Epidermal growth factor-8

Overview
NameEpidermal growth factor-8
Smed IDSMED30026909
Length (bp)1728
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epidermal growth factor-8 (SMED30026909) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epidermal growth factor-8 (SMED30026909) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026909

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30026909h1SMcG0001118 dd_Smed_v4_7186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026909h1SMcG0001118 dd_Smed_v4_7186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epidermal growth factor-8 vs. Ensembl Zebrafish
Match: jag2b (jagged canonical Notch ligand 2b [Source:ZFIN;Acc:ZDB-GENE-011128-3])

HSP 1 Score: 50.8322 bits (120), Expect = 4.847e-6
Identity = 34/120 (28.33%), Postives = 53/120 (44.17%), Query Frame = 3
Query:  495 DSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVFGKCKNEIYSMIYYCKCTAGWTGRYC 842
            D W  +++    +   ++ R+R++C ENYYG+ C+K C P       Y+C  SG+ +C   + G  C           CN + G       C V G+           CKC  GW G++C
Sbjct:  168 DHWQSIRH--PGITAHIEYRIRVRCDENYYGSKCNKQCRPRDDYFGHYRCDPSGNIVCLDGWMGEDCRTAIC---KQGCNLIHG------GCAVPGE-----------CKCNYGWQGQFC 265          
BLAST of Epidermal growth factor-8 vs. Ensembl Zebrafish
Match: jag2b (jagged canonical Notch ligand 2b [Source:ZFIN;Acc:ZDB-GENE-011128-3])

HSP 1 Score: 50.8322 bits (120), Expect = 4.931e-6
Identity = 34/120 (28.33%), Postives = 53/120 (44.17%), Query Frame = 3
Query:  495 DSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVFGKCKNEIYSMIYYCKCTAGWTGRYC 842
            D W  +++    +   ++ R+R++C ENYYG+ C+K C P       Y+C  SG+ +C   + G  C           CN + G       C V G+           CKC  GW G++C
Sbjct:  168 DHWQSIRH--PGITAHIEYRIRVRCDENYYGSKCNKQCRPRDDYFGHYRCDPSGNIVCLDGWMGEDCRTAIC---KQGCNLIHG------GCAVPGE-----------CKCNYGWQGQFC 265          
BLAST of Epidermal growth factor-8 vs. Ensembl Zebrafish
Match: jag2b (jagged canonical Notch ligand 2b [Source:ZFIN;Acc:ZDB-GENE-011128-3])

HSP 1 Score: 50.447 bits (119), Expect = 5.934e-6
Identity = 34/120 (28.33%), Postives = 53/120 (44.17%), Query Frame = 3
Query:  495 DSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVFGKCKNEIYSMIYYCKCTAGWTGRYC 842
            D W  +++    +   ++ R+R++C ENYYG+ C+K C P       Y+C  SG+ +C   + G  C           CN + G       C V G+           CKC  GW G++C
Sbjct:  168 DHWQSIRH--PGITAHIEYRIRVRCDENYYGSKCNKQCRPRDDYFGHYRCDPSGNIVCLDGWMGEDCRTAIC---KQGCNLIHG------GCAVPGE-----------CKCNYGWQGQFC 265          
BLAST of Epidermal growth factor-8 vs. Ensembl Zebrafish
Match: jag2b (jagged canonical Notch ligand 2b [Source:ZFIN;Acc:ZDB-GENE-011128-3])

HSP 1 Score: 50.447 bits (119), Expect = 5.985e-6
Identity = 34/120 (28.33%), Postives = 53/120 (44.17%), Query Frame = 3
Query:  495 DSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVFGKCKNEIYSMIYYCKCTAGWTGRYC 842
            D W  +++    +   ++ R+R++C ENYYG+ C+K C P       Y+C  SG+ +C   + G  C           CN + G       C V G+           CKC  GW G++C
Sbjct:  168 DHWQSIRH--PGITAHIEYRIRVRCDENYYGSKCNKQCRPRDDYFGHYRCDPSGNIVCLDGWMGEDCRTAIC---KQGCNLIHG------GCAVPGE-----------CKCNYGWQGQFC 265          
BLAST of Epidermal growth factor-8 vs. Ensembl Xenopus
Match: JAG2 (jagged 2 [Source:NCBI gene;Acc:100497180])

HSP 1 Score: 51.9878 bits (123), Expect = 2.913e-6
Identity = 32/106 (30.19%), Postives = 46/106 (43.40%), Query Frame = 3
Query:  540 KLKARVRIKCSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVF-GKCKNEIYSMIYYCKCTAGWTGRYC 842
            +   ++R+KC ENYYG++C+K+C P       Y C  +G K C   + G  C                 +  CK  C +  G C     ++   CKC  GW G YC
Sbjct:  142 QFDVKIRVKCDENYYGSMCNKFCRPRNDFVGHYTCDSNGKKACMEGWMGAECK----------------QAICKQGCDLLHGGC-----TVPGECKCHYGWQGLYC 226          
BLAST of Epidermal growth factor-8 vs. Ensembl Xenopus
Match: JAG2 (jagged 2 [Source:NCBI gene;Acc:100497180])

HSP 1 Score: 51.6026 bits (122), Expect = 3.495e-6
Identity = 32/106 (30.19%), Postives = 46/106 (43.40%), Query Frame = 3
Query:  540 KLKARVRIKCSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVF-GKCKNEIYSMIYYCKCTAGWTGRYC 842
            +   ++R+KC ENYYG++C+K+C P       Y C  +G K C   + G  C                 +  CK  C +  G C     ++   CKC  GW G YC
Sbjct:  175 QFDVKIRVKCDENYYGSMCNKFCRPRNDFVGHYTCDSNGKKACMEGWMGAECK----------------QAICKQGCDLLHGGC-----TVPGECKCHYGWQGLYC 259          
BLAST of Epidermal growth factor-8 vs. Ensembl Xenopus
Match: JAG2 (jagged 2 [Source:NCBI gene;Acc:100497180])

HSP 1 Score: 50.447 bits (119), Expect = 8.908e-6
Identity = 32/106 (30.19%), Postives = 46/106 (43.40%), Query Frame = 3
Query:  540 KLKARVRIKCSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVF-GKCKNEIYSMIYYCKCTAGWTGRYC 842
            +   ++R+KC ENYYG++C+K+C P       Y C  +G K C   + G  C                 +  CK  C +  G C     ++   CKC  GW G YC
Sbjct:  133 QFDVKIRVKCDENYYGSMCNKFCRPRNDFVGHYTCDSNGKKACMEGWMGAECK----------------QAICKQGCDLLHGGC-----TVPGECKCHYGWQGLYC 217          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A161HX36 (Epidermal growth factor-8 OS=Schmidtea mediterranea OX=79327 GN=egf-8 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.182e-29
Identity = 79/245 (32.24%), Postives = 116/245 (47.35%), Query Frame = 3
Query:  108 ILNILILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTXXXXXXXXXXXXIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVFGKCKNEIYSMIYYCKCTAGWTGRYC 842
            ++N++I  I +S I  K  ++V IY+Y NH ++ H+ KKCE FHWA DHCDP+F IC+ +K  CD+   TT  + N + ++N+++ T   + FI S+ I V  DD D     DHI  FR +F            M   P ++ + L+A V +KC+ NYYGN            KC    DK        + CN+ C                      + GKC        ++C+C  GW G  C
Sbjct:   10 LINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGN------------KCEERSDK--------FICNSSC----------------------INGKCNFNYQKDTFFCQCYNGWDGINC 212          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A4E0R667 (Delta protein OS=Fasciola hepatica OX=6192 GN=D915_005787 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.307e-10
Identity = 62/247 (25.10%), Postives = 112/247 (45.34%), Query Frame = 3
Query:  123 ILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTK----FWANDRYVWNIYSGTIFSENFITSLKIKVTXXXXXXXXXXXXIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVFGKCKNEIYSMIYYCKCTAGWTGRYCQIA 851
            I+ I+  F  A ++I   + +Y+N  N     KKCE F + GDHCDP F    Y   +   + VT K     + N R++ ++   +   + F  +++  +   D D  +        R       G+ +    ++ G   +++++   VRI+C+++++G+ C+ YC P       YSG                     ++ C+ +TGE+ C   C V G C     S +  C CT+GW+G +C++A
Sbjct:    8 IVLIYGHFTWADVQITYLVNNYANKDNFDIRLKKCETFSFLGDHCDPTFHFNAYTTNDLGERIVTVKKEVGPFQNTRFIESVLEASQIQQVFPNTIEFDLNIYDSDADNDQQIARFHRKFHVTKTGEME----VRLG---VDVRVDVIVRIECAKDFFGDHCEIYCQP-------YSG---------------------LWTCHELTGERICSKPC-VHGSCVLTNQSAV--CVCTSGWSGEFCKLA 216          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A5K3EYV0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.427e-9
Identity = 76/281 (27.05%), Postives = 118/281 (41.99%), Query Frame = 3
Query:  105 IILNILILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKY-ECDLKYVTTKFW---ANDRYVWNIYSGTIFSENFITSLKIKVTXXXXXXXXXXXXIGVFRANFYPHGGKFDSWSHMQYGPRD---LNIKLKARVRIKCSENYYGNLCDKYCYPSSM-YKCSYSGDKICSRNYYGYHCNNY-------CAPNRMYACNPVTGEKTCKINCGVFGKC--KNEIYSMI-----------------YYCKCTAGWTGRYCQ 845
            +IL IL+ S     +     I      YSN  N++ N   C+        CD  F IC   +Y ECD+    +K +   +N R V +              + +KVTA DHD    HD IGVF A         D +  +   P+     +++ +  + + C ENYYG+ C +YC P  + Y+CS +GD+IC   ++G +CN+        CAP     C      + C  N G   +C  +N+  +M                  + C C   +TG +C+
Sbjct:   15 LILAILVRSSPSQSLLGYAAIGTLEIIYSNPENILQNRHVCD-LLPHDRACDVYFEICFSSEYGECDIFQYRSKIFKDSSNVRIVGDSAIIMFLKSPLPDQVDVKVTAFDHDAISVHDLIGVFTATNVSIVATSD-FVDIPVTPQSNKVSSMRFQMGLNVSCLENYYGDRCQRYCKPDGLSYRCSLNGDRICLEGFFGEYCNHSNVCLREPCAPG--AECVAKLAGRICICNGGDHPECYPENDPCAMSPCLNGGECGRSLTNPRGFICSCPKYYTGTFCE 291          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A1I8JHX7 (Delta-like protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.070e-8
Identity = 71/267 (26.59%), Postives = 110/267 (41.20%), Query Frame = 3
Query:  165 IEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICV-----YDKYECDLKYVTTKFWANDRYVWNIYSGTIFS-ENFITSLKIKVTXXXXXXXXXXXXIGVFRANFYPHGGKFDSWSHMQYGPRDLNI--------KLKARVRIKCSENYYGNLCDKYCYPSSMYK-----CSYSGDKICSRNY-YGYHC-NNYCA-------------PNRMYA-CNPVTGEKTCKIN---CGVFGKCKNEIYSMIYY-CKCTAGWTGRYCQI 848
            I++    YSN    ++NG +C+N  + G HCDP F I +       +YE D +      +   + V NI +  +   EN+   L I V  DD D   ++D++G F   F      F   S     P ++++         L  ++ ++C  +YYG+ C K+C P S Y      C   G+KIC   Y     C   +C+             P++    C P  G  TC      C     C+N    +    C C AG+ G  CQ+
Sbjct:  561 IKIRFLYYSNQRGWLYNGHRCDNRFFFGRHCDPFFTIKLEVSGETFRYETDREKGANTVYFGSKIV-NIDNPIVNRIENYQGHLDISVRVDDFDSVTSNDYMGSFHHRFSATAKPFGDLS----APTEVHLVDNGMAAANLALQISVQCEVHYYGSDCSKFCQPRSDYNGGHYYCDMDGNKICKPTYNLATGCREKFCSSEPCKNGGRCIDLPDKFVCKCRPSFGGATCIRELQPCQYSRPCQNGGTCIARVGCACPAGFHGDACQL 822          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A267H131 (Delta-like protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028312g1 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.330e-7
Identity = 75/289 (25.95%), Postives = 121/289 (41.87%), Query Frame = 3
Query:   99 MKIILNILILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYD-----KYECDLKYVTTKFWANDRYVWNIYSGTIFS-ENFITSLKIKVTXXXXXXXXXXXXIGVFRANFYPHGGKFDSWSHMQYGPRDLNI--------KLKARVRIKCSENYYGNLCDKYCYPSSMYK-----CSYSGDKICSRNY-YGYHCNN-YCA-------------PNRMYA-CNPVTGEKTCKIN---CGVFGKCKNEIYSMIYY-CKCTAGWTGRYCQI 848
            +K+I  IL+  + +  + +   I++    YSN    ++NG +C+N  + G HCDP F I +       +YE D +      +   + V NI +  +   EN+   L I V  DD D   ++D++G F   F      F   S     P ++++         L  ++ ++C  +YYG+ C K+C P S Y      C   G+KIC   Y     C   +C+             P++    C P  G  TC      C     C+N    +    C C AG+ G  CQ+
Sbjct:    8 IKLIAIILLGQLLIQAVTSVAVIKIRFLYYSNQRGWLYNGHRCDNRFFFGRHCDPFFTIKLEVSGETFRYETDREKGANTVYFGSKIV-NIDNPIVNRIENYQGHLDISVRVDDFDSVTSNDYMGSFHHRFSATAKPFGDLS----APTEVHLVDNGMAAANLALQISVQCEVHYYGSDCSKFCQPRSDYNGGHYYCDMDGNKICKPTYNLATGCREKFCSSEPCKNGGRCIDLPDKFVCKCRPSFGGATCIRELQPCQYSRPCQNGGTCIARVGCACPAGFHGDACQL 291          
BLAST of Epidermal growth factor-8 vs. Ensembl Cavefish
Match: jag2b (protein jagged-2 [Source:NCBI gene;Acc:103029720])

HSP 1 Score: 51.2174 bits (121), Expect = 2.679e-6
Identity = 36/129 (27.91%), Postives = 53/129 (41.09%), Query Frame = 3
Query:  474 YPHGGKFDSWSHMQY-GPRDLNIKLKARVRIKCSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCG-VFGKCKNEIYSMIYYCKCTAGWTGRYC 842
            + H G  +   H Q         + + R+R+KC ENYYG+ C+K C P       Y+C  SG+ +C   + G+ C                    CK  C  + G C     S+   C C  GW G++C
Sbjct:  158 HAHTGMVNPGDHWQVIAHPGATARFEYRIRVKCDENYYGSKCNKQCRPRDDYFGHYRCDPSGNIVCLEGWMGHDCRT----------------AICKQGCNLIHGGC-----SVPGECTCNYGWQGQFC 265          
BLAST of Epidermal growth factor-8 vs. Ensembl Cavefish
Match: jag2b (protein jagged-2 [Source:NCBI gene;Acc:103029720])

HSP 1 Score: 51.2174 bits (121), Expect = 3.012e-6
Identity = 36/129 (27.91%), Postives = 53/129 (41.09%), Query Frame = 3
Query:  474 YPHGGKFDSWSHMQY-GPRDLNIKLKARVRIKCSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCG-VFGKCKNEIYSMIYYCKCTAGWTGRYC 842
            + H G  +   H Q         + + R+R+KC ENYYG+ C+K C P       Y+C  SG+ +C   + G+ C                    CK  C  + G C     S+   C C  GW G++C
Sbjct:  158 HAHTGMVNPGDHWQVIAHPGATARFEYRIRVKCDENYYGSKCNKQCRPRDDYFGHYRCDPSGNIVCLEGWMGHDCRT----------------AICKQGCNLIHGGC-----SVPGECTCNYGWQGQFC 265          
BLAST of Epidermal growth factor-8 vs. Ensembl Nematostella
Match: EDO36410 (Delta-like protein [Source:UniProtKB/TrEMBL;Acc:A7SIT2])

HSP 1 Score: 51.2174 bits (121), Expect = 3.554e-7
Identity = 25/60 (41.67%), Postives = 35/60 (58.33%), Query Frame = 3
Query:  567 CSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTC 746
            C   ++G+ C+ YC  +    C  SG K C  N+YG  C+ YCAP   +ACN +TGE+ C
Sbjct:   51 CLPGWHGDRCNIYCRKTPTSICDGSGKKYCLPNWYGKDCSKYCAPTGNFACNSLTGERGC 110          

HSP 2 Score: 49.2914 bits (116), Expect = 1.803e-6
Identity = 22/64 (34.38%), Postives = 38/64 (59.38%), Query Frame = 3
Query:  567 CSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTC 746
            C   +YG+ CD+YC  +    + + CS +G+K+C + +YG +C  +C   R   C+ +TGE+ C
Sbjct:  110 CVAGWYGDQCDRYCIATHDDTAAFSCSETGEKVCHKGWYGTNCERHCVRTRNSVCSNITGERIC 173          
BLAST of Epidermal growth factor-8 vs. Ensembl Nematostella
Match: EDO47365 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RML5])

HSP 1 Score: 49.6766 bits (117), Expect = 3.542e-6
Identity = 56/254 (22.05%), Postives = 99/254 (38.98%), Query Frame = 3
Query:   99 MKIILNILILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAG-DHCDPMFIIC---VYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTXXXXXXXXXXXXIGVFRANFYPHGGKFDSWSHM------QYGPRDLNIK-------------LKARVRIKCSENYYGNLCDKYCYP-----SSMYKCSY-SGDKICSRNYYGYHCN-----NYCAPNR----MYACNPVTGEKTC 746
            ++I+L+ ++ +I    +++  K+ +T+ DY N  +L++NG+ C+  ++   + CD +F  C   V    EC L   TTK   +D +    +SG+    +    L+  +         A   + V+  +     GK   +          +  RD                 +   V + C +NY    C +YC          Y C Y  G K+C   +Y    N       C P       + C+P +GEK C
Sbjct:    4 IQILLDCIVFAIITHPVDSSGKLSITLIDYKNPGSLLYNGECCDTLNFCTWNQCDNLFKFCLTAVNSDLECSLGSGTTKTLGDDDFR---FSGS--GADLGGGLRNPLVYGFQGWKGATLVVEVWDEDGSNIAGKLPDFVDKYTLAINSHPDRDQTASTFATHRLCGKRSCMNVHVLLYCDQNYLIPQCTEYCVSRDSDLEGHYVCDYVQGRKVCREGWYDAVSNCTKKKKECTPRNDTGGHFGCDPESGEKLC 252          
BLAST of Epidermal growth factor-8 vs. Ensembl Medaka
Match: ENSORLT00000020945.2 (delta-like protein 4 [Source:NCBI gene;Acc:101169577])

HSP 1 Score: 50.8322 bits (120), Expect = 3.134e-6
Identity = 60/275 (21.82%), Postives = 95/275 (34.55%), Query Frame = 3
Query:  117 ILILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIIC------VYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTXXXXXXXXXXXXIGVFRANFYPHGGKFDSWSHMQYGPR-------DLNIKLKARVRIKCSENYYGNLCDKYCYPS----SMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKIN----------------CGVFGKCKNEIYSMIYYCKCTAGWTGRYC 842
            ++++ +F   + + +  E+ ++ + N   L+ NG++C     AG  C   F +C      V    +C     TT     D +     +      NF       +  +      A       ++ F      F     +  GP            +L+   RI C+ENYYG+ C K C P       Y C   G   C   + G +C     P  +  CN   G  TCK+                 C +   CK+      + C C  GW G YC
Sbjct:   10 VIVMPLFTQVLGSSV-FEIDLHHFQNTKGLLANGRRCS---MAG--CRTYFKVCLKNYQKVVSPGKCIFGKATTSVLGTDTFSIPQEARLRMPLNFTWPGDFSLVVEAWHSPAAEQPEDNTKSEFLI--SSFAVQKKLGIGPEWAEDVQCGTQTELRYSYRIICNENYYGDTCSKICAPRDDRFGHYTCKPDGQIACLTGWKGEYCQE---PICLEGCNESNG--TCKLPGECDCRDGWQGLFCDVCQLHPACKHGTCKEPWQCTCKEGWGGIYC 271          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000012543.1 (SMESG000012543.1)

HSP 1 Score: 397.127 bits (1019), Expect = 1.148e-136
Identity = 224/227 (98.68%), Postives = 225/227 (99.12%), Query Frame = 3
Query:   99 MKIILNILILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTXXXXXXXXXXXXIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVFGKCK 779
            MKIILNILILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTADDHDRYDAHDHIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGY+CNNYCAPNRMYACNPVTGEKTCKINCGVFG  K
Sbjct:    1 MKIILNILILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTADDHDRYDAHDHIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGYNCNNYCAPNRMYACNPVTGEKTCKINCGVFGNVK 227          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000012543.1 (SMESG000012543.1)

HSP 1 Score: 393.66 bits (1010), Expect = 1.219e-135
Identity = 211/214 (98.60%), Postives = 212/214 (99.07%), Query Frame = 3
Query:  138 MSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTXXXXXXXXXXXXIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVFGKCK 779
            MSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTADDHDRYDAHDHIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGY+CNNYCAPNRMYACNPVTGEKTCKINCGVFG  K
Sbjct:    1 MSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTADDHDRYDAHDHIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGYNCNNYCAPNRMYACNPVTGEKTCKINCGVFGNVK 214          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000012542.1 (SMESG000012542.1)

HSP 1 Score: 392.119 bits (1006), Expect = 8.766e-135
Identity = 211/220 (95.91%), Postives = 213/220 (96.82%), Query Frame = 3
Query:  954 PASLTSTQKVFISTSTLVDSTLFL---LTSKKYILESSTDRVESSNISSNFQIELSRAQDKSTTVYKNDKKIIYMDKSSTKLSNVITSAKHIHLENQGKNERLRAMSKLSEKTKENNSIKFEISIYQIIYGFAXXXXXXXXXXXMAKLWKAKYKMKYLLNNSSRPLPQVIFTSKASDANSLQFNGKENTNFCIGADSVYDSCTLTTNLNDEVVYEEPYPR 1604
            PASLTSTQKVFISTSTLVDSTLFL   LTSKKYILESSTDRVESSNIS NFQIELSRAQDKSTTVYKNDKKI YMDKSSTKLSNVITSAKHIHLENQGKNERLRA+SKLSEKTKENNSIKFEISIYQIIYGFAIILLICVVLVLMAKLWKAKYKMKYLLNNSSRPLPQVIFTSKASDANSLQFNGKENTNFCIGADSVYDSCTLTTNLNDEVVYEEP  +
Sbjct:    7 PASLTSTQKVFISTSTLVDSTLFLSSLLTSKKYILESSTDRVESSNISFNFQIELSRAQDKSTTVYKNDKKITYMDKSSTKLSNVITSAKHIHLENQGKNERLRAISKLSEKTKENNSIKFEISIYQIIYGFAIILLICVVLVLMAKLWKAKYKMKYLLNNSSRPLPQVIFTSKASDANSLQFNGKENTNFCIGADSVYDSCTLTTNLNDEVVYEEPISK 226          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000012542.1 (SMESG000012542.1)

HSP 1 Score: 372.089 bits (954), Expect = 5.147e-127
Identity = 204/220 (92.73%), Postives = 207/220 (94.09%), Query Frame = 3
Query:  954 PASLTSTQKVFISTSTLVDSTLFL---LTSKKYILESSTDRVESSNISSNFQIELSRAQDKSTTVYKNDKKIIYMDKSSTKLSNVITSAKHIHLENQGKNERLRAMSKLSEKTKENNSIKFEISIYQIIYGFAXXXXXXXXXXXMAKLWKAKYKMKYLLNNSSRPLPQVIFTSKASDANSLQFNGKENTNFCIGADSVYDSCTLTTNLNDEVVYEEPYPR 1604
            PASLTSTQKVFISTSTLVDSTLFL   LTSKKYILESSTDRVESSNIS NFQIELSRAQDKSTTVYKNDKKI YMDKSSTKLSNVITSAKHIHLENQGKNERLRA+SKLSEKTKENNSIKFEISIYQIIYGFAIILLICVVLVLMAKLWKAKYKM      +SRPLPQVIFTSKASDANSLQFNGKENTNFCIGADSVYDSCTLTTNLNDEVVYEEP  +
Sbjct:    7 PASLTSTQKVFISTSTLVDSTLFLSSLLTSKKYILESSTDRVESSNISFNFQIELSRAQDKSTTVYKNDKKITYMDKSSTKLSNVITSAKHIHLENQGKNERLRAISKLSEKTKENNSIKFEISIYQIIYGFAIILLICVVLVLMAKLWKAKYKM------NSRPLPQVIFTSKASDANSLQFNGKENTNFCIGADSVYDSCTLTTNLNDEVVYEEPISK 220          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077702.1 (SMESG000077702.1)

HSP 1 Score: 129.413 bits (324), Expect = 1.414e-32
Identity = 78/245 (31.84%), Postives = 115/245 (46.94%), Query Frame = 3
Query:  108 ILNILILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTXXXXXXXXXXXXIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGYHCNNYCAPNRMYACNPVTGEKTCKINCGVFGKCKNEIYSMIYYCKCTAGWTGRYC 842
            ++N++I  I +S I  K  ++V IY+Y NH ++ H+  KCE FHWA DHCDP+F IC+ +K  CD+   TT  + N + ++N+++ T   + FI S+ I V  DD D     DHI  FR +F            M   P ++ + L+A V +KC+ NYYGN            KC    DK        + CN+ C                      + GKC        ++C+C  GW G  C
Sbjct:   10 LINVIIFGILISPITTKAILKVYIYNYQNHEDMKHDKNKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFERDKFINSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGN------------KCEERSDK--------FTCNSSC----------------------INGKCNFNYQKDTFFCQCYNGWDGINC 212          
The following BLAST results are available for this feature:
BLAST of Epidermal growth factor-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
jag2b4.847e-628.33jagged canonical Notch ligand 2b [Source:ZFIN;Acc:... [more]
jag2b4.931e-628.33jagged canonical Notch ligand 2b [Source:ZFIN;Acc:... [more]
jag2b5.934e-628.33jagged canonical Notch ligand 2b [Source:ZFIN;Acc:... [more]
jag2b5.985e-628.33jagged canonical Notch ligand 2b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
JAG22.913e-630.19jagged 2 [Source:NCBI gene;Acc:100497180][more]
JAG23.495e-630.19jagged 2 [Source:NCBI gene;Acc:100497180][more]
JAG28.908e-630.19jagged 2 [Source:NCBI gene;Acc:100497180][more]
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A161HX362.182e-2932.24Epidermal growth factor-8 OS=Schmidtea mediterrane... [more]
A0A4E0R6672.307e-1025.10Delta protein OS=Fasciola hepatica OX=6192 GN=D915... [more]
A0A5K3EYV03.427e-927.05Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A1I8JHX73.070e-826.59Delta-like protein OS=Macrostomum lignano OX=28230... [more]
A0A267H1311.330e-725.95Delta-like protein OS=Macrostomum lignano OX=28230... [more]
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
jag2b2.679e-627.91protein jagged-2 [Source:NCBI gene;Acc:103029720][more]
jag2b3.012e-627.91protein jagged-2 [Source:NCBI gene;Acc:103029720][more]
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO364103.554e-741.67Delta-like protein [Source:UniProtKB/TrEMBL;Acc:A... [more]
EDO473653.542e-622.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000020945.23.134e-621.82delta-like protein 4 [Source:NCBI gene;Acc:1011695... [more]
back to top
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012543.11.148e-13698.68SMESG000012543.1[more]
SMESG000012543.11.219e-13598.60SMESG000012543.1[more]
SMESG000012542.18.766e-13595.91SMESG000012542.1[more]
SMESG000012542.15.147e-12792.73SMESG000012542.1[more]
SMESG000077702.11.414e-3231.84SMESG000077702.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026909 ID=SMED30026909|Name=Epidermal growth factor-8|organism=Schmidtea mediterranea sexual|type=transcript|length=1728bp
CCCATTATTCGCAATTTATTCCGTCATTTACTAATTTCAAAGTATTACAT
TGACCTTTATTATTTAAAAACTTTTGGAAAACTTTGAATGATTTTACAAT
GAAAATTATTCTAAATATTTTAATTTTGTCGATTTTTATGAGTTTTATCG
AAGCAAAAATAAAGATTGAAGTAACAATTTATGATTATTCAAATCATTAT
AATTTGATGCATAATGGGAAAAAATGTGAAAACTTTCACTGGGCTGGCGA
TCATTGTGATCCGATGTTTATTATTTGTGTTTATGATAAATATGAATGTG
ACTTGAAGTATGTGACGACAAAGTTTTGGGCAAATGATAGATATGTTTGG
AATATTTATTCTGGCACGATTTTCTCTGAAAATTTTATAACATCTTTAAA
GATCAAAGTTACCGCCGATGATCACGATCGGTATGATGCACATGATCATA
TTGGAGTTTTTAGAGCAAACTTTTATCCCCATGGTGGAAAATTTGATTCC
TGGAGTCATATGCAATATGGGCCTAGGGACCTGAATATAAAACTAAAGGC
CCGAGTGAGAATTAAGTGCTCTGAAAATTATTACGGAAATCTTTGTGATA
AATACTGTTATCCTTCCAGCATGTACAAATGCTCGTATTCGGGAGACAAA
ATATGCTCCCGAAATTACTATGGATATCATTGCAACAATTATTGCGCTCC
CAATCGTATGTACGCGTGCAATCCAGTGACTGGTGAAAAGACGTGTAAAA
TAAATTGTGGAGTTTTTGGAAAATGTAAAAATGAAATTTATAGTATGATT
TACTATTGCAAATGCACTGCAGGTTGGACTGGAAGATATTGTCAAATTGC
TCCTTCGTTTACCAGCCGATATCAAAGGAGGACTACAAAATATTTACCTT
CAACATCTAAAGAATTGACTACAAACACGACAATTATGCTTCATACTACA
ACACCAGCATCTTTAACTTCAACTCAAAAAGTCTTCATATCAACATCTAC
TTTAGTTGATTCCACATTATTCTTACTTACATCAAAAAAGTATATTTTGG
AATCCTCTACTGACAGAGTAGAAAGCAGTAATATAAGTTCCAATTTTCAA
ATAGAGTTGTCGAGGGCACAAGATAAATCAACAACAGTATACAAAAATGA
CAAGAAAATTATATACATGGATAAATCATCAACAAAATTGTCAAATGTCA
TTACATCAGCAAAGCACATCCATTTGGAAAATCAAGGTAAAAATGAGAGA
CTTCGAGCAATGTCCAAATTATCTGAAAAGACCAAAGAAAATAATTCTAT
AAAATTTGAAATCTCAATTTATCAGATAATTTACGGATTCGCAATAATCT
TACTAATCTGTGTAGTCTTGGTCCTTATGGCAAAATTGTGGAAAGCTAAA
TACAAAATGAAATATTTACTAAATAATAGCTCTCGGCCCCTGCCTCAAGT
GATATTTACATCTAAAGCATCAGATGCCAATTCTTTACAATTTAACGGTA
AAGAAAACACCAACTTCTGTATCGGGGCGGATTCAGTTTATGATTCCTGT
ACTTTGACAACAAATCTCAATGATGAAGTCGTATACGAAGAACCTTATCC
AAGAATCGATTTACAGTCTAACAATGCTTTTTAAACTGAAAATGTAACTT
TATGTCATTAGCATATTATAACAACTTATTTACAACATTTACAAAAGTTT
TTCATCTGTTTTCTTGATAGAAACGCAT
back to top

protein sequence of SMED30026909-orf-1

>SMED30026909-orf-1 ID=SMED30026909-orf-1|Name=SMED30026909-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=512bp
MKIILNILILSIFMSFIEAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAG
DHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSL
KIKVTADDHDRYDAHDHIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLK
ARVRIKCSENYYGNLCDKYCYPSSMYKCSYSGDKICSRNYYGYHCNNYCA
PNRMYACNPVTGEKTCKINCGVFGKCKNEIYSMIYYCKCTAGWTGRYCQI
APSFTSRYQRRTTKYLPSTSKELTTNTTIMLHTTTPASLTSTQKVFISTS
TLVDSTLFLLTSKKYILESSTDRVESSNISSNFQIELSRAQDKSTTVYKN
DKKIIYMDKSSTKLSNVITSAKHIHLENQGKNERLRAMSKLSEKTKENNS
IKFEISIYQIIYGFAIILLICVVLVLMAKLWKAKYKMKYLLNNSSRPLPQ
VIFTSKASDANSLQFNGKENTNFCIGADSVYDSCTLTTNLNDEVVYEEPY
PRIDLQSNNAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001774DSL
IPR013032EGF-like_CS
IPR000742EGF-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007154cell communication