Sulfhydryl oxidase

Overview
NameSulfhydryl oxidase
Smed IDSMED30026923
Length (bp)2087
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sulfhydryl oxidase (SMED30026923) t-SNE clustered cells

Violin plots show distribution of expression levels for Sulfhydryl oxidase (SMED30026923) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sulfhydryl oxidase (SMED30026923) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sulfhydryl oxidase (SMED30026923) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026923

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30026923h1SMcG0000627 dd_Smed_v4_8516_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30026923h1SMcG0000627 dd_Smed_v4_8516_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30026923h1SMcG0000627 OX_Smed_1.0.13347ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sulfhydryl oxidase vs. Ensembl Human
Match: QSOX1 (quiescin sulfhydryl oxidase 1 [Source:HGNC Symbol;Acc:HGNC:9756])

HSP 1 Score: 186.808 bits (473), Expect = 2.761e-50
Identity = 138/528 (26.14%), Postives = 240/528 (45.45%), Query Frame = 1
Query:   94 AWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYP---YFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTI-SLIDSYFQPKPFIEFNK----DNIVLKN--PYLLI---TGSQIVNLKRAI-LSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEKLYEGLN---SYLEDPIIINNRTKSSNFAVST---MSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSG--FKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC---RISLNLIWPTENQWRKGKAFQYLVEHYSQINTV 1593
            A   + LY+  D + +    +        +   W ++F+ S+CGHCI FAP +KA  ++ K W   +    +DC+ E   A+C+  NI  +P   +FK F  KN   AV       ++  T+ +   D + S  D++    P +E  K    D    +N   YL +    G   +  + A+ LS H  +         ++   ++ ++      +       S +  L E  +   +YL+    +      +  A +T   ++ T  + +    +Y  D+ +++ Y L  +V    +     L+ LKKF+  L + F G    +N L S N    ++  +  + I    F  + +   E + L   +++WIGC GS+P++R +PC LW  FH LTV    ++         A  ++ +IR ++  FF C++CA +F++  A     V S   AVL+LW  HN VN RL+ APSEDP++PK+ +PP  +C  C   R+ +  +W  E          +L  H+S  N +
Sbjct:   29 AAPRSALYSPSDPLTLLQADTVRGAVLG-SRSAWAVEFFASWCGHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAF-TKNGSGAVFPVAGADVQ--TLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIFEKGGSYLGREVALDLSQHKGVAVRRVLNTEANVVRKFGVTDFPSCYLLFRNGSVSRVPVLMESRSFYTAYLQRLSGLTREAAQTTVAPTTANKIAPTVWKLADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNE---WLKRQKRNKIPYSFFKTALDDRKEGAVLAK-KVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVP-VWDVE------ATLNFLKAHFSPSNII 541          
BLAST of Sulfhydryl oxidase vs. Ensembl Human
Match: QSOX1 (quiescin sulfhydryl oxidase 1 [Source:HGNC Symbol;Acc:HGNC:9756])

HSP 1 Score: 187.193 bits (474), Expect = 1.116e-49
Identity = 138/528 (26.14%), Postives = 240/528 (45.45%), Query Frame = 1
Query:   94 AWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYP---YFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTI-SLIDSYFQPKPFIEFNK----DNIVLKN--PYLLI---TGSQIVNLKRAI-LSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEKLYEGLN---SYLEDPIIINNRTKSSNFAVST---MSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSG--FKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC---RISLNLIWPTENQWRKGKAFQYLVEHYSQINTV 1593
            A   + LY+  D + +    +        +   W ++F+ S+CGHCI FAP +KA  ++ K W   +    +DC+ E   A+C+  NI  +P   +FK F  KN   AV       ++  T+ +   D + S  D++    P +E  K    D    +N   YL +    G   +  + A+ LS H  +         ++   ++ ++      +       S +  L E  +   +YL+    +      +  A +T   ++ T  + +    +Y  D+ +++ Y L  +V    +     L+ LKKF+  L + F G    +N L S N    ++  +  + I    F  + +   E + L   +++WIGC GS+P++R +PC LW  FH LTV    ++         A  ++ +IR ++  FF C++CA +F++  A     V S   AVL+LW  HN VN RL+ APSEDP++PK+ +PP  +C  C   R+ +  +W  E          +L  H+S  N +
Sbjct:   29 AAPRSALYSPSDPLTLLQADTVRGAVLG-SRSAWAVEFFASWCGHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAF-TKNGSGAVFPVAGADVQ--TLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIFEKGGSYLGREVALDLSQHKGVAVRRVLNTEANVVRKFGVTDFPSCYLLFRNGSVSRVPVLMESRSFYTAYLQRLSGLTREAAQTTVAPTTANKIAPTVWKLADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNE---WLKRQKRNKIPYSFFKTALDDRKEGAVLAK-KVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVP-VWDVE------ATLNFLKAHFSPSNII 541          
BLAST of Sulfhydryl oxidase vs. Ensembl Human
Match: QSOX2 (quiescin sulfhydryl oxidase 2 [Source:HGNC Symbol;Acc:HGNC:30249])

HSP 1 Score: 117.857 bits (294), Expect = 9.045e-27
Identity = 52/165 (31.52%), Postives = 91/165 (55.15%), Query Frame = 1
Query: 1120 LSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDT------KENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVN 1596
            + W+GC GS+   R YPC LW  FH LTV    ++   PD       +++   +++++R ++ +FF C+EC ++F++   +    V +   A+L+LWK HN VN RL+   SEDP++PK+ +P   +C  C   +  +      W +G    +L +HY + N ++
Sbjct:  413 IKWVGCQGSRSELRGYPCSLWKLFHTLTV----EASTHPDALVGTGFEDDPQAVLQTMRRYVHTFFGCKECGEHFEEMAKESMDSVKTPDQAILWLWKKHNMVNGRLAGHLSEDPRFPKLQWPTPDLCPACHEEIKGL----ASWDEGHVLTFLKQHYGRDNLLD 569          

HSP 2 Score: 67.781 bits (164), Expect = 4.152e-11
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  127 DNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF 378
            D V + +  S     +N +   W +QFY S+CGHCI +AP ++A   + + W   +R   +DC  E+  A+C   +I  YP F+ F
Sbjct:   61 DAVWVLDSGSVRGATAN-SSAAWLVQFYSSWCGHCIGYAPTWRALAGDVRDWASAIRVAALDCMEEKNQAVCHDYDIHFYPTFRYF 145          
BLAST of Sulfhydryl oxidase vs. Ensembl Human
Match: QSOX2 (quiescin sulfhydryl oxidase 2 [Source:HGNC Symbol;Acc:HGNC:30249])

HSP 1 Score: 87.8113 bits (216), Expect = 2.044e-18
Identity = 37/108 (34.26%), Postives = 63/108 (58.33%), Query Frame = 1
Query: 1120 LSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDT------KENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLS 1425
            + W+GC GS+   R YPC LW  FH LTV    ++   PD       +++   +++++R ++ +FF C+EC ++F++   +    V +   A+L+LWK HN VN RL+
Sbjct:  181 IKWVGCQGSRSELRGYPCSLWKLFHTLTV----EASTHPDALVGTGFEDDPQAVLQTMRRYVHTFFGCKECGEHFEEMAKESMDSVKTPDQAILWLWKKHNMVNGRLA 284          
BLAST of Sulfhydryl oxidase vs. Ensembl Human
Match: QSOX1 (quiescin sulfhydryl oxidase 1 [Source:HGNC Symbol;Acc:HGNC:9756])

HSP 1 Score: 68.1662 bits (165), Expect = 7.695e-13
Identity = 34/109 (31.19%), Postives = 54/109 (49.54%), Query Frame = 1
Query:  103 NAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYP---YFKIFLNKNDKRAVING 414
             + LY+  D + +    +        +   W ++F+ S+CGHCI FAP +KA  ++ K W   +    +DC+ E   A+C+  NI  +P   +FK F  KN   AV  G
Sbjct:   32 RSALYSPSDPLTLLQADTVRGAVLG-SRSAWAVEFFASWCGHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAF-TKNGSGAVFPG 138          
BLAST of Sulfhydryl oxidase vs. Ensembl Celegans
Match: F47B7.2 (Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:Q20514])

HSP 1 Score: 161.77 bits (408), Expect = 6.206e-42
Identity = 138/556 (24.82%), Postives = 258/556 (46.40%), Query Frame = 1
Query:   64 FAIILFLYFVAW--SNAQLYNEMD-----NVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF-LNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQ---PKPFIEFN--KDNIVLKNPY----------LLITGSQIVNLKRAILSYHNRLTFDLYYQRSS--------SNATEYSLSLVNESQINIIINKYSSIEK---LYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEA--SKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETE-VDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVNFQTQPS 1614
            F +++ L F A   S   LY++ D     +V+ F+   Y S  ++      FI+FY S+CG CI +AP FK F K+ + W  +++  V++C+ ++   LC+  +++ YP  + F  N ++K    +G+  S +   +  +  D   L  +  Q   P+ +  F    D   L+  +          +++  S  V     +++YH      + Y   +        S+   ++L   N +Q   +    S ++K   + + ++  + D I  +  T     A   +++ +   +  Y V   D+ +++ Y L  ++   +    + + +LK+++  L +++     +   F  +  +I  ++ S++   ++    + I +A  + LP  E++W+ C GSKP  R Y CGLWT  H +TV  Y K        +  I++++  R FI  F SC ECAQNF KE    +   V   +    +LW+VHN VNKRLS + ++DP + K  FPP+S+C  C       +       + KA  ++ ++YS I T +    P 
Sbjct:   25 FILVVILAFSAGGSSGESLYDKDDPILELDVDTFSAAIYGSKKAH------FIEFYSSWCGACIGYAPTFKKFAKQLEKWAPLVQVTVVNCADDKNMPLCREHSVSSYPSLRYFKYNSHNKD---DGMKYSGDKYDINKLAHDIAGLAQADAQKQNPESWPTFLPLSDTTTLEEVFKSIGTTSYLAIVVQDSPSVIAWANLINYHGNNGVKVAYVTQNHPIATKFFSDGGVHALLFSNGNQ-EPLWKSSSPVDKWVDVQDKIDELIGDKIAASGPTVHPINAAPVIAAPSNPLNNQYEVQLVDLKSAMSYMLYKEIPRREEIRDEPMAVLKQWMHTLKKYAPGTTPMRRLFFRLDEWI--QLQSVVTANEWITKVDEIQQALGNPLPK-EITWMACAGSKPNLRGYTCGLWTLAHTITVEAY-KQEKHNTAFKPVIDVLEPFRAFIFHFLSCSECAQNFTKEAEKNQLHLVTRPEDVYAWLWRVHNFVNKRLSGSLTDDPSFKKQQFPPKSLCADC-------YDANGDIDEAKALPFVFKYYSNIKTDSTDNLPG 559          
BLAST of Sulfhydryl oxidase vs. Ensembl Celegans
Match: F47B7.2 (Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:Q20514])

HSP 1 Score: 161.77 bits (408), Expect = 7.582e-42
Identity = 138/556 (24.82%), Postives = 258/556 (46.40%), Query Frame = 1
Query:   64 FAIILFLYFVAW--SNAQLYNEMD-----NVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF-LNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQ---PKPFIEFN--KDNIVLKNPY----------LLITGSQIVNLKRAILSYHNRLTFDLYYQRSS--------SNATEYSLSLVNESQINIIINKYSSIEK---LYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEA--SKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETE-VDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVNFQTQPS 1614
            F +++ L F A   S   LY++ D     +V+ F+   Y S  ++      FI+FY S+CG CI +AP FK F K+ + W  +++  V++C+ ++   LC+  +++ YP  + F  N ++K    +G+  S +   +  +  D   L  +  Q   P+ +  F    D   L+  +          +++  S  V     +++YH      + Y   +        S+   ++L   N +Q   +    S ++K   + + ++  + D I  +  T     A   +++ +   +  Y V   D+ +++ Y L  ++   +    + + +LK+++  L +++     +   F  +  +I  ++ S++   ++    + I +A  + LP  E++W+ C GSKP  R Y CGLWT  H +TV  Y K        +  I++++  R FI  F SC ECAQNF KE    +   V   +    +LW+VHN VNKRLS + ++DP + K  FPP+S+C  C       +       + KA  ++ ++YS I T +    P 
Sbjct:   25 FILVVILAFSAGGSSGESLYDKDDPILELDVDTFSAAIYGSKKAH------FIEFYSSWCGACIGYAPTFKKFAKQLEKWAPLVQVTVVNCADDKNMPLCREHSVSSYPSLRYFKYNSHNKD---DGMKYSGDKYDINKLAHDIAGLAQADAQKQNPESWPTFLPLSDTTTLEEVFKSIGTTSYLAIVVQDSPSVIAWANLINYHGNNGVKVAYVTQNHPIATKFFSDGGVHALLFSNGNQ-EPLWKSSSPVDKWVDVQDKIDELIGDKIAASGPTVHPINAAPVIAAPSNPLNNQYEVQLVDLKSAMSYMLYKEIPRREEIRDEPMAVLKQWMHTLKKYAPGTTPMRRLFFRLDEWI--QLQSVVTANEWITKVDEIQQALGNPLPK-EITWMACAGSKPNLRGYTCGLWTLAHTITVEAY-KQEKHNTAFKPVIDVLEPFRAFIFHFLSCSECAQNFTKEAEKNQLHLVTRPEDVYAWLWRVHNFVNKRLSGSLTDDPSFKKQQFPPKSLCADC-------YDANGDIDEAKALPFVFKYYSNIKTDSTDNLPG 559          
BLAST of Sulfhydryl oxidase vs. Ensembl Celegans
Match: F47B7.2 (Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:Q20514])

HSP 1 Score: 161.384 bits (407), Expect = 1.917e-41
Identity = 138/556 (24.82%), Postives = 258/556 (46.40%), Query Frame = 1
Query:   64 FAIILFLYFVAW--SNAQLYNEMD-----NVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF-LNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQ---PKPFIEFN--KDNIVLKNPY----------LLITGSQIVNLKRAILSYHNRLTFDLYYQRSS--------SNATEYSLSLVNESQINIIINKYSSIEK---LYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEA--SKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETE-VDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVNFQTQPS 1614
            F +++ L F A   S   LY++ D     +V+ F+   Y S  ++      FI+FY S+CG CI +AP FK F K+ + W  +++  V++C+ ++   LC+  +++ YP  + F  N ++K    +G+  S +   +  +  D   L  +  Q   P+ +  F    D   L+  +          +++  S  V     +++YH      + Y   +        S+   ++L   N +Q   +    S ++K   + + ++  + D I  +  T     A   +++ +   +  Y V   D+ +++ Y L  ++   +    + + +LK+++  L +++     +   F  +  +I  ++ S++   ++    + I +A  + LP  E++W+ C GSKP  R Y CGLWT  H +TV  Y K        +  I++++  R FI  F SC ECAQNF KE    +   V   +    +LW+VHN VNKRLS + ++DP + K  FPP+S+C  C       +       + KA  ++ ++YS I T +    P 
Sbjct:   25 FILVVILAFSAGGSSGESLYDKDDPILELDVDTFSAAIYGSKKAH------FIEFYSSWCGACIGYAPTFKKFAKQLEKWAPLVQVTVVNCADDKNMPLCREHSVSSYPSLRYFKYNSHNKD---DGMKYSGDKYDINKLAHDIAGLAQADAQKQNPESWPTFLPLSDTTTLEEVFKSIGTTSYLAIVVQDSPSVIAWANLINYHGNNGVKVAYVTQNHPIATKFFSDGGVHALLFSNGNQ-EPLWKSSSPVDKWVDVQDKIDELIGDKIAASGPTVHPINAAPVIAAPSNPLNNQYEVQLVDLKSAMSYMLYKEIPRREEIRDEPMAVLKQWMHTLKKYAPGTTPMRRLFFRLDEWI--QLQSVVTANEWITKVDEIQQALGNPLPK-EITWMACAGSKPNLRGYTCGLWTLAHTITVEAY-KQEKHNTAFKPVIDVLEPFRAFIFHFLSCSECAQNFTKEAEKNQLHLVTRPEDVYAWLWRVHNFVNKRLSGSLTDDPSFKKQQFPPKSLCADC-------YDANGDIDEAKALPFVFKYYSNIKTDSTDNLPG 559          
BLAST of Sulfhydryl oxidase vs. Ensembl Celegans
Match: T10H10.2 (Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:P91442])

HSP 1 Score: 109.768 bits (273), Expect = 8.286e-25
Identity = 67/172 (38.95%), Postives = 92/172 (53.49%), Query Frame = 1
Query: 1006 FNNIVRFIDAK-INSMIGRKKFTKSWNSILEASKLP-NLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINL----IKSIREFIISFFSCQECAQNFKKETAD---YETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC 1494
            F+ +  FI  K + + I  + + K + +  E +  P  L  +W  C GS   YR Y CGLWTTFH LTV+ + K++     K N I L    ++SIR+++ SFF C  C  +F K T D    E  V   +   LYLWK HN VN RL    +EDPK+PK  FP + +C  C
Sbjct:  373 FSRLRDFIAEKGLEAPISVEDWQKEFLAAEEEAGHPFPLNTNWEHCAGSSTQYRGYTCGLWTTFHALTVSAF-KNW---QNKTNDITLPLPPLQSIRDWVGSFFGCNHCRDHFLKMTTDTFKIEANVRRPEDVYLYLWKAHNKVNARLHGRETEDPKFPKYQFPAKFLCVDC 540          

HSP 2 Score: 60.4622 bits (145), Expect = 2.817e-9
Identity = 31/121 (25.62%), Postives = 61/121 (50.41%), Query Frame = 1
Query:   31 IIFLVILKMKYFA-IILFLYFVAWSNAQLYNEMDNVNIFNKTSY-ESVFSNLT-EDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCS--VERALCKSKNITHYPYFKIF 378
            +  L++L     A I  + Y    +N  LY+  D+V   ++ ++ +++F   +    + ++FY  +CGHC  FAP +K   K+   W  +++   I+C+  V   +C+S  +  +P  K F
Sbjct:    1 MFLLILLITPVLADIATYGYHPKGANPTLYSPEDSVLQLDEATFNDTIFGAQSGAAGYLVEFYSDWCGHCRAFAPTYKNLAKDVDGWQNIVKIAAINCADPVNEPVCRSNGVRFFPLIKYF 121          
BLAST of Sulfhydryl oxidase vs. Ensembl Celegans
Match: F35G2.1 (Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:Q20063])

HSP 1 Score: 105.916 bits (263), Expect = 5.028e-24
Identity = 78/287 (27.18%), Postives = 126/287 (43.90%), Query Frame = 1
Query:  841 LYPVYNQDIYASVFYALTNDVTDI-KLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMI--------------------GRK--------KFTKSWNSI--LEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADY----ETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVN 1596
            +Y V   D+  ++  AL ++VT +      DN   L +F+  L          + SF N +R + AK  + +                    GRK        ++ + + S+  + AS  P +  +W  C GS P YR Y CGLWTTFH LTV+ Y+ +    D   N +  + +I+ ++ S+F C+ C  +F   T       E  V      + YLW+ HN VN RL    +EDP++ K+ FP   +C  C         +  Q+ + +   +L+ +Y  I   N
Sbjct:  154 MYYVSETDMLKAMRMALLDEVTRVPGAIRGDNFTNLHEFMTLLS-----NHFPVLSFQNDIRRMRAKRTTSVILRNSERARLVFTHMREFLEGRKSIGSVSSDEYRRQFESVERVYASPFP-VNSTWQHCKGSSPMYRGYTCGLWTTFHALTVHTYIDTI--KDDYVNPMKPLSTIQGWVKSYFGCEHCRNHFMHMTTTLFPLNERRVRHPHDMMTYLWRAHNIVNNRLHGDSTEDPQFTKMQFPAPFLCPTCH--------SGGQFSRRQIRNFLLRYYGSIKPHN 424          
BLAST of Sulfhydryl oxidase vs. Ensembl Fly
Match: Qsox1 (gene:FBgn0033814 transcript:FBtr0340493)

HSP 1 Score: 107.457 bits (267), Expect = 6.269e-24
Identity = 65/245 (26.53%), Postives = 124/245 (50.61%), Query Frame = 1
Query:  850 VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNN----IVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELS-WIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYET-EVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC-RISLNLIWPTENQWRKGKAFQYL 1563
            VY  D+  ++   L N+V+ +   + + L+ L++F+  L +++    N  +  +     +V+F D ++      ++  +     LEA   P    + ++GC GS P  R + C LWT FH +TV          +  ++ + +++++  +I +FF C EC+++F+   +  +   V + + AVL+LW  HN VN+RL+   +EDP++PK  FP    C +C R  ++     E +W K     +L
Sbjct:  322 VYQADLEQAIRTVLHNEVSKVGEISGEKLLALQRFLAVLQRYNPLGANGHQLVSKLKDYVVQFNDQRLTGSQFEEELKR-----LEAHLSPVYSSNHFVGCVGSSPRLRGFSCSLWTLFHFMTVQA-----ANNEETQDPLEVLQAMHGYIKNFFGCTECSEHFQAMASRRKIWSVPNKEEAVLWLWAAHNEVNQRLAGDATEDPEFPKKQFPAPESCNECYRTPVSKSENLEIEWNKDAVLGFL 556          

HSP 2 Score: 55.0694 bits (131), Expect = 2.110e-7
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  196 FIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFK 372
             ++FY++YCGHC  FAP +K+  +    W+ V+    IDC+ E    +C++  +  YP  +
Sbjct:   71 LVEFYNTYCGHCRRFAPTYKSVAEHLLPWSEVLIVAAIDCAAEENNGICRNYEVMGYPTLR 131          
BLAST of Sulfhydryl oxidase vs. Ensembl Fly
Match: Qsox1 (gene:FBgn0033814 transcript:FBtr0087760)

HSP 1 Score: 107.457 bits (267), Expect = 6.269e-24
Identity = 65/245 (26.53%), Postives = 124/245 (50.61%), Query Frame = 1
Query:  850 VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNN----IVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELS-WIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYET-EVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC-RISLNLIWPTENQWRKGKAFQYL 1563
            VY  D+  ++   L N+V+ +   + + L+ L++F+  L +++    N  +  +     +V+F D ++      ++  +     LEA   P    + ++GC GS P  R + C LWT FH +TV          +  ++ + +++++  +I +FF C EC+++F+   +  +   V + + AVL+LW  HN VN+RL+   +EDP++PK  FP    C +C R  ++     E +W K     +L
Sbjct:  322 VYQADLEQAIRTVLHNEVSKVGEISGEKLLALQRFLAVLQRYNPLGANGHQLVSKLKDYVVQFNDQRLTGSQFEEELKR-----LEAHLSPVYSSNHFVGCVGSSPRLRGFSCSLWTLFHFMTVQA-----ANNEETQDPLEVLQAMHGYIKNFFGCTECSEHFQAMASRRKIWSVPNKEEAVLWLWAAHNEVNQRLAGDATEDPEFPKKQFPAPESCNECYRTPVSKSENLEIEWNKDAVLGFL 556          

HSP 2 Score: 55.0694 bits (131), Expect = 2.110e-7
Identity = 20/61 (32.79%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  196 FIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFK 372
             ++FY++YCGHC  FAP +K+  +    W+ V+    IDC+ E    +C++  +  YP  +
Sbjct:   71 LVEFYNTYCGHCRRFAPTYKSVAEHLLPWSEVLIVAAIDCAAEENNGICRNYEVMGYPTLR 131          
BLAST of Sulfhydryl oxidase vs. Ensembl Fly
Match: Qsox3 (gene:FBgn0038918 transcript:FBtr0084149)

HSP 1 Score: 106.301 bits (264), Expect = 1.157e-23
Identity = 120/508 (23.62%), Postives = 206/508 (40.55%), Query Frame = 1
Query:  112 LYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCS-VERA-LCKSKNITHYPYFKIFLNKNDK-RAVING-----IPTSIEHGTVEDVFKDTIS---LIDSYFQP-KPFIEFNKDNIVLKNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYS-LSLVNESQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQ-----FSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ--------FSGFKENILESFNNIVR-FIDAKINSMIGRKKFTKSWNSILEASKLPNLEL------------------SWIGCNGSKPYYRRYPCGLWTTFHVLTV-NQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYE-TEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC 1494
            LY++ DN+++    S + + +        +QF +SYCG+C  FA  F+    + + WN V+R   +DC+ +E   LC+   IT  P  + + +K  + R  I       IP+ I    +E + ++  S    +   F P +P  + N       N    I     V++   I +  N L +     R   +A  ++   L    Q+  ++N+    +              +I    KSS+  V +++    Q       TL P   + I +  + A   D   +  T +     L++ I Q            SGFK    ++  +I+R F    + +  GR+      N + E +++   E                    ++GC GS P+ RR+ C LWT FH  TV    +K YP          L K        F+ C++ +  F K        +V +    +L+LW+ HN VN++L+   S DP++PK+ FP    C  C
Sbjct:   35 LYSKEDNIHVVVGASLKKILAEPAMGK-LVQFLNSYCGNCRRFAHTFRKMAVDLQKWNRVLRIYAVDCARLENVKLCRDFRITLTPTIRYYPSKFQRIRHGIGTDIETTIPSEIADQLIESLSENDYSESKGVKPIFDPIEPGNKLNDIYEQFDNKVTYILLVHPVDM--GIETILNMLPYPDVGVRIIKDAEMFAQFGLKPCKQMVALLNRSGKAQ--------------LIKPAGKSSSAYVESVAGLLHQNGHTSMPTLPPAEPEYILSEGYDAFIVDYV-LNSTKVLFQADLEQAIYQFLHVEIPKTAFISGFK---FKALRHIIRLFRRFNVLNRDGRRMLNSLVNHLFEVTEITGEEFRDVVDDLQTRLDPIFAEQQYVGCLGSTPHTRRFSCSLWTLFHYFTVLAAQMKVYPPSSVTIGLYGLAKF-------FYDCKDGSMYFVKLAKRMNIAKVRTHDEEILWLWEAHNEVNEKLAGDASGDPRFPKVQFPERKHCPDC 514          
BLAST of Sulfhydryl oxidase vs. Ensembl Fly
Match: Qsox2 (gene:FBgn0038919 transcript:FBtr0084150)

HSP 1 Score: 105.916 bits (263), Expect = 1.640e-23
Identity = 55/164 (33.54%), Postives = 87/164 (53.05%), Query Frame = 1
Query: 1126 WIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYE-TEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVNFQTQPS 1614
            ++GC GS+P  R + C +WT FH LTV        +P     A +++K+   F   FF C +C+++F++       T V +    +L+LW  HN VN R++   +EDPK+PKI FP    C  CR +       +++WR  +  +YL + Y  IN V+F   P+
Sbjct:  397 YVGCIGSRPLLRSFTCSMWTLFHHLTVEAA-----KPPNYFEAGSILKTFHGFAKYFFGCTDCSEHFQQMAIRRNLTSVKTHDEEILWLWAAHNEVNARIAGDSTEDPKFPKIQFPSAENCPTCRSN-------DSEWRTDEVLKYLKQLYD-INNVSFYGLPT 547          

HSP 2 Score: 67.3958 bits (163), Expect = 2.149e-11
Identity = 38/110 (34.55%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  106 AQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF---LNKNDK--RAVING 414
            A LY++ DNV + +  S     +   +++  +QF +S+CG C  FAPVFK   ++   W  ++R   +DC+ ER   LC+  NI   P  + F   + KND    AVI G
Sbjct:   33 ASLYSDTDNVIMLDIESLRPALN--LKNSKLVQFLNSFCGDCHRFAPVFKTLSRDLYKWRRILRIYAVDCAQERNAQLCREFNIRQTPSLRFFGPDMRKNDDVLGAVIPG 140          
BLAST of Sulfhydryl oxidase vs. Ensembl Fly
Match: Qsox4 (gene:FBgn0051413 transcript:FBtr0084442)

HSP 1 Score: 83.9593 bits (206), Expect = 1.605e-16
Identity = 51/157 (32.48%), Postives = 74/157 (47.13%), Query Frame = 1
Query: 1126 WIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQ---NFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQIN 1587
            ++GC  S+P  R + C LW  FH L+V            K  ++ L+     ++  F +C+EC      FKK         D  +  +L+LW+ HN VNK+L+   +EDPK+PKI FP E  C KCR           +WR  +   YL   Y+  N
Sbjct:  409 YVGCIASRPSLRGFNCSLWVLFHYLSVES-------KKLKPKSVLLV--FLGYVRFFMNCKECDMKISEFKKLRPIANVTNDDEQ--ILWLWEAHNYVNKQLAGDSTEDPKFPKIQFPSERDCPKCR-------NNATEWRTEEVLHYLKGIYTLKN 547          
BLAST of Sulfhydryl oxidase vs. Ensembl Zebrafish
Match: qsox1 (quiescin Q6 sulfhydryl oxidase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7019])

HSP 1 Score: 137.887 bits (346), Expect = 2.604e-33
Identity = 76/251 (30.28%), Postives = 137/251 (54.58%), Query Frame = 1
Query:  850 VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASK--LPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVN 1596
            VY  D+ +++ Y+L  +++     + D+LI LKK+I  L ++   + ++  +   +  ++ ++  + I    F    +++++ S   LP   + W+GC GS+  YR YPC +WT FHVLTV    ++     T      ++ ++R ++ SFF C+ CA +F+   A+   +V+S  GAV++LW  HN VN RL+   SEDP +PKI +P   +C  C   + +I   ++ W K +  Q+L  ++S    +N
Sbjct:  308 VYMSDLESALHYSLRVELSSHTSISGDDLIALKKYINVLAKYFPGRPSVKSALQAVDSWLQSQKGTEIKYSDFRDVLDNVVQTSDAVLPE-GVQWVGCQGSQARYRGYPCAVWTLFHVLTV----QAKEMGSTVSEPQEVLLAMRGYVSSFFGCRPCATHFEAMAAESMDQVNSLSGAVIWLWSRHNRVNNRLAGDLSEDPHFPKIQWPSPELCPSCH-GVTII--GDHNWIKDEVPQFLQNYFSSSRILN 550          

HSP 2 Score: 66.2402 bits (160), Expect = 1.057e-10
Identity = 33/94 (35.11%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  103 NAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYPYFKIF 378
             A LY   D V +    + +S   N T     ++FY ++CGHCI F+PV+K+  ++ K W   +    IDC+ E  R +C +  IT YP  K F
Sbjct:   40 EAGLYTASDQVIVLTPENVDSTLFNNTA-ALLVEFYATWCGHCIAFSPVWKSLARDIKEWKPAVDLAAIDCANESNRKVCTNFGITGYPSIKFF 132          
BLAST of Sulfhydryl oxidase vs. Ensembl Zebrafish
Match: qsox2 (quiescin Q6 sulfhydryl oxidase 2 [Source:ZFIN;Acc:ZDB-GENE-110203-4])

HSP 1 Score: 123.635 bits (309), Expect = 7.046e-29
Identity = 72/260 (27.69%), Postives = 129/260 (49.62%), Query Frame = 1
Query:  850 VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILE----ASKLPNLELS----WIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDT------KENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQIN 1587
            VY  D+ + + Y L  ++   K    + L   K F+  + +       +     ++V+ ++  +  ++        +++IL+      ++  L LS    W+GC GS    R YPC LWT FHVLTV    ++  +PD       +++ + +++++R +I +FF CQEC ++F++   +   +V +   AVL+LW+ HN VN RLS + SEDP +PK  +P   +C  C      +    + W +     +L +HYS  N
Sbjct:  294 VYMADLESGLHYLLRVELATHKTLEGEELKTFKDFVTVVAK-------LFPGHQSVVKLLETLLEWLVSLPLEKIPYDAILDLVNNKMRISGLYLSEQVQWVGCQGSSVALRGYPCSLWTLFHVLTV----QAANRPDALANTGFEDDPLAVLQTMRRYIGTFFGCQECGKHFEEMAQESLNQVKTVDEAVLWLWRKHNQVNARLSGSMSEDPMFPKTQWPTPDLCPTCHEEQEGL----HVWNEQMVLAFLKQHYSASN 538          

HSP 2 Score: 83.9593 bits (206), Expect = 2.744e-16
Identity = 41/106 (38.68%), Postives = 59/106 (55.66%), Query Frame = 1
Query:   67 AIILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF 378
            +II+ L F     A+LY E D V I +  S +    N +   W +QFY S+CGHCI ++P +KA   + K W   +R GV+DC+ E+   +CK   I  YP F+ F
Sbjct:   10 SIIVGLLFGRAQPARLYTEEDPVVILSSDSLKQTVLN-SSSAWLVQFYSSWCGHCIQYSPTWKALAGDVKDWAQAIRIGVVDCAHEKNFDICKEFGIHFYPTFRYF 114          
BLAST of Sulfhydryl oxidase vs. Ensembl Zebrafish
Match: dnajc10 (DnaJ (Hsp40) homolog, subfamily C, member 10 [Source:ZFIN;Acc:ZDB-GENE-070327-1])

HSP 1 Score: 58.9214 bits (141), Expect = 1.640e-8
Identity = 25/89 (28.09%), Postives = 47/89 (52.81%), Query Frame = 1
Query:  112 LYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            +Y++   +   ++  +++  +  + + WF+ FY   C HC + AP ++ F KE    + V+R G ++C     LC+SK I  YP   +F
Sbjct:  123 IYDDDPEITTLDRGDFDAAVN--SGEVWFVNFYFPRCSHCHDLAPTWREFAKEM---DGVIRIGAVNCGDNGMLCRSKGINSYPSLYVF 206          

HSP 2 Score: 51.6026 bits (122), Expect = 3.022e-6
Identity = 23/77 (29.87%), Postives = 34/77 (44.16%), Query Frame = 1
Query:  184 EDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKNDKRAVING 414
            +D+W + FY  +CG C  FAP F+     A+     +R G +DC      C+S  I  YP  + +      R    G
Sbjct:  684 KDHWVLDFYAPWCGPCQQFAPEFEVL---ARMMKGTVRAGKVDCQAHYQTCQSAGIKAYPTVRFYPTLGTTRRDQGG 757          
BLAST of Sulfhydryl oxidase vs. Ensembl Zebrafish
Match: txndc5 (thioredoxin domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1951])

HSP 1 Score: 50.0618 bits (118), Expect = 6.633e-6
Identity = 27/93 (29.03%), Postives = 49/93 (52.69%), Query Frame = 1
Query:  103 NAQLYNEMDNVNIFNKTSY-ESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            +A+   +  NV +  ++++ E+V   L+    FI+FY  +CGHC N AP +    ++       ++   +DC+VER LC   ++  YP   +F
Sbjct:  285 SAEPEKQESNVLVLTESNFDETVAKGLS----FIKFYAPWCGHCKNLAPTWDDLSQKEFPGLTDVKIAKVDCTVERTLCNRFSVRGYPTLLMF 373          
BLAST of Sulfhydryl oxidase vs. Ensembl Xenopus
Match: fucolectinloc100491211 (fucolectin uncharacterized LOC100491211 [Source:Xenbase;Acc:XB-GENE-5953489])

HSP 1 Score: 178.333 bits (451), Expect = 4.236e-47
Identity = 123/523 (23.52%), Postives = 235/523 (44.93%), Query Frame = 1
Query:   70 IILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF------LNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQPKPFIEFNKDNIVLKNPYLLITGSQIVNLKR-AILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYP------VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELS----WIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQ 1581
            + + + F +     LY   D ++I NK S      N +   W ++FY S+CGHCIN+AP ++A  ++   W+  ++ GV+DC+ E     CK   +T YP F+ F        + +     N          + D  + T++L        P  + +   I+ ++    +    +++L R + +     L  D          +  S  L+  +  + +I +   ++ L   L+S+L+    +  R   S+ A S ++    Q            +Y  D+ + + Y L  ++ + +    + L   K F+  L +    + ++++    +  ++   I+  + +  +    + +    ++  + L+    W+GC GSK + R YPC LW  FH LTV   +K     +T  +   +++++R +I  FF C+ECA++F+    +    V +   AVL+LW+ HN+VN RLS APSEDPK+PK+ +P   +C  C             W + +   +L  +Y +
Sbjct:   12 LAVLVLFGSVGAEALYGPADPLSILNKESVTRAVFN-SSSAWLLEFYSSWCGHCINYAPTWRALARDVSDWDPAIKIGVLDCAEEDNYGTCKDFGVTLYPTFRFFKAFTTEFTQGENYKAGNDREIQTVRQVIIDFLQTTVALY-------PHKQSHYTAIIFESEESYVGREVMLDLIRYSNMVVRRALPSDKAILEKLGIGSVPSCYLIQPNGSHGLIKE---VKCLRAQLSSHLKALPNVRKRL-PSDTAHSGLNKDAQQGDVAMKEFDRSKLYMADLESGLHYVLRAELANHRTLEGEKLKTFKDFVTILYKLFPGRPHVMKLLETLQEWL---ISMPLDKIPYDAILDLVNNRMRISGIFLTNHTQWVGCRGSKSHLRGYPCSLWKLFHSLTVQASVKPDALANTGADPQAVLQTMRSYIREFFGCRECAKHFEAMAKETMDSVRTPDQAVLWLWRKHNAVNNRLSGAPSEDPKFPKVQWPTSDLCSACHGQTG---GGTQSWNENEVLSFLKRYYGK 516          
BLAST of Sulfhydryl oxidase vs. Ensembl Xenopus
Match: clpb (ClpB homolog, mitochondrial AAA ATPase chaperonin [Source:Xenbase;Acc:XB-GENE-994913])

HSP 1 Score: 155.221 bits (391), Expect = 7.715e-39
Identity = 129/550 (23.45%), Postives = 245/550 (44.55%), Query Frame = 1
Query:   67 AIILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTISLID----------------SYFQPKPFIEFNKDN---IVLKNPYLLITGSQIVNLK-------RAILSYHNRLTFDLYYQRSSSNATEY-SLSLVNESQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQ-----FSTLYPVYNQDIYASVFYALTNDVT---DIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSIL---EASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVN 1596
            A ++ L  V  S+A LY   + V   ++ ++  +    +   W  +FY S+CGHC  F P +    ++ K W  V+  GVIDC+       C    +  YP  K F  K+  + V  G+     H +V+ + ++ I+ ++                S F+ + F +  ++N   ++ + P + I     +++        R +L   N +    +        T Y SL L++ +  N ++N  +     Y      L  P +     K + F +   ++ T +      +    +Y  D+ ++V Y L  +V+    ++   +D LI     + +      +   +L+S       I + ++   G++   K + ++L   + + + +  ++++ C GS P +R +PC LWT FH LTV          DT      ++  +R ++ +FF C+ECA +F+   A+    V++   A+L+LW  HN VNKRL+  PSEDP++PK+ +P +++C  C++        E  W       ++  HYS+ N  N
Sbjct:   12 ATLVLLATVVPSHAGLYTPDEPVVHLDRKAHTYLLG--SRSFWVAEFYASWCGHCQRFKPSWSGLAEDIKDWRPVVYLGVIDCAESSNFETCNEFGVEGYPTIKSF--KSFTKEVSQGVSEDAVH-SVQALRENIITRLEEQKDSRPSSWPPLEPISTFEVENFFKTKQENYLALIFEEPSMYIGRETTLDMVQYEGVSVRRVLRDQNDMVNKFWI-------TSYPSLVLLSRNGSNTVVNLKADTRSSYTDFLRSL--PGV----RKKNLFIIGVANNGTTEQDDRRIADSTKLYMADLESAVHYTLRAEVSRFSHLEGERLDALIAYVSVLRKYFPARPYGTTLLKS-------IHSWLHDRAGKEVLYKDFENVLNNKDENAVLSSSVNYVWCQGSHPNFRGFPCSLWTLFHFLTVQA------SEDTAAPPTEVLLGLRGYVKNFFGCRECAGHFESMAAESMNTVNTLDEAILWLWDRHNRVNKRLAGQPSEDPEFPKLPWPSKTLCPFCQVEDG---GDELAWDIPNVLNFMKTHYSRQNLAN 527          
BLAST of Sulfhydryl oxidase vs. Ensembl Xenopus
Match: clpb (ClpB homolog, mitochondrial AAA ATPase chaperonin [Source:Xenbase;Acc:XB-GENE-994913])

HSP 1 Score: 154.451 bits (389), Expect = 1.227e-38
Identity = 129/545 (23.67%), Postives = 240/545 (44.04%), Query Frame = 1
Query:   67 AIILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTISLID----------------SYFQPKPFIEFNKDN---IVLKNPYLLITGSQIVNLK-------RAILSYHNRLTFDLYYQRSSSNATEY-SLSLVNESQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQ-----FSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEA-SKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVN 1596
            A ++ L  V  S+A LY   + V   ++ ++  +    +   W  +FY S+CGHC  F P +    ++ K W  V+  GVIDC+       C    +  YP  K F  K+  + V  G+     H +V+ + ++ I+ ++                S F+ + F +  ++N   ++ + P + I     +++        R +L   N +    +        T Y SL L++ +  N ++N  +     Y      L  P +     K + F +   ++ T +      +    +Y  D+ ++V Y L  +V+       + L  L  ++  L ++   +        +I  ++  +    +  K F    N+  EA + + +  ++++ C GS P +R +PC LWT FH LTV          DT      ++  +R ++ +FF C+ECA +F+   A+    V++   A+L+LW  HN VNKRL+  PSEDP++PK+ +P +++C  C++        E  W       ++  HYS+ N  N
Sbjct:   11 ATLVLLATVVPSHAGLYTPDEPVVHLDRKAHTYLLG--SRSFWVAEFYASWCGHCQRFKPSWSGLAEDIKDWRPVVYLGVIDCAESSNFETCNEFGVEGYPTIKSF--KSFTKEVSQGVSEDAVH-SVQALRENIITRLEEQKDSRPSSWPPLEPISTFEVENFFKTKQENYLALIFEEPSMYIGRETTLDMVQYEGVSVRRVLRDQNDMVNKFWI-------TSYPSLVLLSRNGSNTVVNLKADTRSSYTDFLRSL--PGV----RKKNLFIIGVANNGTTEQDDRRIADSTKLYMADLESAVHYTLRAEVSRFSHLEGERLDALIAYVSVLRKYFPARPYGTTLLKSIHSWLHDRAGKEVLYKDFENVLNNKDEAQNAVLSSSVNYVWCQGSHPNFRGFPCSLWTLFHFLTVQA------SEDTAAPPTEVLLGLRGYVKNFFGCRECAGHFESMAAESMNTVNTLDEAILWLWDRHNRVNKRLAGQPSEDPEFPKLPWPSKTLCPFCQVEDG---GDELAWDIPNVLNFMKTHYSRQNLAN 528          
BLAST of Sulfhydryl oxidase vs. Ensembl Xenopus
Match: fucolectinloc100491211 (fucolectin uncharacterized LOC100491211 [Source:Xenbase;Acc:XB-GENE-5953489])

HSP 1 Score: 124.02 bits (310), Expect = 7.996e-29
Identity = 68/254 (26.77%), Postives = 124/254 (48.82%), Query Frame = 1
Query:  850 VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELS----WIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAI------NLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQ 1581
            +Y  D+ + + Y L  ++ + +    + L   K F+  L +    + ++++    +  ++   I+  + +  +    + +    ++  + L+    W+GC GSK + R YPC LW  FH LTV   +K    PD   N         +++++R +I  FF C+ECA++F+    +    V +   AVL+LW+ HN+VN RLS APSEDPK+PK+ +P   +C  C             W + +   +L  +Y +
Sbjct:  295 LYMADLESGLHYVLRAELANHRTLEGEKLKTFKDFVTILYKLFPGRPHVMKLLETLQEWL---ISMPLDKIPYDAILDLVNNRMRISGIFLTNHTQWVGCRGSKSHLRGYPCSLWKLFHSLTVQASVK----PDALANTALGADPQAVLQTMRSYIREFFGCRECAKHFEAMAKETMDSVRTPDQAVLWLWRKHNAVNNRLSGAPSEDPKFPKVQWPTSDLCSACHGQTG---GGTQSWNENEVLSFLKRYYGK 538          

HSP 2 Score: 79.7221 bits (195), Expect = 7.417e-15
Identity = 35/105 (33.33%), Postives = 57/105 (54.29%), Query Frame = 1
Query:   70 IILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF 378
            + + + F +     LY   D ++I NK S      N +   W ++FY S+CGHCIN+AP ++A  ++   W+  ++ GV+DC+ E     CK   +T YP F+ F
Sbjct:   12 LAVLVLFGSVGAEALYGPADPLSILNKESVTRAVFN-SSSAWLLEFYSSWCGHCINYAPTWRALARDVSDWDPAIKIGVLDCAEEDNYGTCKDFGVTLYPTFRFF 115          
BLAST of Sulfhydryl oxidase vs. Ensembl Xenopus
Match: fucolectinloc100491211 (fucolectin uncharacterized LOC100491211 [Source:Xenbase;Acc:XB-GENE-5953489])

HSP 1 Score: 124.02 bits (310), Expect = 7.996e-29
Identity = 68/254 (26.77%), Postives = 124/254 (48.82%), Query Frame = 1
Query:  850 VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELS----WIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAI------NLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQ 1581
            +Y  D+ + + Y L  ++ + +    + L   K F+  L +    + ++++    +  ++   I+  + +  +    + +    ++  + L+    W+GC GSK + R YPC LW  FH LTV   +K    PD   N         +++++R +I  FF C+ECA++F+    +    V +   AVL+LW+ HN+VN RLS APSEDPK+PK+ +P   +C  C             W + +   +L  +Y +
Sbjct:  295 LYMADLESGLHYVLRAELANHRTLEGEKLKTFKDFVTILYKLFPGRPHVMKLLETLQEWL---ISMPLDKIPYDAILDLVNNRMRISGIFLTNHTQWVGCRGSKSHLRGYPCSLWKLFHSLTVQASVK----PDALANTALGADPQAVLQTMRSYIREFFGCRECAKHFEAMAKETMDSVRTPDQAVLWLWRKHNAVNNRLSGAPSEDPKFPKVQWPTSDLCSACHGQTG---GGTQSWNENEVLSFLKRYYGK 538          

HSP 2 Score: 79.7221 bits (195), Expect = 7.417e-15
Identity = 35/105 (33.33%), Postives = 57/105 (54.29%), Query Frame = 1
Query:   70 IILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF 378
            + + + F +     LY   D ++I NK S      N +   W ++FY S+CGHCIN+AP ++A  ++   W+  ++ GV+DC+ E     CK   +T YP F+ F
Sbjct:   12 LAVLVLFGSVGAEALYGPADPLSILNKESVTRAVFN-SSSAWLLEFYSSWCGHCINYAPTWRALARDVSDWDPAIKIGVLDCAEEDNYGTCKDFGVTLYPTFRFF 115          
BLAST of Sulfhydryl oxidase vs. Ensembl Mouse
Match: Qsox1 (quiescin Q6 sulfhydryl oxidase 1 [Source:MGI Symbol;Acc:MGI:1330818])

HSP 1 Score: 199.904 bits (507), Expect = 2.447e-55
Identity = 141/528 (26.70%), Postives = 239/528 (45.27%), Query Frame = 1
Query:  112 LYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYPYFKIF--LNKNDKRAVINGIPTSIEHGTVEDVFKDTI-SLIDSYFQPKPFIEFNKDNIVL------KNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNE------------------SQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSG--FKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTV--NQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTV 1593
            LY+  D + + +  S        +   W ++F+ S+CGHCI FAP +K    + K W   +   V+DC+ E   A+C+  NI  +P  + F    KN   A + G   +++  T+     D + S  D++    P +E  K N +       K  YL +    +   + + L     L    Y+  +          LVN+                  S++ +++   S       GL     D       T ++      ++ T  +F+    +Y  D+ +++ Y L  +V    +     L+ LKKF+  L + F G    +N L S N+   ++  +    I    F  + +S  E + L   +++W+GC GS+P++R +PC LW  FH LTV  N+Y +++PQ     +   +++++R ++  FF C++CA +F++  A    +V S   A+L+LW  HN VN RLS A SEDP +PK+ +PP  +C  C   LN   P    W  G    +L  H+S  N V
Sbjct:   38 LYSSSDPLTLLDADSVRPTVLG-SSSAWAVEFFASWCGHCIAFAPTWKELANDVKDWRPALNLAVLDCAEETNSAVCREFNIAGFPTVRFFQAFTKNGSGATLPGAGANVQ--TLRMRLIDALESHRDTWPPACPPLEPAKLNDIDGFFTRNKADYLAL----VFEREDSYLGREVTLDLSQYHAVAVRRVLNTESDLVNKFGVTDFPSCYLLLRNGSVSRVPVLVESRSFYTSYLRGLPGLTRD----APPTTATPVTADKIAPTVWKFADRSKIYMADLESALHYILRVEVGKFSVLEGQRLVALKKFVAVLAKYFPGQPLVQNFLHSIND---WLQKQQKKRIPYSFFKAALDSRKEDAVLTE-KVNWVGCQGSEPHFRGFPCSLWVLFHFLTVQANRYSEAHPQ--EPADGQEVLQAMRSYVQFFFGCRDCADHFEQMAAASMHQVRSPSNAILWLWTSHNRVNARLSGALSEDPHFPKVQWPPRELCSACHNELNGQVPL---WDLGATLNFLKAHFSPANIV 545          
BLAST of Sulfhydryl oxidase vs. Ensembl Mouse
Match: Qsox1 (quiescin Q6 sulfhydryl oxidase 1 [Source:MGI Symbol;Acc:MGI:1330818])

HSP 1 Score: 200.29 bits (508), Expect = 7.638e-55
Identity = 141/528 (26.70%), Postives = 239/528 (45.27%), Query Frame = 1
Query:  112 LYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYPYFKIF--LNKNDKRAVINGIPTSIEHGTVEDVFKDTI-SLIDSYFQPKPFIEFNKDNIVL------KNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNE------------------SQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSG--FKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTV--NQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTV 1593
            LY+  D + + +  S        +   W ++F+ S+CGHCI FAP +K    + K W   +   V+DC+ E   A+C+  NI  +P  + F    KN   A + G   +++  T+     D + S  D++    P +E  K N +       K  YL +    +   + + L     L    Y+  +          LVN+                  S++ +++   S       GL     D       T ++      ++ T  +F+    +Y  D+ +++ Y L  +V    +     L+ LKKF+  L + F G    +N L S N+   ++  +    I    F  + +S  E + L   +++W+GC GS+P++R +PC LW  FH LTV  N+Y +++PQ     +   +++++R ++  FF C++CA +F++  A    +V S   A+L+LW  HN VN RLS A SEDP +PK+ +PP  +C  C   LN   P    W  G    +L  H+S  N V
Sbjct:   38 LYSSSDPLTLLDADSVRPTVLG-SSSAWAVEFFASWCGHCIAFAPTWKELANDVKDWRPALNLAVLDCAEETNSAVCREFNIAGFPTVRFFQAFTKNGSGATLPGAGANVQ--TLRMRLIDALESHRDTWPPACPPLEPAKLNDIDGFFTRNKADYLAL----VFEREDSYLGREVTLDLSQYHAVAVRRVLNTESDLVNKFGVTDFPSCYLLLRNGSVSRVPVLVESRSFYTSYLRGLPGLTRD----APPTTATPVTADKIAPTVWKFADRSKIYMADLESALHYILRVEVGKFSVLEGQRLVALKKFVAVLAKYFPGQPLVQNFLHSIND---WLQKQQKKRIPYSFFKAALDSRKEDAVLTE-KVNWVGCQGSEPHFRGFPCSLWVLFHFLTVQANRYSEAHPQ--EPADGQEVLQAMRSYVQFFFGCRDCADHFEQMAAASMHQVRSPSNAILWLWTSHNRVNARLSGALSEDPHFPKVQWPPRELCSACHNELNGQVPL---WDLGATLNFLKAHFSPANIV 545          
BLAST of Sulfhydryl oxidase vs. Ensembl Mouse
Match: Qsox1 (quiescin Q6 sulfhydryl oxidase 1 [Source:MGI Symbol;Acc:MGI:1330818])

HSP 1 Score: 200.29 bits (508), Expect = 2.369e-54
Identity = 141/528 (26.70%), Postives = 239/528 (45.27%), Query Frame = 1
Query:  112 LYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYPYFKIF--LNKNDKRAVINGIPTSIEHGTVEDVFKDTI-SLIDSYFQPKPFIEFNKDNIVL------KNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNE------------------SQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSG--FKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTV--NQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTV 1593
            LY+  D + + +  S        +   W ++F+ S+CGHCI FAP +K    + K W   +   V+DC+ E   A+C+  NI  +P  + F    KN   A + G   +++  T+     D + S  D++    P +E  K N +       K  YL +    +   + + L     L    Y+  +          LVN+                  S++ +++   S       GL     D       T ++      ++ T  +F+    +Y  D+ +++ Y L  +V    +     L+ LKKF+  L + F G    +N L S N+   ++  +    I    F  + +S  E + L   +++W+GC GS+P++R +PC LW  FH LTV  N+Y +++PQ     +   +++++R ++  FF C++CA +F++  A    +V S   A+L+LW  HN VN RLS A SEDP +PK+ +PP  +C  C   LN   P    W  G    +L  H+S  N V
Sbjct:   38 LYSSSDPLTLLDADSVRPTVLG-SSSAWAVEFFASWCGHCIAFAPTWKELANDVKDWRPALNLAVLDCAEETNSAVCREFNIAGFPTVRFFQAFTKNGSGATLPGAGANVQ--TLRMRLIDALESHRDTWPPACPPLEPAKLNDIDGFFTRNKADYLAL----VFEREDSYLGREVTLDLSQYHAVAVRRVLNTESDLVNKFGVTDFPSCYLLLRNGSVSRVPVLVESRSFYTSYLRGLPGLTRD----APPTTATPVTADKIAPTVWKFADRSKIYMADLESALHYILRVEVGKFSVLEGQRLVALKKFVAVLAKYFPGQPLVQNFLHSIND---WLQKQQKKRIPYSFFKAALDSRKEDAVLTE-KVNWVGCQGSEPHFRGFPCSLWVLFHFLTVQANRYSEAHPQ--EPADGQEVLQAMRSYVQFFFGCRDCADHFEQMAAASMHQVRSPSNAILWLWTSHNRVNARLSGALSEDPHFPKVQWPPRELCSACHNELNGQVPL---WDLGATLNFLKAHFSPANIV 545          
BLAST of Sulfhydryl oxidase vs. Ensembl Mouse
Match: Qsox2 (quiescin Q6 sulfhydryl oxidase 2 [Source:MGI Symbol;Acc:MGI:2387194])

HSP 1 Score: 123.25 bits (308), Expect = 3.650e-29
Identity = 55/162 (33.95%), Postives = 92/162 (56.79%), Query Frame = 1
Query: 1117 ELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQ--YLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVN 1596
             + W+GC GS+   R YPC LW  FH LTV    + ++      + +   ++++IR +I +FF C+EC ++F++   +    V +   AVL+LW+ HN VN RL+   SEDPK+PK+ +P   +C  C   +  +    + W +G+   +L +HYS+ N V+
Sbjct:  241 HVKWVGCQGSRLELRGYPCSLWKLFHTLTVQASTHPEALAGTGFEGHPQAVLQAIRRYIRTFFGCKECGEHFEEMAKESMDSVKTPDQAVLWLWRKHNMVNSRLAGHLSEDPKFPKVPWPTPDLCPACHEEIKGL----DSWNEGQVLLFLKQHYSRDNLVD 398          
BLAST of Sulfhydryl oxidase vs. Ensembl Mouse
Match: Qsox2 (quiescin Q6 sulfhydryl oxidase 2 [Source:MGI Symbol;Acc:MGI:2387194])

HSP 1 Score: 124.02 bits (310), Expect = 4.920e-29
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 1
Query: 1117 ELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQ--YLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVNF----QTQPSLLLRT 1629
             + W+GC GS+   R YPC LW  FH LTV    + ++      + +   ++++IR +I +FF C+EC ++F++   +    V +   AVL+LW+ HN VN RL+   SEDPK+PK+ +P   +C  C   +  +    + W +G+   +L +HYS+ N V+     Q  P  +LR 
Sbjct:  406 HVKWVGCQGSRLELRGYPCSLWKLFHTLTVQASTHPEALAGTGFEGHPQAVLQAIRRYIRTFFGCKECGEHFEEMAKESMDSVKTPDQAVLWLWRKHNMVNSRLAGHLSEDPKFPKVPWPTPDLCPACHEEIKGL----DSWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGSVLRA 578          

HSP 2 Score: 72.0182 bits (175), Expect = 1.632e-12
Identity = 37/120 (30.83%), Postives = 60/120 (50.00%), Query Frame = 1
Query:   49 LKMKYFAIILFLYFVA-------WSNAQLYNEM-DNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF 378
            L+      +LFL  V           A+LY E  D V + +  S  S   N +   W +QF+ S+CGHCI +AP ++A   + + W   +R   +DC+ E+   +C++ +I  YP F+ F
Sbjct:   21 LRAARLPRLLFLLAVVAAVGPREGGGARLYREGSDAVWLLDSGSVRSATGN-SSAAWLVQFHSSWCGHCIGYAPTWRALAADVRDWAAAIRVAALDCAEEKNQDVCRTYDIHFYPTFRYF 139          
BLAST of Sulfhydryl oxidase vs. UniProt/SwissProt
Match: sp|Q8BND5|QSOX1_MOUSE (Sulfhydryl oxidase 1 OS=Mus musculus OX=10090 GN=Qsox1 PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.657e-53
Identity = 141/528 (26.70%), Postives = 239/528 (45.27%), Query Frame = 1
Query:  112 LYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYPYFKIF--LNKNDKRAVINGIPTSIEHGTVEDVFKDTI-SLIDSYFQPKPFIEFNKDNIVL------KNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNE------------------SQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSG--FKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTV--NQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTV 1593
            LY+  D + + +  S        +   W ++F+ S+CGHCI FAP +K    + K W   +   V+DC+ E   A+C+  NI  +P  + F    KN   A + G   +++  T+     D + S  D++    P +E  K N +       K  YL +    +   + + L     L    Y+  +          LVN+                  S++ +++   S       GL     D       T ++      ++ T  +F+    +Y  D+ +++ Y L  +V    +     L+ LKKF+  L + F G    +N L S N+   ++  +    I    F  + +S  E + L   +++W+GC GS+P++R +PC LW  FH LTV  N+Y +++PQ     +   +++++R ++  FF C++CA +F++  A    +V S   A+L+LW  HN VN RLS A SEDP +PK+ +PP  +C  C   LN   P    W  G    +L  H+S  N V
Sbjct:   38 LYSSSDPLTLLDADSVRPTVLG-SSSAWAVEFFASWCGHCIAFAPTWKELANDVKDWRPALNLAVLDCAEETNSAVCREFNIAGFPTVRFFQAFTKNGSGATLPGAGANVQ--TLRMRLIDALESHRDTWPPACPPLEPAKLNDIDGFFTRNKADYLAL----VFEREDSYLGREVTLDLSQYHAVAVRRVLNTESDLVNKFGVTDFPSCYLLLRNGSVSRVPVLVESRSFYTSYLRGLPGLTRD----APPTTATPVTADKIAPTVWKFADRSKIYMADLESALHYILRVEVGKFSVLEGQRLVALKKFVAVLAKYFPGQPLVQNFLHSIND---WLQKQQKKRIPYSFFKAALDSRKEDAVLTE-KVNWVGCQGSEPHFRGFPCSLWVLFHFLTVQANRYSEAHPQ--EPADGQEVLQAMRSYVQFFFGCRDCADHFEQMAAASMHQVRSPSNAILWLWTSHNRVNARLSGALSEDPHFPKVQWPPRELCSACHNELNGQVPL---WDLGATLNFLKAHFSPANIV 545          
BLAST of Sulfhydryl oxidase vs. UniProt/SwissProt
Match: sp|Q6IUU3|QSOX1_RAT (Sulfhydryl oxidase 1 OS=Rattus norvegicus OX=10116 GN=Qsox1 PE=1 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 3.069e-53
Identity = 142/531 (26.74%), Postives = 240/531 (45.20%), Query Frame = 1
Query:  112 LYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYP---YFKIFLNKNDKRAVINGIPTSIEHGTVE-----DVFKDTISLIDSYFQPKPFIEFNKDNIVLKNPYL-LITGSQIVNLKRAI---LSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEKLYEGL---NSYLEDPIIINNRTKSSNFAVST---MSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSG--FKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVNFQTQPSLLLRTST 1635
            LY+  D + + +  +        +   W ++F+ S+CGHCI FAP +K    + K W   +   V+DC+ E   A+C+  NI  +P   +FK F +KN     +     +++   +      +  +DT        +P    + N+     K  YL LI   +   L R +   LS  + +         S   ++++++      + +     S +  L E      SYL     +      +  A  T   ++ T  +F+    +Y  D+ +++ Y L  +V    +     L+ LKKF+  L + F G    +N L S N+   ++  +    I    F  + +S  E + L   +++WIGC GS+P++R +PC LW  FH LTV  +  S   P    +   +++++R ++ SFF C++CA +F++  A    +V S   AVL+LW  HN VN RLS A SEDP++PK+ +PP  +C  C   +N   P    W  G    +L  H+S  N V     P    R  T
Sbjct:   38 LYSSSDPLTLLDADTVRPAVLG-SSSAWAVEFFASWCGHCIAFAPTWKELANDVKDWRPALNLAVLDCADETNSAVCREFNIAGFPTVRFFKAF-SKNGTGTALPAAGANVQTLRMRLIDALESHRDTWPPACPPLEPAKLKDINEFFTRSKAEYLALIFEREDSYLGREVTLDLSQFHAVAVRRVLNSESDVVSKFAVTDFPSCYLLLRNGSVSRVPVLVESRPFYTSYLRGLPGLTREAPPTTAAPVTPDKIAPTVWKFADRSKIYMADLESALHYILRVEVGKFSVLEGQRLVALKKFVAVLAKYFPGQPLVQNFLHSIND---WLQKQQKKKIPYSYFKAALDSRKENAVLAE-KVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAHRYSEAHPQEPADGQEVLQAMRSYVQSFFGCRDCANHFEQMAAASMHQVKSPSNAVLWLWTSHNRVNARLSGALSEDPQFPKVQWPPRELCSACHNEVNGQVPL---WDLGATLNFLKAHFSPANIVRDPPAPGPASRRGT 559          
BLAST of Sulfhydryl oxidase vs. UniProt/SwissProt
Match: sp|O08841|QSOX1_CAVPO (Sulfhydryl oxidase 1 OS=Cavia porcellus OX=10141 GN=QSOX1 PE=1 SV=2)

HSP 1 Score: 188.348 bits (477), Expect = 4.636e-50
Identity = 145/532 (27.26%), Postives = 238/532 (44.74%), Query Frame = 1
Query:  106 AQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYP---YFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQPKP-----------------FIEFNKDNIVL----KNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEKLYEGLN---SYLEDPIIINNRTKSSNFAVSTMSS----TTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSG--FKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTV 1593
            A LY+  D + +    +  S   N +   W ++F+ S+CGHCI FAP +KA  K+ K W   +    ++C+ E   A+C+  NI  +P   +FK F +KN       G    +    V+ + +  I  ++S+    P                 F   N++ +VL    +N YL   G ++       LS H+ L         ++   ++ ++      +       S +  L E      +YL+  +    R  +   AV T+S     T  +F+    +Y  D+ +++ Y L  +V    +     L+ LKKF+  L + F G     N L+S N  ++    K       K    S N     +K    E++W+GC GS+ ++R +PC LW  FH LTV    K+        N   ++++IR ++  FF C++CA +F++  A     V S   AVL+LW  HN VN RL+ APSEDP++PK+ +PP  +C  C   L+     E  W      ++L  H+S  N V
Sbjct:   34 AALYSASDPLTLLQADTVRSTVLN-SPSAWAVEFFASWCGHCIAFAPTWKALAKDIKDWRPALNLAALNCADETNNAVCRDFNIAGFPSVRFFKAF-SKNS-----TGTTLPVAGANVQMLRERLIDALESHHDTWPSACPPLEPVKPKEIDTFFARNNQEYLVLIFEQENSYL---GREVT----LDLSQHHDLVVRRVLSTEANVVRKFGVADFPSCYLLFRNGSVSRVPVLVESRRFYTAYLQR-LSEVTREGTPTPAVPTISDQIAPTVWKFADRSKIYMADLESALHYILRVEVGRFSVLEGQRLMALKKFVTVLTKYFPGQPLVRNFLQSTNEWLKRQHKKKMPYSFFKTAMDSRNEEAVITK----EVNWVGCQGSESHFRGFPCSLWILFHFLTVQASQKNAESSQKPANGQEVLQAIRNYVRFFFGCRDCANHFEQMAAGSMHRVKSPNDAVLWLWTSHNRVNARLAGAPSEDPQFPKVQWPPPELCSACHNELS----GEPVWDVDATLRFLKTHFSPSNIV 542          
BLAST of Sulfhydryl oxidase vs. UniProt/SwissProt
Match: sp|H2N4I1|QSOX1_PONAB (Sulfhydryl oxidase 1 OS=Pongo abelii OX=9601 GN=QSOX1 PE=3 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 3.620e-49
Identity = 138/528 (26.14%), Postives = 242/528 (45.83%), Query Frame = 1
Query:   94 AWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYP---YFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTI-SLIDSYFQPKPFIEFNK----DNIVLKN--PYLLI---TGSQIVNLKRAI-LSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEKLYEGLN---SYLEDPIIINNRTKSSNFAVST---MSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSG--FKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC---RISLNLIWPTENQWRKGKAFQYLVEHYSQINTV 1593
            A   + LY+  D + +    +        +   W ++F+ S+CGHCI FAP +KA  ++ K W   +    +DC+ E   A+C+  NI  +P   +FK F  KN   AV       ++  T+ +   D + S  D++    P +E  +    D    +N   YL +    G   +  + A+ LS H  +         ++   ++ ++      +       S +  L E  +   +YL+    +      +  A +T   ++ T  +F+    +Y  D+ +++ Y L  +V    +     L+ LKKF+  L + F G    +N L S N    ++  +  + I    F  + +   E + L   +++WIGC GS+P++R +PC LW  FH LTV    ++  +      A  ++ +IR ++  FF C++CA +F++  A     V S   AVL+LW  HN VN RL+ APSEDP++PK+ +PP  +C  C   R+ +  +W  E          +L  H+S  N +
Sbjct:   32 AAPRSALYSPSDPLTLLQADTVRGAVLG-SRSAWAVEFFASWCGHCIAFAPTWKALAEDVKAWRPALNLAALDCAEETNSAVCRDFNIPGFPTVRFFKAF-TKNGSGAVFPVAGADVQ--TLRERLIDALESHHDTWPPACPPLEPARLEEIDGFFARNNEEYLALIFEKGGSYLGREVALDLSQHKGVAVRRVLNTEANVVRKFGVTDFPSCYLLFRNGSVSRVPVLMESRSFYTAYLQRLSGLTREAAQTTVAPTTANKIAPTVWKFADRSKIYMADLESALHYILRIEVGRFPVLEGQCLVALKKFVAVLAKYFPGRPLVQNFLHSVNE---WLKRQKRNKIPYSFFKTALDDRKEGAVLAK-KVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQNIDRSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVRSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVP-VWDVE------ATLNFLKAHFSPSNII 544          
BLAST of Sulfhydryl oxidase vs. UniProt/SwissProt
Match: sp|Q8JGM4|QSOX1_CHICK (Sulfhydryl oxidase 1 OS=Gallus gallus OX=9031 GN=QSOX1 PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 5.106e-49
Identity = 138/532 (25.94%), Postives = 245/532 (46.05%), Query Frame = 1
Query:  112 LYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYPYFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQPKPFIEFNKDNIVLKNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSS-NATEYSLSLVNESQINIIINK-YSSIEKLYE--GLNSYLEDPIIINNRTKSS-----------NFAVSTMSSTTL-------------QFSTLYP-------VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENI---LESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQIN 1587
            LY+  D + +    + E      +   W ++F+ S+CGHCI+FAP ++A  ++ + W   +    +DC+ E  + +C    IT +P  K F   + K    +GI  +    TV D+ +  I+           +E + D      P L    ++ V   R+    +      L +++S+S    E +L L+     N+ + +  SS E+L E  G+ ++    +++ N + S             + + T+S  T              +   L P       VY  D+ ++V Y L  +     +     L  LK ++  L ++   + ++   L+S ++ +R            K+  K+      A+ LP   ++W+GC GS+P++R YPCGLWT FH+LTV     +   PD +E  + ++ ++R ++  FF CQECAQ+F+   A    +V S + AVL+LW  HN VN RL+   +EDP++PK+ +PP  +C +C      +    + W +     +L EH+S  N
Sbjct:   45 LYSPSDPLELLGADTAERRLLG-SPSAWAVEFFASWCGHCIHFAPTWRALAEDVREWRPAVMIAALDCADEANQQVCADFGITGFPTLKFFRAFSKK--AEDGIRIAHPTATVADLRRAIIT----------NLEQSGDAWPPACPPLEPASAEEV---RSFFHRNTERYLALIFEQSNSFVGREVALDLLQYE--NVAVRRVLSSEEELVEKFGVTTFPSAYLLLRNGSFSRLPVHAEARSFYTYYLQTLSGVTRGSYRLNVTGSAINETRALQPAQADRSKVYVADLESTVHYTLRVEAGRPAVLAGAQLAALKCYVATLAKYFPGRPSVQTFLQSLDSWLRNWTEPELPRSALKEAVKNKEDASPAAVLPT-NVTWVGCRGSEPHFRGYPCGLWTIFHLLTVQ---AAQGGPD-EELPLEVLNTMRCYVKHFFGCQECAQHFEAMAAKSMDQVKSRREAVLWLWSHHNEVNARLAGGDTEDPQFPKLQWPPPDMCPQCHREERGV----HTWDEAAVLSFLKEHFSLGN 549          
BLAST of Sulfhydryl oxidase vs. TrEMBL
Match: C3ZHZ6 (Sulfhydryl oxidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_88784 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 3.968e-55
Identity = 149/562 (26.51%), Postives = 257/562 (45.73%), Query Frame = 1
Query:  106 AQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERAL--CKSKNITHYPYFKIFL----NKND--KRAVINGIPTSIEHGTVEDVFKDTI---------------SLIDSYFQPKPFIEF------NKDNIVLKNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSS------NATEYSLSLVNESQIN--IIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILE----ASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTV-------------NFQTQPSLLLRT 1629
            A+LY+E D V   +  S      N+  + + ++FY S+CGHC+NFAP +KA  ++ + W  V++   IDC+  + L  C+  +I  YP  K+F     N +D  K   +      + H  V+ + + ++               S +  +FQ    +E+        D+ V K   L +     + ++R +L     L   L  +   S      N +   L+   E++ +  + + K   +++        L  P   +  T     A  T S      S    V+  D+ +++ Y+   ++   +      L  ++ F+  L ++      +    +NI R ++ +   M       + W  +L+    AS LP  E+ W+GC GS+P+ R Y C LW  FH LTV Q      +PD  +N+ +++ ++R +I + F CQEC +NF+KE    ET+V +   AVL+LW+ HN VNKRL    SEDP++PK+ FPP  +C  C ++      TE  W +G+  Q+L  HY   N +             +F  QP+++ R+
Sbjct:   23 AELYSEEDAVVRLDAVSLNRTIYNVP-NVFLVEFYSSWCGHCVNFAPTWKALARDTQDWAEVIQLAAIDCADSKNLPTCRQYDIKGYPTIKVFQPFTQNTSDIGKPLKVGRASDKLVHAMVDVIEQHSLLNKPQHWPNLQPAHSSEVSEFFQTWKNVEYLALLFEANDSYVGKQVILDMAKHDNIMVRR-VLKNEEMLMKKLAVEVVPSLYVLYRNGSAIQLARGGETRFDFRLALKKLPHLDRSQRHGEQLLLQP---SAPTLEKTTAPRTPSMDNFNRSA---VHMTDLLSALTYSFKQEIAGRQELEGQTLQAVQDFVKVLAKYFPGPPGVSAFLHNINRRLNPRKTKMT-----YQEWAQLLDEQEDASALPQ-EVRWVGCQGSQPHGRGYSCSLWLLFHTLTVQQAA----EPDPTQNSQSVLLAMRAYITTMFGCQECGKNFQKEAVTMETDVATPDEAVLWLWRTHNRVNKRLHGDLSEDPQFPKVQFPPPWLCPSCHLAQGP--ETEPVWDEGQVLQFLKRHYGSANFIHDNPSLQSKDQGPHFHVQPTMVRRS 564          
BLAST of Sulfhydryl oxidase vs. TrEMBL
Match: A0A1Z5LCM6 (Sulfhydryl oxidase (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 8.186e-53
Identity = 154/551 (27.95%), Postives = 244/551 (44.28%), Query Frame = 1
Query:   70 IILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERAL--CKSKNITHYPYFKIFLNKN---DKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQPK-------PFIEFNKDNIVL-----KNPYLLITGSQIVNLKRA-ILSYHNRLTFDLYYQRSSSNATEYSLSLVN-------------ESQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQF---SGFKENILESFN-------------NIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQ 1581
            +I+F   V  + A LY    N+   N T++  V +   E  W I +Y  +CGHC  +AP+F  F  + K W+ V++  VIDC++   L  C+   +  YP  K         DK  +   I T      V+ + + TI  +      K       P ++    + +       +  LL+  +Q   L R  IL Y N  T  ++    S+ A    L  +               S+   I+ K SS E   E   + L      N    ++  +   +++T         VY  D+  +++  LT++V      N   L +L+ F+  L  +   S  + + L                 +I RF+ A  N+  G                LP L   ++GC GSKP YR +PC LW  FH LTVN +  +Y + +T E  + ++++I+ F++ FFSC+ECA+NF KET + E E+++ + +VLYLW VHN VN RL+   +EDP  PK+AFPP  +C  CR S         +W +    ++L   Y Q
Sbjct:   43 LIVFTLAVQVATANLYRGAKNIRELNSTNFYDVVTG-KEHVWVINYYKHWCGHCQRYAPIFSLFANDVKGWSNVVQVAVIDCAMPENLDVCRGNGVKLYPAVKFHPACATVWDKGHLWETIKT------VKSLREQTIDFLQGGNASKCTQEPSWPSLDATNASALAGLREEADRVLLVLENQDSYLGRELILDYSNSGTTKVFRVLPSNRALSSELKALGAPGNYATLYLIEKHSERPKILAKVSSAEGAREVFKAAL------NQEETATESSPDILTTTYRPLVDPSKVYKDDLEKALYLILTHEVPVHTTLNETQLAVLRNFVDVLVDYFPGSPSEHDFLGRLRTYLWNARPGVRGEDISRFLQALTNAGQG----------------LPPLR-EYVGCRGSKPQYRGFPCSLWMLFHSLTVNAH-ATYKEGNTDE-PLKVLRAIKSFVLHFFSCRECAENFAKETMNMEEEIENPEDSVLYLWSVHNRVNARLAGDETEDPLRPKVAFPPPRLCPTCRKS--------GRWDQAAVLEFLHSFYGQ 553          
BLAST of Sulfhydryl oxidase vs. TrEMBL
Match: A0A1U7U8H3 (Sulfhydryl oxidase OS=Tarsius syrichta OX=1868482 GN=QSOX1 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 3.772e-52
Identity = 142/525 (27.05%), Postives = 236/525 (44.95%), Query Frame = 1
Query:   94 AWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYP---YFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTI-SLIDSYFQPKPFIEFNK----DNIVLKN--PYLLI----TGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEKLYEGLNSY------LEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSG--FKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTV 1593
            A   + LY+  D + +    S        +   W ++F+ S+CGHCI FAP++KA  K+ K W   +    +DC+ E   A+C+  NI  +P   +FK F +K+   A +      ++  T+ +   D + S  D++    P +E  K    D    +N   YL +     GS +       LS H+ +              ++ ++      +       S +  L E  ++Y      L  P      T  +      ++ T  + +    VY  D+ +++ Y L  +V    +     L+ LKKF+  L Q F G    +N L S N    ++  +    I    F  + ++  E + L   +++W+GC GS+P++R +PC LW  FH LTV     S   P  K  A  ++++IR ++  FF C++CA +F++  A    +V+S   AVL+ W  HN VN RL+ APSEDP++PK+ +PP  +C  C   L      E  W       +L  H+S  N V
Sbjct:   28 AAPRSALYSPSDPLTLLRADSVRHAVLG-SRSAWAVEFFASWCGHCIAFAPIWKALAKDVKDWRPALNLAALDCADETNIAVCRDFNILGFPTVRFFKAF-SKDGLGATLPVAGADVQ--TLRERLIDALGSHRDTWPLACPPLEPAKLEEIDGFFARNNAEYLALIFEKEGSYVGREVTLDLSQHHGMVVRRVLNTEDDVVKKFGVTHFPSCYLLFRNGSVSQVPVLMESRSAYTTYLQSLSGPTREAAPTSVAPTTAKKIAPTVWKLADHSKVYMADLESALHYILRVEVGKFSVLEGQRLVALKKFVAVLAQYFPGQPLVQNFLHSVNE---WLKKQQRKKIPYSFFKTALDNRKEGAVLAK-KVNWVGCQGSEPHFRGFPCSLWVLFHFLTVQASQHSAGHPQEKAQAQEVLQAIRGYVRFFFGCRDCASHFEQMAAGSMQQVESLDQAVLWFWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNELR----GEPVWDVDATLHFLKAHFSPSNIV 540          
BLAST of Sulfhydryl oxidase vs. TrEMBL
Match: A0A444T1W5 (Sulfhydryl oxidase OS=Armadillidium vulgare OX=13347 GN=Avbf_04968 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 7.269e-52
Identity = 165/570 (28.95%), Postives = 269/570 (47.19%), Query Frame = 1
Query:   52 KMKYFAI-------ILFLYFVAWSNAQLYNEMDNVNIFN-KTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF--------LNKNDKRAVINGIPTSI---------------------------EHGTVEDVFKDT----------ISLIDSYFQPKPFIEFNKDNIVL-----------------KNPYLLI---TGSQIVNLK--------RAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEKLYEGLNSYLEDPIIINNR--TKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKIN-SMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDT--KENAINLIKSIREFIISFFSCQECAQNFKKE-TADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC 1494
            K+KYF++       I  L F A +N  LYN  D + +   K  YE++ S  +++ W ++FY+S+CGHCI+FAP ++ F KE K WN  ++  VIDCS E   ++C+   +  YP  ++F        + K+ K   +NG+ + I                             GT++D+FK++          +   DS       ++  K  +VL                 K P +L+    G+  V L+         A++ +H RLT +L     +  A +   S + +      +N+   IE   +G    LE+   IN++      +   +  S+  +Q + +      DI   + YAL ++VT  K+   + L  LK F+    ++  F+ ++L   + +  F+  K + S +  +K  K   S    +KLP+ +  W  C GS+P YR YPCGLWT FH LTVN ++    Q D     N +  +K+I  ++ +FFSC+ C+++F++    D ET V S    V++LW+ HN VNKRL    SEDPK+PK  FP +  C KC
Sbjct:    8 KIKYFSVVNMFSKVIFLLLFTALANGDLYNSSDPMVLLTAKNFYETILS--SKNGWIVEFYNSWCGHCISFAPKWREFSKEIKDWNHTIKAAVIDCSDEENVSICRDYEVMGYPSIRLFGANTQKGKIGKSVKNRGVNGMQSEIIDFIIDEEQSHMANKSKIPSSWVNLLSYQGTLKDIFKESSLDVKNAVLIVEKGDSKVACHSILDLAKYPMVLVRRINSEAAELKAFNLNKFPSVLVIPRKGNTKVLLEDASTPEEITALIFHHLRLTRNLLQMNDALTAYKSLDSKLKQ------VNEREDIEGAGDG---NLEE---INSQRLNYDDDLPDAAFSNAHVQVNMV------DIENGISYALRHEVTLHKVLEGETLEALKSFVTVTAKYMPFRPSLLSFLSKLREFLAHKKSLSGVEFEKILKELES--SDAKLPDKQ-PWRECQGSEPKYRGYPCGLWTLFHSLTVNAFM----QKDKFYHYNPLESLKAIHGYVKNFFSCEYCSKHFQEMYKLDAETSVKSPGDEVIWLWRAHNKVNKRLHGDLSEDPKHPKEQFPSKVTCPKC 550          
BLAST of Sulfhydryl oxidase vs. TrEMBL
Match: A0A023GD84 (Sulfhydryl oxidase (Fragment) OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 9.528e-52
Identity = 145/556 (26.08%), Postives = 251/556 (45.14%), Query Frame = 1
Query:   52 KMKYF---AIILFLYF-VAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDS-----YFQPKPFIEFNKDNIVLKNPYL-----LITGSQIVNLKRAILSYHNRLTFDLYYQRS--------SSNATEYSLSLVNESQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYP-------------------VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKE-NAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTV 1593
            K+ +F    I+LF     A   A LY+    + + N TS++ V  N  E+ W +QFY+ +CGHCI F+P+F+AF  +   W  V+   VIDC      C++  I  YP  K F  +        G+     H  ++ +    + L+DS       +P  +  F     V     L      +T +QI+ ++R        +T +L  ++S        SS+++     L +E+    +  +++ +  L+   N      + +N    S    +  +       S+  P                   VY  D+  ++ Y+L  +V   +L N   L +L  F+  L ++    E++  +  ++  F+ +     +  +  +   N   +   LP +   + GC GS+P  R YPC LW  FH LTV+ Y  S   P  ++ + +++++++R+++  FFSC+ CA +F     D +TEV +++ AVL+LW+ HN VN RL+   SEDP +PK  FPP S+C  CR           QW +  +  +L+  YS    V
Sbjct:   13 KLSFFLGAGILLFSRVSFALGLASLYDPSMPLEVLNATSFQKVILN-KENAWLVQFYNHWCGHCIKFSPIFRAFANDVAGWKPVIGLAVIDCVDYMQTCRTYGINSYPTIKFF--RAHSTLHDRGVEVETRH-NLDQLRHQAVDLVDSKDSYRGKRPASWPTFEPLQGVRSIEELWQNVPAMTDTQILVVERNASYIGKEVTLELSSRQSTYVWRLVVSSDSSWLESLLPHETDAADV--RWADLYALHR--NGSTTRILRLNEENGSRELVLQALEPYVRVASSTPPPTSATTEPPEEINQVDTSRVYLADLNNALAYSLRQEVAGHQLLNRTELAVLVHFVDVLLKYFPGSESMKHTLKSLHAFVTSSGADSLRGEDLSAFLN---KQDDLPAVG-PYEGCRGSRPDLRGYPCALWMLFHSLTVSAYHTSGGYPLGRDASGLDVLQAVRDYVTHFFSCRYCAAHFGAMAKDLDTEVRTTRDAVLWLWRAHNKVNARLAGDISEDPLHPKQPFPPPSLCSDCR--------EGTQWNEQHSLGFLLRFYSPGGLV 548          
BLAST of Sulfhydryl oxidase vs. Ensembl Cavefish
Match: qsox1 (quiescin Q6 sulfhydryl oxidase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7019])

HSP 1 Score: 193.741 bits (491), Expect = 6.233e-52
Identity = 142/547 (25.96%), Postives = 248/547 (45.34%), Query Frame = 1
Query:   70 IILFLYFVAWSN---AQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYPYFKIFLNKNDKRAV---INGIPTSIEHGTVEDVFKDTISLIDSYFQPKPFIEFNKDNIVLKNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEK---------------LYEGLNSYLEDPIIINNRTKSSNFAVSTM-----------SSTTLQFS-TLYP--------VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNS-ILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYS 1578
            ++  L    WS+   A LY+  D V + +  S   +F+  T   + ++ Y ++CGHC  FAPVF++  ++   W   +    IDC+ E  R  C S  +T YP  K F   +   +V   + G P       V+ + +  I  ++S+ +P P             P    + +++     +    H  L F+   +  S    E +L L+     NI + +  S EK               LY    +Y   P+++  RT  S +A+  +           S + LQ + T  P        VY  D+ +++ Y+L  +++     + D+L  LK++I  L ++   +  I  +   +  ++  +  + I    F K+ +S +L    +    + W+GC GS+P YR YPC +WT FHVLTV        +     + + +++++R ++ SFF C+ CA +F+    +  ++V S   AVL+LW  HN VN RL+  PSEDP +PKI +P   +C  C    +L    E+ W K +   +L  ++S
Sbjct:   23 LLCALLAAVWSSGARAGLYSPGDRVRVVDADSVPQLFN--TSSAFLLELYATWCGHCAAFAPVFRSLARDISEWKPAVDLVAIDCAEEENRKACTSLGVTGYPSLKFFPAYSSNESVGESLRGFPRD-----VQGLRRLVIDRLESHKEPGP---------PACPPLEPASAAEVDGFYESNKDQHLALVFE---KNDSYVGREVTLDLLQYE--NIAVRRVLSSEKDLVSRLGVTEFPSCYLYYTDTNYTRLPVLMEARTFYS-YALQRLPGVVRAGKPLPSDSDLQRNYTEEPWRSFNRSRVYMSDLESALHYSLRVELSAHTTISGDDLTALKQYITVLTKYFPGRPAIKGALKAVENWLQEQEGTEIQYSDFRKALDSTVLSGDAVLPAGVRWVGCQGSQPQYRGYPCAVWTLFHVLTVQA------KASGSTDGLEVLRAMRAYVSSFFGCRPCATHFESMAQESLSDVTSPATAVLWLWSRHNQVNNRLAGEPSEDPHFPKIQWPTPELCPSCH---SLKNGGEHSWSKDQVLDFLYNYFS 538          
BLAST of Sulfhydryl oxidase vs. Ensembl Cavefish
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:NCBI gene;Acc:103023271])

HSP 1 Score: 177.563 bits (449), Expect = 7.315e-47
Identity = 146/562 (25.98%), Postives = 246/562 (43.77%), Query Frame = 1
Query:   73 ILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYP---YFKIFLNKNDKRAVINGI-----------------------PTS---IEHGTVEDVFKDTISLIDSYFQPKPFIEFNKDNIVLKNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINK-----YSSIEKLYEGLN----SYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEAS----KLPNLELS----WIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDT------KENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC---RISLNLIWPTENQWRKGKAFQYLVEHYSQIN 1587
            IL   F      +LY E D V I    + +    N +   W +QFY S+CGHCI ++P +KA   + K W+  +R GV+DC+ E+   +CK  +I  YP   YFK  +   D      G                        P S   +E    ED+        + Y      I  + D+ V +   L +   Q V +KRA+    N     +     S+  T Y L   N +   + + K     YSS  KL  G++    + ++ P  I N+ + SN        +         VY  D+ + + Y L  ++   K    + L   K F+  + +       +     ++V+ ++  +  ++        +++IL+ +    ++  L LS    W+GC GS    R YPC LWT FHVLTV    ++  +PD       +++ + +++++R +I +FF C+EC ++F++   +  ++V S   AVL+LW+ HN VN RL+ + SEDP +PK  +P   +C  C   R  L++       W +     +L +HY   N
Sbjct:   28 ILTAAFRCGQATRLYTEEDPVVILTSDNLKQTLLN-SSTAWLLQFYSSWCGHCIQYSPTWKALAGDVKDWSQAIRIGVLDCAHEKNFDICKEFSIHFYPTFRYFKAHVTTADIGKTYRGADRELQTVRQLMVNFLQNHTRQDWPASCPPLEPARTEDILSLMGQKSEHY---TAVIIEDGDSYVGREVILDLMPYQGVVVKRAL----NSEKLLMEKLGISTVPTAY-LFHPNGTHAVMEVQKRLRFFYSSFLKLLPGVHRKQATSVQQPAQIANKGQGSNEVWKEFDKSK--------VYMVDLESGLHYLLRVELATHKTLEGEELKTFKDFVTVVAK-------LFPGRQSVVKLLETLLEWLVSLPLEKIPYDAILDLADNKMRISGLYLSEHVQWVGCQGSSVALRGYPCSLWTLFHVLTV----QAASRPDALANTALEDDPLAVLQTMRRYIGTFFGCRECGKHFEEMAQESISQVKSLDEAVLWLWRRHNQVNARLAGSMSEDPMFPKTQWPTPDLCPTCHEEREGLHV-------WNEDMVLVFLKQHYGAAN 554          
BLAST of Sulfhydryl oxidase vs. Ensembl Cavefish
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:NCBI gene;Acc:103023271])

HSP 1 Score: 171.4 bits (433), Expect = 5.400e-45
Identity = 140/548 (25.55%), Postives = 244/548 (44.53%), Query Frame = 1
Query:   73 ILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKNDK------RAVINGI--------PTS---IEHGTVEDVFKDTISLIDSYFQPKPFIEFNKDNIVLKNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINK-----YSSIEKLYEGLN----SYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEAS----KLPNLELS----WIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDT------KENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC---RISLNLIWPTENQWRKGKAFQYLVEHYSQIN 1587
            IL   F      +LY E D V I    + +    N +   W +QFY S+CGHCI ++P +KA   + K W+  +R GV+DC+ E+     K         ++L   D+      + ++N +        P S   +E    ED+        + Y      I  + D+ V +   L +   Q V +KRA+    N     +     S+  T Y L   N +   + + K     YSS  KL  G++    + ++ P  I N+ + SN        +         VY  D+ + + Y L  ++   K    + L   K F+  + +       +     ++V+ ++  +  ++        +++IL+ +    ++  L LS    W+GC GS    R YPC LWT FHVLTV    ++  +PD       +++ + +++++R +I +FF C+EC ++F++   +  ++V S   AVL+LW+ HN VN RL+ + SEDP +PK  +P   +C  C   R  L++       W +     +L +HY   N
Sbjct:   11 ILTAAFRCGQATRLYTEEDPVVILTSDNLKQTLLN-SSTAWLLQFYSSWCGHCIQYSPTWKALAGDVKDWSQAIRIGVLDCAHEKNFDICKEFFKMISVGLWLTGADRELQTVRQLMVNFLQNHTRQDWPASCPPLEPARTEDILSLMGQKSEHY---TAVIIEDGDSYVGREVILDLMPYQGVVVKRAL----NSEKLLMEKLGISTVPTAY-LFHPNGTHAVMEVQKRLRFFYSSFLKLLPGVHRKQATSVQQPAQIANKGQGSNEVWKEFDKSK--------VYMVDLESGLHYLLRVELATHKTLEGEELKTFKDFVTVVAK-------LFPGRQSVVKLLETLLEWLVSLPLEKIPYDAILDLADNKMRISGLYLSEHVQWVGCQGSSVALRGYPCSLWTLFHVLTV----QAASRPDALANTALEDDPLAVLQTMRRYIGTFFGCRECGKHFEEMAQESISQVKSLDEAVLWLWRRHNQVNARLAGSMSEDPMFPKTQWPTPDLCPTCHEEREGLHV-------WNEDMVLVFLKQHYGAAN 523          
BLAST of Sulfhydryl oxidase vs. Ensembl Cavefish
Match: pdia6 (protein disulfide-isomerase A6-like [Source:NCBI gene;Acc:103041928])

HSP 1 Score: 56.9954 bits (136), Expect = 3.626e-8
Identity = 42/190 (22.11%), Postives = 76/190 (40.00%), Query Frame = 1
Query:  160 ESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYW-NWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKNDKRAVINGIPTSIEHG-TVEDVFKDTISLIDSYFQPKPFIEFNKDNIVLKN------------PYLLITGSQIVN-----LKRAILSYHNRLTFDLYYQRSSSNATEYSLSL 672
            E VF   ++D W ++F+  +CGHC N  P + A   + K   N  ++ G +D +V + L     I  +P  K+F    +        P   + G T  D+    + L      P   +E   ++I+ K             P++L TG+   N     + +    Y  ++   L+ +  +    E SL +
Sbjct:  177 EKVFG--SDDVWMVEFFAPWCGHCKNLEPEWAAAASQVKEQTNGRVKLGAVDATVHQGLASRYGIRGFPTIKVFRKGEE--------PEDYQGGRTRSDIIARALDLYSDNAPPPEMLEILNEDILKKTCDDHQLCVIAVLPHILDTGAAGRNGYLEVMMKMAEKYKKKMWGWLWTEAGAQMDLEASLGI 356          
BLAST of Sulfhydryl oxidase vs. Ensembl Cavefish
Match: dnajc10 (DnaJ heat shock protein family (Hsp40) member C10 [Source:NCBI gene;Acc:103021499])

HSP 1 Score: 56.6102 bits (135), Expect = 7.167e-8
Identity = 26/89 (29.21%), Postives = 47/89 (52.81%), Query Frame = 1
Query:  112 LYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            +Y+E   +   ++  +++  +  + + WF+ FY   C HC + AP ++ F KE    + V+R   ++C     LC+SK I+ YP   IF
Sbjct:  130 IYDEDPEIITLDRGDFDAAVN--SGEVWFVNFYFPRCSHCHDLAPTWREFAKEM---DGVIRISAVNCGDNNRLCRSKGISSYPSLFIF 213          

HSP 2 Score: 52.373 bits (124), Expect = 1.460e-6
Identity = 20/71 (28.17%), Postives = 39/71 (54.93%), Query Frame = 1
Query:  187 DNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKNDKR 399
            + W + FY  +CG C    P ++   + A+  + V+  G +DC    +LC+S+N+  YP  ++F   +++R
Sbjct:  580 ETWVVDFYAPWCGPCQALLPEWR---RMARMLSGVINVGTVDCQKHHSLCQSENVRAYPEIRLFPQNSNRR 647          

HSP 3 Score: 51.6026 bits (122), Expect = 2.703e-6
Identity = 23/77 (29.87%), Postives = 37/77 (48.05%), Query Frame = 1
Query:  184 EDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKNDKRAVING 414
            +++W + FY  +CG C +FAP F+     A+     +R G +DC      C+S  IT YP  + +     +R    G
Sbjct:  691 KEHWVLDFYAPWCGPCQHFAPEFEIL---ARMLKGTVRAGKVDCQAHYQTCQSAGITAYPTVRFYPYLGTQRRQQGG 764          
BLAST of Sulfhydryl oxidase vs. Ensembl Sea Lamprey
Match: pdia6 (protein disulfide isomerase family A, member 6 [Source:ZFIN;Acc:ZDB-GENE-030131-879])

HSP 1 Score: 60.8474 bits (146), Expect = 5.255e-10
Identity = 44/145 (30.34%), Postives = 70/145 (48.28%), Query Frame = 1
Query:   52 KMKYFAIILFLYFVAWSNAQLYNEMDNVNIFNKTSY--ESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF-LNKNDKRAVINGIPTSIEHGTVEDVFKDTISLI 477
            ++K F  ++    VA + A LY+  D+V     +++  E V SN   D W ++FY  +CGHC    P +K   K A     +++ G +D    + L  + N+  +P  KIF +NKN K    NG  T+   G V+       SL+
Sbjct:    1 EVKVFGALVLGVLVAGAQA-LYSPSDDVIELTASNFNREVVQSN---DLWLVEFYAPWCGHCQRLIPEWK---KAATALKGIVKLGAVDADEHKGLGSTYNVRGFPTIKIFGINKN-KPEDFNGGRTT--QGIVDGALGALRSLV 135          
BLAST of Sulfhydryl oxidase vs. Ensembl Sea Lamprey
Match: dnajc10 (DnaJ (Hsp40) homolog, subfamily C, member 10 [Source:ZFIN;Acc:ZDB-GENE-070327-1])

HSP 1 Score: 53.9138 bits (128), Expect = 1.006e-7
Identity = 24/89 (26.97%), Postives = 47/89 (52.81%), Query Frame = 1
Query:  112 LYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            +Y++   V   ++  +++  S  + + +F+ FY   C HC   AP+++ F KE    + V+R   ++C   R +C+SK I  YP   ++
Sbjct:  126 IYDDDAEVLTLDRGEFDAAVS--SGELFFVNFYSPRCSHCHELAPMWREFAKEM---DGVIRVAAVNCGDNRMMCRSKGIGSYPSLYVY 209          

HSP 2 Score: 48.521 bits (114), Expect = 4.936e-6
Identity = 23/84 (27.38%), Postives = 41/84 (48.81%), Query Frame = 1
Query:  130 NVNIFNKTSYESVFSNLTEDN-WFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            +V      +Y S+      D  W + FY  +CG C    P +K   + A+  + +++ G +DC    ALC+S+ +  YP  ++F
Sbjct:  558 SVVTLTPETYVSLVKQRKRDEVWMVDFYAPWCGPCQALLPEWK---RMARMLSGMVQVGSVDCQKHHALCQSEMVHAYPEIRLF 638          
BLAST of Sulfhydryl oxidase vs. Ensembl Sea Lamprey
Match: txndc5 (thioredoxin domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1951])

HSP 1 Score: 47.3654 bits (111), Expect = 8.421e-6
Identity = 21/89 (23.60%), Postives = 45/89 (50.56%), Query Frame = 1
Query:  118 NEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLN 384
             E  +V + N+ ++++  ++      F++FY  +CGHC N AP ++   K+       +    +DC+ E  LC  +++  YP   +++ 
Sbjct:  292 EEASSVLVLNENNFDATVADGIT---FVKFYAPWCGHCKNLAPTWEDLAKKEFSGLSKVTIAKVDCTSEAQLCSKQHVRGYPTLLLYVG 377          
BLAST of Sulfhydryl oxidase vs. Ensembl Nematostella
Match: EDO47168 (Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:A7RMV6])

HSP 1 Score: 191.045 bits (484), Expect = 2.840e-52
Identity = 155/543 (28.55%), Postives = 239/543 (44.01%), Query Frame = 1
Query:  103 NAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERAL--CKSKNITHYPYFKIFLNKNDKRAVINGIPTSIEHG--TVEDVFKDTISLIDSYFQPKPFIEFNKDNIV------LKNPYLLITGSQ-----IVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQIN----IIINKYSSIEKLYEGLNSYLED--------------------PIIINNRTKSSNFAVSTMSSTTLQFSTLYP----VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQ-FSGFKENILESFNNIVRFIDAKINSMIGRKKF----TKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQIN 1587
             A+LYN  D + + + T+ + V  + +   W I+FY S+CGHC  FAP +K   +  + W  V+R   IDC+ E  L  C+   I  YP  K F      R   N +    ++G  T  ++  + + ++D Y  PK  +E  K N        L  P    +G Q     +   + + +     L   LY   S     +   +LV++ QI     I+  +     +L EGL                          P I   +    +FA   +    + F  L      VY +D+ + + Y L N++   K    D L  LK F   + + F G +   +  F ++   I +K+ + +  K F    T + + I   + LP+ ++ W  C GS P YR YPC LWT FHVLTVN        P      +  +  IRE+I  FF+C  C ++F K   D E  V S   A+L+LW+ HN  NKRL    SEDPK+PKI FP + +C  CR         ++QW++    ++L +HY + N
Sbjct:   32 QARLYNLTDEIVLLDNTTIKGVIYD-SPVAWIIEFYSSWCGHCQAFAPTWKKLAQVVQDWKSVIRVAAIDCAEESNLDTCREFGIEAYPTIKFFNASTKNR---NNLGKDFDNGDKTFLNLLHEIVRVVD-YQDPK-LLENPKPNFTPLHESELDEP----SGEQKYQVLVFEKESSFVGKELALDMQLYPSVSLRRVLDTETALVDKYQITDFPAIVFIEKGYFRELSEGLPQSQRTHADFKRKLHRRLGKKLRKTFPEIPAAQRAYEHFA--KLHGGPIAFHKLTGSSSDVYLKDMVSGLSYMLWNEIPMKKEIKGDALKALKNFFGLISECFPGSRTTSM-LFRHLANKISSKLLTKLRSKDFLNIATTTNDMIEHDAPLPH-KVEWQACQGSSPRYRGYPCTLWTLFHVLTVNCKKGDQNTPP----GLRTLLHIREYIRHFFTCSYCVKHFTKMAEDIEDTVKSRDDAILWLWQAHNKANKRLHLDESEDPKFPKIQFPSDDICANCRDD-------QSQWKEHMVLKFLKDHYGKDN 549          
BLAST of Sulfhydryl oxidase vs. Ensembl Nematostella
Match: EDO43758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXE0])

HSP 1 Score: 55.8398 bits (133), Expect = 5.528e-8
Identity = 21/70 (30.00%), Postives = 40/70 (57.14%), Query Frame = 1
Query:  181 TEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKN 390
            +ED WFI +Y  +C HC + AP ++   ++ +    V+RFG ++C  +  LC+ + I  YP   ++  ++
Sbjct:  134 SEDIWFINYYSPFCSHCHDLAPTWREVARDLE---GVVRFGAVNCQEDWGLCQRQGIRSYPSLVLYPTQH 200          

HSP 2 Score: 53.1434 bits (126), Expect = 3.790e-7
Identity = 25/80 (31.25%), Postives = 39/80 (48.75%), Query Frame = 1
Query:  181 TEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLN--KNDKRAVING 414
            +ED W + FY  +CG C+ FAP ++     AK     +R   ++C  +  LC   NI  YP  +++L   +      ING
Sbjct:  667 SEDAWVVDFYAPWCGPCMRFAPKYEQL---AKMLKGKVRAAKVNCEQDYGLCSEANIHSYPTVRLYLGSTRQGMTQSING 743          
BLAST of Sulfhydryl oxidase vs. Ensembl Nematostella
Match: EDO37155 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGL1])

HSP 1 Score: 52.373 bits (124), Expect = 4.014e-7
Identity = 24/67 (35.82%), Postives = 36/67 (53.73%), Query Frame = 1
Query:  193 WFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF-LNKN 390
            W ++FY  +CGHC   AP    ++K A     V++ G +D  V +++    NI  +P  KIF  NKN
Sbjct:   33 WMVEFYAPWCGHCKALAP---EWMKAATALKGVVKVGAVDMDVHQSVGGPYNIRGFPTIKIFGANKN 96          
BLAST of Sulfhydryl oxidase vs. Ensembl Medaka
Match: qsox1 (quiescin sulfhydryl oxidase 1 [Source:NCBI gene;Acc:101164970])

HSP 1 Score: 179.489 bits (454), Expect = 4.708e-47
Identity = 126/505 (24.95%), Postives = 229/505 (45.35%), Query Frame = 1
Query:   70 IILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVE--RALCKSKNITHYP---YFKIFLNKNDKRAVINGIP---TSIEHGTVEDVFKDTISLIDSYFQPKPFIEFNKDNIVLKNP--YLLI--------TGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYP--------VYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEA--SKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTK--ENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKC 1494
            ++ F    + + A LY   D + +  + + ESV  N T     ++FY S+CGHCI+F+PV+K+  ++   W   +    +DC+ E  R +C    I  +P   +F+ F  ++       G P   + + H  ++ +         S    +P      D     NP  YL +         G +++     +L + N +T         S  T+  ++      +     ++S ++   E  + Y    + +    +S    +  +SS  +  S+  P        VY  D+ +++ YAL  ++    L   + L  LK +I  L ++   +  ++    ++  ++  +    I  + F +  ++  +   + LP  E  W+GC GS+P++RRYPCG+WT FHVLTV        Q D+    N   ++  +R ++ +FF C++CA +F+    +    V S   A+L+LW  HN VN R++ A SEDP +PKI +PP  +C  C
Sbjct:   24 LMCFCLLPSAAQAGLYTASDQITLLTRDNVESVLVNSTAAA-VVEFYASWCGHCISFSPVYKSLARDISEWRPAVSLAAVDCAAEENRKICVDYKIRGFPSIKFFRAFSKEDSYGTNYLGFPRDISGLRHAIIDSLETHGEPWPPSCPPLEPISPAEVDVFFGTNPVQYLALIFEESRSYVGREVI---LDLLQFEN-ITVRRVLSSEVSLVTKLGVTEFPSCYLYYPDGQFSRLQVSREARSFYTYALMRLPGVLRSGKAGL--ISSVVITNSSAEPWRSFNRTRVYMADLESTLHYALRVELAAHSLIKGEALTSLKNYIAVLAKYFPGRSVVMNLLKSLNSWLQNQTADHISYEAFREMLDNTAQVPDAALPEGE-RWVGCQGSQPHFRRYPCGVWTLFHVLTV--------QADSAGASNPHEVLSVMRSYVKNFFGCRDCADHFETMAREGLRTVSSPPSAMLWLWSAHNRVNSRIAGALSEDPHFPKIQWPPPEMCSSC 512          
BLAST of Sulfhydryl oxidase vs. Ensembl Medaka
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:NCBI gene;Acc:101158615])

HSP 1 Score: 126.716 bits (317), Expect = 5.213e-30
Identity = 72/266 (27.07%), Postives = 128/266 (48.12%), Query Frame = 1
Query:  844 YPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILE--------ASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAIN----------LIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQIN 1587
            + VY  D+ +++ Y L  ++    +   + L + K  +  + +       +     ++V+ ++   + ++        + ++L+        A      EL W+GC GS+P  R YPC LWT FHVLTV        Q D   NA++          +++ +R +I +FF CQEC+++F++  A    EV S++  +++LW  HN VN RL+ + S+DP +PK  +P  S+C  C    N +    ++W       +L  HYS  N
Sbjct:  290 FQVYTADLESALHYLLRVELASHSMLEGEKLKVFKDLVTLVSK-------LYPGGGSVVKLMETLSDWLLSLPLQRIPYQAVLDLVNNKMRIAGVFLGEELRWVGCQGSRPGLRGYPCSLWTLFHVLTV--------QHDAMPNALDNTGLEVEAAPVLQVMRSYIRTFFGCQECSRHFEQAVAAGIHEVKSAEQQIVWLWNQHNRVNARLAGSLSDDPLFPKAQWPSPSLCASCHEERNGV----HEWNLDNVLHFLRHHYSASN 536          

HSP 2 Score: 73.9442 bits (180), Expect = 3.255e-13
Identity = 38/111 (34.23%), Postives = 60/111 (54.05%), Query Frame = 1
Query:   61 YFAIILFLYFVAWS---NAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVER--ALCKSKNITHYPYFKIF 378
            +F     L+FV+ S    ++LY E D + I   +S +   SN +   W +QFY S+CGHCI+++  +K   ++ K W   +   V+DC+ E    +C+  NI  YP FK F
Sbjct:    5 WFHAAGVLWFVSGSLGGASRLYTEDDPLVILGSSSLKPTISN-SSSAWLVQFYSSWCGHCIHYSSTWKVLAQDVKDWQDAIGVAVLDCAQEENFDVCRDYNIQFYPTFKYF 114          
BLAST of Sulfhydryl oxidase vs. Ensembl Medaka
Match: dnajc10 (DnaJ heat shock protein family (Hsp40) member C10 [Source:NCBI gene;Acc:101167406])

HSP 1 Score: 57.7658 bits (138), Expect = 1.357e-8
Identity = 23/62 (37.10%), Postives = 33/62 (53.23%), Query Frame = 1
Query:  193 WFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            WF+ FY   C HC   AP ++ F KE    + V+R G ++C     LC+ K +T YP   I+
Sbjct:  151 WFVNFYSPRCSHCHQLAPTWREFAKEM---DGVIRIGAVNCGDNNHLCRRKGVTSYPSLYIY 209          
BLAST of Sulfhydryl oxidase vs. Ensembl Medaka
Match: dnajc10 (DnaJ heat shock protein family (Hsp40) member C10 [Source:NCBI gene;Acc:101167406])

HSP 1 Score: 56.225 bits (134), Expect = 9.583e-8
Identity = 23/62 (37.10%), Postives = 33/62 (53.23%), Query Frame = 1
Query:  193 WFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            WF+ FY   C HC   AP ++ F KE    + V+R G ++C     LC+ K +T YP   I+
Sbjct:  134 WFVNFYSPRCSHCHQLAPTWREFAKEM---DGVIRIGAVNCGDNNHLCRRKGVTSYPSLYIY 192          

HSP 2 Score: 51.2174 bits (121), Expect = 3.723e-6
Identity = 29/95 (30.53%), Postives = 46/95 (48.42%), Query Frame = 1
Query:   94 AWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            AW+ + L     +V++  +T    V S   + +W + FY  +CG C +FAP F+   +  K     +R G +DC      C+S  IT YP  K +
Sbjct:  629 AWALSSLPRA--SVDLNPETFRSKVLSG--QHHWVLDFYAPWCGPCQHFAPEFEVLARMLKG---EVRAGKVDCQAHYQTCQSAGITAYPTVKFY 716          
BLAST of Sulfhydryl oxidase vs. Ensembl Medaka
Match: dnajc10 (DnaJ heat shock protein family (Hsp40) member C10 [Source:NCBI gene;Acc:101167406])

HSP 1 Score: 56.225 bits (134), Expect = 1.076e-7
Identity = 23/62 (37.10%), Postives = 33/62 (53.23%), Query Frame = 1
Query:  193 WFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            WF+ FY   C HC   AP ++ F KE    + V+R G ++C     LC+ K +T YP   I+
Sbjct:  133 WFVNFYSPRCSHCHQLAPTWREFAKEM---DGVIRIGAVNCGDNNHLCRRKGVTSYPSLYIY 191          

HSP 2 Score: 51.2174 bits (121), Expect = 3.968e-6
Identity = 29/95 (30.53%), Postives = 46/95 (48.42%), Query Frame = 1
Query:   94 AWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            AW+ + L     +V++  +T    V S   + +W + FY  +CG C +FAP F+     A+     +R G +DC      C+S  IT YP  K +
Sbjct:  637 AWALSSLPRA--SVDLNPETFRSKVLSG--QHHWVLDFYAPWCGPCQHFAPEFEVL---ARMLKGEVRAGKVDCQAHYQTCQSAGITAYPTVKFY 724          
BLAST of Sulfhydryl oxidase vs. Planmine SMEST
Match: SMESG000015310.1 (SMESG000015310.1)

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 551/554 (99.46%), Postives = 554/554 (100.00%), Query Frame = 1
Query:  124 MDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQPKPFIEFNKDNIVLKNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLVEHYSQINTVNFQTQPSLLLRTSTSFIVNLSSMDXXXXXXXXXXXXXXXXMAFLKFFRDSSFCHRKWYRKVIKS 1785
            MDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQPKPFIEFNKDNI+LKNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIE+LYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYL+EHYSQINTVNFQTQPSLLLRTSTSFIVNLSSMDISVCVILSVFSSFVVIMAFLKFFRDSSFCHRKWYRKVIKS
Sbjct:    1 MDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQPKPFIEFNKDNILLKNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNATEYSLSLVNESQINIIINKYSSIEQLYEGLNSYLEDPIIINNRTKSSNFAVSTMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKFILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASKLPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENAINLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHNSVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAFQYLIEHYSQINTVNFQTQPSLLLRTSTSFIVNLSSMDISVCVILSVFSSFVVIMAFLKFFRDSSFCHRKWYRKVIKS 554          
BLAST of Sulfhydryl oxidase vs. Planmine SMEST
Match: SMESG000023147.1 (SMESG000023147.1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.739e-9
Identity = 34/110 (30.91%), Postives = 56/110 (50.91%), Query Frame = 1
Query:   55 MKYFAIILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFI--QFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            MKY +I+LF + +A  NA +  E   + + N     S F+ + E N ++  +FY  +CGHC   AP + +  ++ K  N +++   +D +VE  L     I  YP  K F
Sbjct:    1 MKYLSIVLFCFALAQCNADITEEEGVLVLTN-----SNFNEVIEKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFF 105          
BLAST of Sulfhydryl oxidase vs. Planmine SMEST
Match: SMESG000017020.1 (SMESG000017020.1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.707e-7
Identity = 31/102 (30.39%), Postives = 55/102 (53.92%), Query Frame = 1
Query:   73 ILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIF 378
            ++FLY  A S+  LY+  D+V     ++++ + +  ++  WF++FY  +CGHC + AP +K   K A     V++ G +D     +L +   I  +P  KIF
Sbjct:    8 LIFLY--AKSSTALYSSNDDVVELTPSNFDDMKN--SDSLWFVEFYAPWCGHCQSLAPEWK---KAATALKGVVKVGAVDMDKYSSLGQPYGIQGFPTIKIF 102          
BLAST of Sulfhydryl oxidase vs. Planmine SMEST
Match: SMESG000010656.1 (SMESG000010656.1)

HSP 1 Score: 53.5286 bits (127), Expect = 4.052e-7
Identity = 25/76 (32.89%), Postives = 41/76 (53.95%), Query Frame = 1
Query:  169 FSNLTEDNWFI--QFYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNITHYPYFKIFLNKN 390
            F+ + E + +I  +F+  +CGHC + AP F    K     N  ++   +D +VE  L K  +++ YP  K+F NKN
Sbjct:  153 FTQIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPSLKLFKNKN 228          
The following BLAST results are available for this feature:
BLAST of Sulfhydryl oxidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
QSOX12.761e-5026.14quiescin sulfhydryl oxidase 1 [Source:HGNC Symbol;... [more]
QSOX11.116e-4926.14quiescin sulfhydryl oxidase 1 [Source:HGNC Symbol;... [more]
QSOX29.045e-2731.52quiescin sulfhydryl oxidase 2 [Source:HGNC Symbol;... [more]
QSOX22.044e-1834.26quiescin sulfhydryl oxidase 2 [Source:HGNC Symbol;... [more]
QSOX17.695e-1331.19quiescin sulfhydryl oxidase 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Sulfhydryl oxidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F47B7.26.206e-4224.82Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
F47B7.27.582e-4224.82Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
F47B7.21.917e-4124.82Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
T10H10.28.286e-2538.95Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:P... [more]
F35G2.15.028e-2427.18Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
back to top
BLAST of Sulfhydryl oxidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Qsox16.269e-2426.53gene:FBgn0033814 transcript:FBtr0340493[more]
Qsox16.269e-2426.53gene:FBgn0033814 transcript:FBtr0087760[more]
Qsox31.157e-2323.62gene:FBgn0038918 transcript:FBtr0084149[more]
Qsox21.640e-2333.54gene:FBgn0038919 transcript:FBtr0084150[more]
Qsox41.605e-1632.48gene:FBgn0051413 transcript:FBtr0084442[more]
back to top
BLAST of Sulfhydryl oxidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
qsox12.604e-3330.28quiescin Q6 sulfhydryl oxidase 1 [Source:ZFIN;Acc:... [more]
qsox27.046e-2927.69quiescin Q6 sulfhydryl oxidase 2 [Source:ZFIN;Acc:... [more]
dnajc101.640e-828.09DnaJ (Hsp40) homolog, subfamily C, member 10 [Sour... [more]
txndc56.633e-629.03thioredoxin domain containing 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Sulfhydryl oxidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fucolectinloc1004912114.236e-4723.52fucolectin uncharacterized LOC100491211 [Source:Xe... [more]
clpb7.715e-3923.45ClpB homolog, mitochondrial AAA ATPase chaperonin ... [more]
clpb1.227e-3823.67ClpB homolog, mitochondrial AAA ATPase chaperonin ... [more]
fucolectinloc1004912117.996e-2926.77fucolectin uncharacterized LOC100491211 [Source:Xe... [more]
fucolectinloc1004912117.996e-2926.77fucolectin uncharacterized LOC100491211 [Source:Xe... [more]
back to top
BLAST of Sulfhydryl oxidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Qsox12.447e-5526.70quiescin Q6 sulfhydryl oxidase 1 [Source:MGI Symbo... [more]
Qsox17.638e-5526.70quiescin Q6 sulfhydryl oxidase 1 [Source:MGI Symbo... [more]
Qsox12.369e-5426.70quiescin Q6 sulfhydryl oxidase 1 [Source:MGI Symbo... [more]
Qsox23.650e-2933.95quiescin Q6 sulfhydryl oxidase 2 [Source:MGI Symbo... [more]
Qsox24.920e-2933.33quiescin Q6 sulfhydryl oxidase 2 [Source:MGI Symbo... [more]
back to top
BLAST of Sulfhydryl oxidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BND5|QSOX1_MOUSE1.657e-5326.70Sulfhydryl oxidase 1 OS=Mus musculus OX=10090 GN=Q... [more]
sp|Q6IUU3|QSOX1_RAT3.069e-5326.74Sulfhydryl oxidase 1 OS=Rattus norvegicus OX=10116... [more]
sp|O08841|QSOX1_CAVPO4.636e-5027.26Sulfhydryl oxidase 1 OS=Cavia porcellus OX=10141 G... [more]
sp|H2N4I1|QSOX1_PONAB3.620e-4926.14Sulfhydryl oxidase 1 OS=Pongo abelii OX=9601 GN=QS... [more]
sp|Q8JGM4|QSOX1_CHICK5.106e-4925.94Sulfhydryl oxidase 1 OS=Gallus gallus OX=9031 GN=Q... [more]
back to top
BLAST of Sulfhydryl oxidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3ZHZ63.968e-5526.51Sulfhydryl oxidase OS=Branchiostoma floridae OX=77... [more]
A0A1Z5LCM68.186e-5327.95Sulfhydryl oxidase (Fragment) OS=Ornithodoros moub... [more]
A0A1U7U8H33.772e-5227.05Sulfhydryl oxidase OS=Tarsius syrichta OX=1868482 ... [more]
A0A444T1W57.269e-5228.95Sulfhydryl oxidase OS=Armadillidium vulgare OX=133... [more]
A0A023GD849.528e-5226.08Sulfhydryl oxidase (Fragment) OS=Amblyomma triste ... [more]
back to top
BLAST of Sulfhydryl oxidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qsox16.233e-5225.96quiescin Q6 sulfhydryl oxidase 1 [Source:ZFIN;Acc:... [more]
qsox27.315e-4725.98quiescin sulfhydryl oxidase 2 [Source:NCBI gene;Ac... [more]
qsox25.400e-4525.55quiescin sulfhydryl oxidase 2 [Source:NCBI gene;Ac... [more]
pdia63.626e-822.11protein disulfide-isomerase A6-like [Source:NCBI g... [more]
dnajc107.167e-829.21DnaJ heat shock protein family (Hsp40) member C10 ... [more]
back to top
BLAST of Sulfhydryl oxidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pdia65.255e-1030.34protein disulfide isomerase family A, member 6 [So... [more]
dnajc101.006e-726.97DnaJ (Hsp40) homolog, subfamily C, member 10 [Sour... [more]
txndc58.421e-623.60thioredoxin domain containing 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Sulfhydryl oxidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sulfhydryl oxidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO471682.840e-5228.55Sulfhydryl oxidase [Source:UniProtKB/TrEMBL;Acc:A... [more]
EDO437585.528e-830.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371554.014e-735.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sulfhydryl oxidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qsox14.708e-4724.95quiescin sulfhydryl oxidase 1 [Source:NCBI gene;Ac... [more]
qsox25.213e-3027.07quiescin sulfhydryl oxidase 2 [Source:NCBI gene;Ac... [more]
dnajc101.357e-837.10DnaJ heat shock protein family (Hsp40) member C10 ... [more]
dnajc109.583e-837.10DnaJ heat shock protein family (Hsp40) member C10 ... [more]
dnajc101.076e-737.10DnaJ heat shock protein family (Hsp40) member C10 ... [more]
back to top
BLAST of Sulfhydryl oxidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000015310.10.000e+099.46SMESG000015310.1[more]
SMESG000023147.11.739e-930.91SMESG000023147.1[more]
SMESG000017020.13.707e-730.39SMESG000017020.1[more]
SMESG000010656.14.052e-732.89SMESG000010656.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026923 ID=SMED30026923|Name=Sulfhydryl oxidase|organism=Schmidtea mediterranea sexual|type=transcript|length=2087bp
GTGCAATTTTTTAAATCGAATATTTAACTAATTATATTTTTAGTTATTTT
GAAAATGAAATATTTTGCAATTATTTTATTTCTGTATTTCGTTGCATGGT
CTAACGCTCAATTATATAATGAAATGGACAATGTTAATATATTTAATAAA
ACTTCTTATGAATCAGTGTTTAGCAATTTAACCGAAGATAACTGGTTTAT
TCAGTTTTATCACAGTTATTGTGGACATTGTATTAATTTTGCTCCTGTTT
TCAAAGCATTTTTAAAAGAAGCAAAATATTGGAACTGGGTTATGAGGTTT
GGTGTAATTGATTGTTCTGTCGAAAGAGCTTTGTGCAAAAGTAAAAACAT
CACTCATTACCCATATTTTAAAATATTTTTAAATAAAAATGACAAAAGAG
CCGTCATCAACGGAATACCTACGTCCATAGAGCATGGGACTGTTGAGGAT
GTTTTTAAAGATACGATCTCATTAATAGATTCTTACTTTCAACCGAAACC
ATTTATTGAATTCAATAAAGACAATATTGTATTGAAAAATCCTTATTTGC
TTATTACCGGAAGCCAAATTGTAAATCTCAAAAGAGCAATTCTTTCATAT
CATAATCGGTTAACATTTGACCTTTATTATCAACGTAGTAGTAGCAATGC
CACAGAATACAGTCTCAGTCTGGTTAATGAATCTCAAATCAACATAATTA
TCAACAAATATTCGAGCATAGAAAAATTGTACGAGGGATTAAATAGTTAT
CTTGAGGACCCGATAATTATCAACAATAGAACGAAATCATCTAATTTTGC
GGTTTCAACAATGAGTTCTACCACTTTGCAATTTTCAACACTTTATCCCG
TCTATAATCAAGATATTTATGCCAGTGTATTTTATGCTCTTACAAATGAT
GTAACCGACATAAAACTCACCAATATTGATAATTTAATAATTCTGAAAAA
ATTCATTCTTCAATTGTGTCAATTTTCAGGTTTTAAAGAAAATATCTTAG
AAAGTTTCAATAATATAGTCAGATTCATTGATGCCAAAATTAATTCGATG
ATAGGTAGGAAGAAGTTCACGAAATCCTGGAATAGTATCCTGGAAGCATC
TAAGTTACCAAACCTTGAATTATCGTGGATAGGATGTAATGGCAGTAAAC
CGTATTATCGTAGGTATCCATGTGGATTATGGACGACATTTCATGTGCTT
ACTGTGAACCAATATCTTAAGTCGTATCCTCAGCCGGATACAAAAGAGAA
TGCTATTAATCTAATCAAATCAATTCGGGAATTTATCATCTCATTCTTTT
CATGCCAGGAATGTGCACAAAATTTTAAAAAGGAAACAGCTGATTATGAA
ACCGAAGTTGACAGTTCGAAAGGCGCCGTACTCTATTTATGGAAAGTTCA
TAATAGTGTCAATAAAAGACTTTCTAAGGCCCCTTCAGAAGATCCAAAAT
ATCCGAAAATCGCCTTTCCGCCGGAATCAGTGTGTCAAAAATGTAGAATA
AGCTTGAATTTAATCTGGCCGACTGAGAATCAGTGGCGGAAAGGAAAAGC
TTTTCAATATTTAGTTGAACATTATTCACAAATAAATACGGTTAACTTTC
AAACTCAACCGTCACTTTTATTGCGCACTTCTACTTCTTTTATAGTCAAT
CTTTCATCAATGGACATCAGCGTCTGTGTGATATTGTCGGTGTTTTCTAG
TTTTGTCGTCATTATGGCGTTTTTAAAATTTTTTAGAGATTCTTCGTTTT
GCCATCGGAAATGGTACAGAAAAGTCATTAAAAGTTGATTAAATTGTGTT
ATTTGACCTTTTGTTTTATTAAATGGATTTTTGGTAGTTTTTAACATGAA
AAAAAAACAATTATATTATGTCAATTTTGCCCATGTTTTGGTTTCTCATT
TGCATTTTCACCAAAAGCTGTGTTGTAGAGTTGGTGGTAATTATTATTAA
ATTAAGATTGATTATTGTGTGAGATAATTCGGTGAAATGTATTTTTTTCA
ATTAAATATTTGAAAATTTTATTTTAATATTCAATAACCAGTTTCAGATC
TATATAATCGGCTATTTTCATTTTACTTTAAAGAAAC
back to top

protein sequence of SMED30026923-orf-1

>SMED30026923-orf-1 ID=SMED30026923-orf-1|Name=SMED30026923-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=578bp
MKYFAIILFLYFVAWSNAQLYNEMDNVNIFNKTSYESVFSNLTEDNWFIQ
FYHSYCGHCINFAPVFKAFLKEAKYWNWVMRFGVIDCSVERALCKSKNIT
HYPYFKIFLNKNDKRAVINGIPTSIEHGTVEDVFKDTISLIDSYFQPKPF
IEFNKDNIVLKNPYLLITGSQIVNLKRAILSYHNRLTFDLYYQRSSSNAT
EYSLSLVNESQINIIINKYSSIEKLYEGLNSYLEDPIIINNRTKSSNFAV
STMSSTTLQFSTLYPVYNQDIYASVFYALTNDVTDIKLTNIDNLIILKKF
ILQLCQFSGFKENILESFNNIVRFIDAKINSMIGRKKFTKSWNSILEASK
LPNLELSWIGCNGSKPYYRRYPCGLWTTFHVLTVNQYLKSYPQPDTKENA
INLIKSIREFIISFFSCQECAQNFKKETADYETEVDSSKGAVLYLWKVHN
SVNKRLSKAPSEDPKYPKIAFPPESVCQKCRISLNLIWPTENQWRKGKAF
QYLVEHYSQINTVNFQTQPSLLLRTSTSFIVNLSSMDISVCVILSVFSSF
VVIMAFLKFFRDSSFCHRKWYRKVIKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR036774ERV/ALR_sulphydryl_oxid_sf
IPR039798Sulfhydryl_oxidase
IPR017905ERV/ALR_sulphydryl_oxidase
IPR013766Thioredoxin_domain
IPR012336Thioredoxin-like_fold
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0045454cell redox homeostasis
GO:0016242negative regulation of macroautophagy
Vocabulary: molecular function
TermDefinition
GO:0016972thiol oxidase activity
GO:0003756protein disulfide isomerase activity
GO:0016491oxidoreductase activity
GO:0016971flavin-linked sulfhydryl oxidase activity
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030173integral component of Golgi membrane
GO:0043231intracellular membrane-bounded organelle
GO:0045171intercellular bridge
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 27..116
e-value: 3.1E-12
score: 46.4
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 18..146
score: 9.073
IPR017905ERV/ALR sulfhydryl oxidase domainPFAMPF04777Evr1_Alrcoord: 373..471
e-value: 5.8E-22
score: 78.1
IPR017905ERV/ALR sulfhydryl oxidase domainPROSITEPS51324ERV_ALRcoord: 364..470
score: 22.493
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 14..142
e-value: 2.2E-20
score: 75.0
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 23..119
IPR036774ERV/ALR sulfhydryl oxidase domain superfamilyGENE3DG3DSA:1.20.120.310coord: 359..516
e-value: 5.7E-46
score: 157.9
IPR036774ERV/ALR sulfhydryl oxidase domain superfamilySUPERFAMILYSSF69000FAD-dependent thiol oxidasecoord: 363..468
IPR039798Sulfhydryl oxidasePANTHERPTHR22897QUIESCIN Q6-RELATED SULFHYDRYL OXIDASEcoord: 3..559
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.836
NoneNo IPR availableTMHMMTMhelixcoord: 538..560