI FF+  APFH +R++ T        S  IL  +   +Y LSG L+Y +  +NPI+YNI+S KFR  F
Sbjct:   13 KEILEGALGPKLMPLMYRILQGLIYTCVLTFGFCGNICTCTVIISNKYLHTTTNIYLFNLAVSDILLLLTGLPSEILYSVGNGYPWILGNFYCHLRAMLLEMSSIVSVLTITAFTIERYIAICHP-LKQQIISTMQRSFFVVIFIWLISSLFSLPYGVLCKLDYMLTFPNMTANNSECFDALNSEVYKPIEDSNLCVGPRNSSFFNYIIRTSTFLFFLIPLAVLLVLYFHIALTLWRRKITRSHLS----------NHSRGRNGVIRMLIFVVIAFFISWAPFHTQRILATF-----RHSVDILDFI---IYYLSGSLFYMSSVLNPIVYNIISSKFRKAF 334          
BLAST of GCR044 vs. Planmine SMEST
Match: SMESG000044227.1 (SMESG000044227.1)

HSP 1 Score: 162.925 bits (411), Expect = 2.050e-45
Identity = 118/341 (34.60%), Postives = 171/341 (50.15%), Query Frame = 3
Query:   54 KEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGL-TQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLP------LALQMGLQQLKRN-----DSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTI-RHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            KE +    GP+  P+   I    IY  ++  G  GN  TC VI+  K + T TN YL NL ++D+ +L+ GL ++  Y   + YP+  GNF C ++++L EM    SVLT T FTIERYIAICHP LK    +  QR+  ++  IW+ S L SLP      L   +    +  N     D+  +   + +EDS +C      +  N  + +    F    L ++ VLY  I LT+ R  + R              N  R R   ++ML  +VI FF+  APFH +R++ T        S  IL  +   +Y LSG L+Y +  +NPI+YNI+S KFR  F
Sbjct:   26 KEILEGALGPKLMPLMYRILQGLIYTCVLTFGFCGNICTCTVIISNKYLHTTTNIYLFNLAVSDILLLLTGLPSEILYSVGNGYPWILGNFYCHLRAMLLEMSSIVSVLTITAFTIERYIAICHP-LKQQIISTMQRSFFVVIFIWLISSLFSLPYGVLCKLDYMLTFPNMTANNSECFDALNSEVYKPIEDSNLCVGPRNSSFFNYIIRTSTFLFFLIPLAVLLVLYFHIALTLWRRKITRSHLS----------NHSRGRNGVIRMLIFVVIAFFISWAPFHTQRILATF-----RHSVDILDFI---IYYLSGSLFYMSSVLNPIVYNIISSKFRKAF 347          
BLAST of GCR044 vs. Planmine SMEST
Match: SMESG000044227.1 (SMESG000044227.1)

HSP 1 Score: 157.532 bits (397), Expect = 1.272e-43
Identity = 112/318 (35.22%), Postives = 162/318 (50.94%), Query Frame = 3
Query:  123 IYVVLIFVGVFGNCITCRVILHFKVMRTPTNYYLLNLGIADLSVLILGL-TQDFYLTWSHYPYPFGNFGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIKIIACIWITSFLCSLP------LALQMGLQQLKRN-----DSSTNFTQRLLEDSTVCTQIEQKALPNSXXXXXXXXXXXX-XXXMSVLYMRIGLTI-RHSVCRGEQQIISSAEHKRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKILWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGF 1034
            IY  ++  G  GN  TC VI+  K + T TN YL NL ++D+ +L+ GL ++  Y   + YP+  GNF C ++++L EM    SVLT T FTIERYIAICHP LK    +  QR+  ++  IW+ S L SLP      L   +    +  N     D+  +   + +EDS +C      +  N  + +    F    L ++ VLY  I LT+ R  + R              N  R R   ++ML  +VI FF+  APFH +R++ T        S  IL  +   +Y LSG L+Y +  +NPI+YNI+S KFR  F
Sbjct:   12 IYTCVLTFGFCGNICTCTVIISNKYLHTTTNIYLFNLAVSDILLLLTGLPSEILYSVGNGYPWILGNFYCHLRAMLLEMSSIVSVLTITAFTIERYIAICHP-LKQQIISTMQRSFFVVIFIWLISSLFSLPYGVLCKLDYMLTFPNMTANNSECFDALNSEVYKPIEDSNLCVGPRNSSFFNYIIRTSTFLFFLIPLAVLLVLYFHIALTLWRRKITRSHLS----------NHSRGRNGVIRMLIFVVIAFFISWAPFHTQRILATF-----RHSVDILDFI---IYYLSGSLFYMSSVLNPIVYNIISSKFRKAF 310          
The following BLAST results are available for this feature:
BLAST of GCR044 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NMUR21.321e-4832.34neuromedin U receptor 2 [Source:HGNC Symbol;Acc:HG... [more]
NMUR13.777e-4434.28neuromedin U receptor 1 [Source:HGNC Symbol;Acc:HG... [more]
GHSR1.296e-3131.20growth hormone secretagogue receptor [Source:HGNC ... [more]
NTSR14.223e-3028.02neurotensin receptor 1 [Source:HGNC Symbol;Acc:HGN... [more]
NTSR23.525e-2725.00neurotensin receptor 2 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of GCR044 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmur-29.102e-4432.28NMUR (NeuroMedin U Receptor) homolog [Source:UniP... [more]
nmur-18.785e-4330.23NMUR (NeuroMedin U Receptor) homolog; Neuromedin U... [more]
trhr-14.248e-2929.61Thyrotropin-Releasing Hormone Receptor [Source:Un... [more]
tkr-21.819e-2527.17TachyKinin Receptor family [Source:UniProtKB/TrEM... [more]
nmur-32.459e-2426.16NMUR (NeuroMedin U Receptor) homolog [Source:UniP... [more]
back to top
BLAST of GCR044 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PK2-R11.240e-4937.77gene:FBgn0038140 transcript:FBtr0082745[more]
CapaR6.278e-4833.82gene:FBgn0037100 transcript:FBtr0078379[more]
PK2-R22.788e-4636.44gene:FBgn0038139 transcript:FBtr0082773[more]
PK2-R22.788e-4636.44gene:FBgn0038139 transcript:FBtr0082774[more]
PK1-R4.094e-3843.13gene:FBgn0038201 transcript:FBtr0305681[more]
back to top
BLAST of GCR044 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmur1a4.858e-5732.87neuromedin U receptor 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
nmur38.981e-5533.52neuromedin U receptor 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
nmur31.711e-5433.52neuromedin U receptor 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
nmur1b1.257e-4835.12neuromedin U receptor 1b [Source:ZFIN;Acc:ZDB-GENE... [more]
ghsra4.585e-3831.21growth hormone secretagogue receptor a [Source:ZFI... [more]
back to top
BLAST of GCR044 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk164.660e-5534.93cyclin-dependent kinase 16 [Source:Xenbase;Acc:XB-... [more]
cdk167.649e-5534.36cyclin-dependent kinase 16 [Source:Xenbase;Acc:XB-... [more]
cdk161.314e-5434.68cyclin-dependent kinase 16 [Source:Xenbase;Acc:XB-... [more]
cdk161.405e-5434.66cyclin-dependent kinase 16 [Source:Xenbase;Acc:XB-... [more]
cdk161.570e-5434.66cyclin-dependent kinase 16 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of GCR044 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmur27.306e-4833.53neuromedin U receptor 2 [Source:MGI Symbol;Acc:MGI... [more]
Nmur19.044e-4732.95neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI... [more]
Nmur19.343e-4732.95neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI... [more]
Nmur12.082e-4433.33neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI... [more]
Ghsr7.617e-3231.46growth hormone secretagogue receptor [Source:MGI S... [more]
back to top
BLAST of GCR044 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9GZQ4|NMUR2_HUMAN6.343e-4832.34Neuromedin-U receptor 2 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8BZ39|NMUR2_MOUSE5.110e-4733.53Neuromedin-U receptor 2 OS=Mus musculus OX=10090 G... [more]
sp|Q8ITC7|CAPAR_DROME6.293e-4733.82Neuropeptides capa receptor OS=Drosophila melanoga... [more]
sp|Q9ESQ4|NMUR2_RAT1.572e-4631.85Neuromedin-U receptor 2 OS=Rattus norvegicus OX=10... [more]
sp|O55040|NMUR1_MOUSE6.327e-4632.95Neuromedin-U receptor 1 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of GCR044 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUI40.000e+0100.00GCR044 OS=Schmidtea mediterranea OX=79327 GN=gcr04... [more]
A0A193KUB15.942e-8242.94GCR092 OS=Schmidtea mediterranea OX=79327 GN=gcr09... [more]
A1X4Q36.776e-6937.93Capa receptor-like GPCR OS=Apis mellifera OX=7460 ... [more]
A0A1B6C1726.466e-6640.12G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A2A3ERA99.857e-6635.71Neuropeptides capa receptor OS=Apis cerana cerana ... [more]
back to top
BLAST of GCR044 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmur1a3.042e-5833.33neuromedin U receptor 1 [Source:NCBI gene;Acc:1030... [more]
nmur1a3.625e-5834.90neuromedin U receptor 1 [Source:NCBI gene;Acc:1030... [more]
nmur35.606e-5332.56neuromedin-U receptor 2-like [Source:NCBI gene;Acc... [more]
nmur1b1.101e-4632.79neuromedin-U receptor 1-like [Source:NCBI gene;Acc... [more]
nmur1b1.101e-4632.79neuromedin-U receptor 1-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of GCR044 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmur1a4.331e-5533.24neuromedin U receptor 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
NMUR23.560e-2638.43neuromedin U receptor 2 [Source:HGNC Symbol;Acc:HG... [more]
ntsr11.508e-2336.30neurotensin receptor 1 (high affinity) [Source:ZFI... [more]
mlnr7.173e-2329.39motilin receptor [Source:ZFIN;Acc:ZDB-GENE-130530-... [more]
ENSPMAT00000008040.12.050e-2026.45pep scaffold:Pmarinus_7.0:GL477351:476361:492361:-... [more]
back to top
BLAST of GCR044 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR044 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458842.959e-2528.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439981.920e-2426.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460846.433e-2326.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496192.134e-2125.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339742.430e-2027.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR044 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmur1a7.307e-5834.99neuromedin U receptor 1 [Source:NCBI gene;Acc:1011... [more]
nmur39.934e-5632.02neuromedin-U receptor 2-like [Source:NCBI gene;Acc... [more]
nmur1a4.809e-5535.47neuromedin U receptor 1 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000011317.21.997e-5134.86neuromedin-U receptor 1-like [Source:NCBI gene;Acc... [more]
ENSORLT00000039093.12.514e-5134.86neuromedin-U receptor 1-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of GCR044 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046087.11.066e-150100.00SMESG000046087.1[more]
SMESG000046084.12.496e-142100.00SMESG000046084.1[more]
SMESG000044227.11.351e-4534.60SMESG000044227.1[more]
SMESG000044227.12.050e-4534.60SMESG000044227.1[more]
SMESG000044227.11.272e-4335.22SMESG000044227.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026927 ID=SMED30026927|Name=GCR044|organism=Schmidtea mediterranea sexual|type=transcript|length=1324bp
TTTCCATTTAATAATTTTGAATGTACGAAATGTATAAAGATAATTTAACC
GACAAGGAATTTATAAGCCTTGAACAAGGCCCACAGAGAGATCCAATTAA
TTTATTGATCCCGTTCAACACTATTTATGTCGTCCTGATTTTTGTTGGCG
TTTTTGGAAATTGTATAACATGTAGAGTTATATTGCATTTTAAAGTCATG
AGAACCCCGACAAATTATTATTTATTGAATCTCGGAATAGCTGACTTAAG
TGTGCTTATTTTGGGTTTGACCCAAGACTTCTATTTGACATGGTCACATT
ATCCGTATCCGTTTGGAAATTTTGGTTGTATCGTTAAATCCCTGTTGTCG
GAAATGGGCATGTGCACTTCAGTTTTAACTGCTACAGGATTCACAATTGA
AAGATACATAGCAATATGTCACCCCTTGCTGAAACCGTCAGAGAGTAACA
ATAGACAGAGGACAATTAAAATAATCGCCTGTATATGGATAACATCGTTT
CTTTGCAGTTTACCGCTTGCTCTACAGATGGGTCTCCAGCAGCTTAAAAG
AAATGATTCCTCTACAAACTTTACTCAACGGCTATTAGAAGATTCAACAG
TTTGTACCCAAATTGAACAGAAAGCACTACCAAATTCCTTCTTAATCAGC
TTCATTATTTTCTTCTTGACTCCTTTAATTCTAATGTCAGTTCTATATAT
GAGAATTGGACTCACAATAAGACATTCGGTTTGTCGAGGAGAACAACAAA
TAATTTCCAGCGCTGAACACAAGCGACGAAATCAAATGAGAGCTCGAAAA
GCAGCTGTTAAAATGTTAGCGGCAATTGTCATTTTATTCTTTTTATGTTT
GGCGCCATTCCACGCCGAACGATTGATGGTCACGTTGATTCCCGAATCAG
CTTGGGACTCTCAAAAGATCCTTTGGAGAGTTCACGAATTCCTTTACAGT
TTATCCGGAATACTTTACTACTTTAATTGTGCAATCAATCCTATTTTGTA
TAATATCATGTCTCATAAATTCCGTAACGGGTTCTGTGATATTGTCAAAT
GCCGTCGACTCTCGTCGACCCCAAAAATTCAAATGAGTCTCAGTACAAAA
CGCTACATGATTATTTCCAAAGAACCATTAAAACAATCGTCAATAAAGAA
ATGTCAATACATTTTCAGTCAAAACCGATCGGAAGACAGACCGGAACGGT
CTGAATGTTGTTTTTGTGTTCCTAAATATGATAACCGAGAACATTACCAA
GACAGTGTAGATGCATTTAATGTAACAATCAATTCAATTCACGATTGATT
GGGTACGATACCGTTCGTCAAAGA
back to top

protein sequence of SMED30026927-orf-1

>SMED30026927-orf-1 ID=SMED30026927-orf-1|Name=SMED30026927-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=426bp
MYEMYKDNLTDKEFISLEQGPQRDPINLLIPFNTIYVVLIFVGVFGNCIT
CRVILHFKVMRTPTNYYLLNLGIADLSVLILGLTQDFYLTWSHYPYPFGN
FGCIVKSLLSEMGMCTSVLTATGFTIERYIAICHPLLKPSESNNRQRTIK
IIACIWITSFLCSLPLALQMGLQQLKRNDSSTNFTQRLLEDSTVCTQIEQ
KALPNSFLISFIIFFLTPLILMSVLYMRIGLTIRHSVCRGEQQIISSAEH
KRRNQMRARKAAVKMLAAIVILFFLCLAPFHAERLMVTLIPESAWDSQKI
LWRVHEFLYSLSGILYYFNCAINPILYNIMSHKFRNGFCDIVKCRRLSST
PKIQMSLSTKRYMIISKEPLKQSSIKKCQYIFSQNRSEDRPERSECCFCV
PKYDNREHYQDSVDAFNVTINSIHD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR005390NeuromedU_rcpt
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007218neuropeptide signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0001607neuromedin U receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 309..335
score: 31.56
coord: 31..55
score: 22.01
coord: 262..286
score: 28.89
coord: 207..230
score: 28.86
coord: 110..132
score: 25.99
coord: 64..85
score: 34.75
coord: 147..168
score: 26.7
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 46..327
e-value: 1.3E-43
score: 149.2
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 116..132
IPR005390Neuromedin U receptorPRINTSPR01565NEUROMEDINURcoord: 56..67
score: 61.11
coord: 189..200
score: 30.56
coord: 280..290
score: 44.44
coord: 84..106
score: 32.37
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 21..354
e-value: 8.1E-83
score: 280.0
NoneNo IPR availablePANTHERPTHR24243:SF148PYROKININ-1 RECEPTORcoord: 12..361
NoneNo IPR availablePANTHERPTHR24243G-PROTEIN COUPLED RECEPTORcoord: 12..361
NoneNo IPR availableCDDcd151347tmA_capaRcoord: 30..338
e-value: 8.6309E-104
score: 308.105
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 4..351
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 207..229
NoneNo IPR availableTMHMMTMhelixcoord: 151..173
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 261..283
NoneNo IPR availableTMHMMTMhelixcoord: 109..131
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 46..327
score: 37.644