BTB domain-containing protein

Overview
NameBTB domain-containing protein
Smed IDSMED30026908
Length (bp)932
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BTB domain-containing protein (SMED30026908) t-SNE clustered cells

Violin plots show distribution of expression levels for BTB domain-containing protein (SMED30026908) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BTB domain-containing protein (SMED30026908) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BTB domain-containing protein (SMED30026908) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026908

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30026908 dd_Smed_v4_8654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30026908 dd_Smed_v4_8654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30026908 dd_Smed_v4_8654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD21 (potassium channel tetramerization domain containing 21 [Source:HGNC Symbol;Acc:HGNC:27452])

HSP 1 Score: 98.9821 bits (245), Expect = 5.867e-25
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            T+NVGG ++TT+L+TL  +P+SM+  MF G +P  +  DS GN F+DRDG +F Y+LNFLR+  L LP+ F     L+ EAD+Y +  L+EAL+
Sbjct:    6 TLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKR--DSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQ 97          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD21 (potassium channel tetramerization domain containing 21 [Source:HGNC Symbol;Acc:HGNC:27452])

HSP 1 Score: 98.2117 bits (243), Expect = 5.911e-25
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            T+NVGG ++TT+L+TL  +P+SM+  MF G +P  +  DS GN F+DRDG +F Y+LNFLR+  L LP+ F     L+ EAD+Y +  L+EAL+
Sbjct:    6 TLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKR--DSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQ 97          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD21 (potassium channel tetramerization domain containing 21 [Source:HGNC Symbol;Acc:HGNC:27452])

HSP 1 Score: 98.2117 bits (243), Expect = 1.989e-24
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            T+NVGG ++TT+L+TL  +P+SM+  MF G +P  +  DS GN F+DRDG +F Y+LNFLR+  L LP+ F     L+ EAD+Y +  L+EAL+
Sbjct:    6 TLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKR--DSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQ 97          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD21 (potassium channel tetramerization domain containing 21 [Source:HGNC Symbol;Acc:HGNC:27452])

HSP 1 Score: 98.5969 bits (244), Expect = 1.592e-23
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            T+NVGG ++TT+L+TL  +P+SM+  MF G +P  +  DS GN F+DRDG +F Y+LNFLR+  L LP+ F     L+ EAD+Y +  L+EAL+
Sbjct:    6 TLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKR--DSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQ 97          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD11 (potassium channel tetramerization domain containing 11 [Source:HGNC Symbol;Acc:HGNC:21302])

HSP 1 Score: 90.8929 bits (224), Expect = 1.272e-20
Identity = 46/104 (44.23%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGS--IPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTT 435
            T+NVGG +++TTL TL R+P+SM+  MF     +PP+ +    G+ F+DRDG  F ++LNFLR G L LP G+     L+ EAD+Y +  LL+AL+     Q T
Sbjct:   18 TLNVGGTLYSTTLETLTRFPDSMLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGT 121          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: VM106R.1 (pep chromosome:WBcel235:II:10827716:10829556:-1 gene:WBGene00014848.1 transcript:VM106R.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:VM106R.1)

HSP 1 Score: 77.0258 bits (188), Expect = 5.691e-16
Identity = 39/95 (41.05%), Postives = 61/95 (64.21%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSID----SNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDEL 396
            V T+NVGG ++TTT STL +  ++++A +  GS+   +  +     +G +F+DRDG LF YVL+FLR+  L+LP+ F     L+ EAD+Y L+  
Sbjct:   29 VITLNVGGTMYTTTRSTLSKETDTLLANIASGSLSEDEQANVVTLPDGTLFVDRDGPLFAYVLHFLRTDKLSLPEQFREVARLKDEADFYRLERF 123          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: D2045.8 (pep chromosome:WBcel235:III:10482288:10483926:1 gene:WBGene00008425.1 transcript:D2045.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2045.8)

HSP 1 Score: 73.1738 bits (178), Expect = 7.178e-15
Identity = 36/93 (38.71%), Postives = 56/93 (60.22%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLE 402
            +  ++VGG I  TT+ TLC++ +SM+  MF   +P ++  +  G++F+DRD   F  +LNFLR G + LPD       +  EA Y+ LD L+E
Sbjct:    6 IVKLDVGGKIFKTTIFTLCKH-DSMLKTMFCTDVPVTK--NEEGSVFIDRDSKHFRLILNFLRDGQIALPDSDREVREVLAEASYFLLDPLIE 95          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: B0281.6 (pep chromosome:WBcel235:II:2301308:2302229:-1 gene:WBGene00015113.1 transcript:B0281.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0281.6)

HSP 1 Score: 60.8474 bits (146), Expect = 8.715e-11
Identity = 41/131 (31.30%), Postives = 67/131 (51.15%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDEL-------LEALKIYRTDQTTLNNSTNSKFVGYFIEIMEFE 495
            +  +NVGG +  T  STL ++    I +  + +  P++  DS    F+DR    F  VLN++RSG + LPD  +    L+ EA+YY L++L       +  +K Y+T    LN   N+K V   I  + ++
Sbjct:    7 IVKLNVGGTVFVTLKSTLTKHHG--IFKALVKTEMPAEDGDS---FFIDRSPKHFETVLNYIRSGDVDLPDSENELKELKREAEYYSLEKLATLCQSSMPKIKSYKTADELLNMIANTKKVVVVIHYLAYK 132          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: C17F4.8 (pep chromosome:WBcel235:II:3230817:3234813:-1 gene:WBGene00015914.1 transcript:C17F4.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C17F4.8)

HSP 1 Score: 58.9214 bits (141), Expect = 4.165e-10
Identity = 37/98 (37.76%), Postives = 55/98 (56.12%), Query Frame = 1
Query:  118 NKVYTINVGGIIHTTTLSTLCRYPNSMIA---RMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLE 402
            + +  +NVGG +  T+ STL     +MI    +M + S  P Q  DSN  IF+DR    F  +LNFLR G + LP+     N ++ EA +Y L+EL++
Sbjct:    5 DNIVKLNVGGTVFQTSKSTL-----TMIDGFFKMMLESDIPLQKDDSNC-IFIDRSPKHFDIILNFLRDGDVDLPEQEKEINEVKREAQFYLLEELVD 96          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: ZC239.4 (pep chromosome:WBcel235:II:3214452:3215565:1 gene:WBGene00022567.1 transcript:ZC239.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC239.4)

HSP 1 Score: 59.3066 bits (142), Expect = 4.330e-10
Identity = 38/107 (35.51%), Postives = 55/107 (51.40%), Query Frame = 1
Query:  133 INVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK----IYRTDQTTLN 441
            ++VGG I  T+ STL ++      R  +GS     ++D +G IF+DR    F  +LNF+R G L LP        L  EA YY LD L++ L        +D+ T+N
Sbjct:    7 LDVGGTIFKTSKSTLTKFDG--FFRTMLGS-GIGLNVDESGCIFIDRSPKHFDLILNFMRDGCLALPKNERDLTELMAEAQYYLLDGLIDRLASSNWSVESDEKTIN 110          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: Ktl (gene:FBgn0038839 transcript:FBtr0347575)

HSP 1 Score: 84.3445 bits (207), Expect = 5.680e-19
Identity = 43/100 (43.00%), Postives = 65/100 (65.00%), Query Frame = 1
Query:  121 KVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYR 420
            ++  +NVGG+ +TTTL+TL +  ++++A +F G    S + DS G  FLDRDGVLF Y+L+FLR   L LP+GF     L  EA+++ L  +LE ++  R
Sbjct:    3 EIIELNVGGVSYTTTLATLLQDKSTLLAELF-GEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDKALHLPEGFRERQRLLREAEHFKLTAMLECIRSER 101          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: Ktl (gene:FBgn0038839 transcript:FBtr0083986)

HSP 1 Score: 84.3445 bits (207), Expect = 5.680e-19
Identity = 43/100 (43.00%), Postives = 65/100 (65.00%), Query Frame = 1
Query:  121 KVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYR 420
            ++  +NVGG+ +TTTL+TL +  ++++A +F G    S + DS G  FLDRDGVLF Y+L+FLR   L LP+GF     L  EA+++ L  +LE ++  R
Sbjct:    3 EIIELNVGGVSYTTTLATLLQDKSTLLAELF-GEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDKALHLPEGFRERQRLLREAEHFKLTAMLECIRSER 101          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: twz (gene:FBgn0034636 transcript:FBtr0071692)

HSP 1 Score: 75.0998 bits (183), Expect = 4.614e-15
Identity = 40/105 (38.10%), Postives = 65/105 (61.90%), Query Frame = 1
Query:  133 INVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDS-NGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNN 444
            I+VGG I+T++L TL +YP S +A++F G IP    +DS   + F+DRDG +F ++LNF+R+  L + + F     L  EA YY ++ +++ L+  R D+    N
Sbjct:  110 IDVGGTIYTSSLETLTKYPESKLAKLFNGQIP--IVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGN 212          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: twz (gene:FBgn0034636 transcript:FBtr0308642)

HSP 1 Score: 75.0998 bits (183), Expect = 5.259e-15
Identity = 40/105 (38.10%), Postives = 65/105 (61.90%), Query Frame = 1
Query:  133 INVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDS-NGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNN 444
            I+VGG I+T++L TL +YP S +A++F G IP    +DS   + F+DRDG +F ++LNF+R+  L + + F     L  EA YY ++ +++ L+  R D+    N
Sbjct:  139 IDVGGTIYTSSLETLTKYPESKLAKLFNGQIP--IVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGN 241          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: CG10465 (gene:FBgn0033017 transcript:FBtr0086094)

HSP 1 Score: 64.6994 bits (156), Expect = 1.260e-11
Identity = 37/98 (37.76%), Postives = 56/98 (57.14%), Query Frame = 1
Query:  103 LKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDEL 396
            LK  +++   +NVGG ++ TT+ TL +  ++M++ MF G +      DS G I +DR G  FG +LN+LR G + LP+       L  EA YY + EL
Sbjct:   13 LKGHSSQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRM--EVLTDSEGWILIDRCGNHFGIILNYLRDGTVPLPETNKEIAELLAEAKYYCITEL 108          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: CR352234.1 (pep chromosome:GRCz11:CHR_ALT_CTG23_1_16:19672488:19673353:1 gene:ENSDARG00000111861.1 transcript:ENSDART00000180550.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352234.1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.985e-24
Identity = 47/93 (50.54%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            T+NVGG ++TT++STL RYP+SM+  MF G  P ++  D+ GN F+DRDG LF Y+LNFLR+  LTLP  F   + L+ EAD+Y ++ L++ L
Sbjct:   14 TLNVGGHLYTTSISTLQRYPDSMLGAMFRGDFPTTR--DAQGNYFIDRDGTLFRYILNFLRTSELTLPVDFTELDLLRKEADFYQIEPLIQCL 104          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd6a (potassium channel tetramerization domain containing 6a [Source:ZFIN;Acc:ZDB-GENE-050208-474])

HSP 1 Score: 99.7525 bits (247), Expect = 2.343e-24
Identity = 49/103 (47.57%), Postives = 69/103 (66.99%), Query Frame = 1
Query:  100 DLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            D  ++     T+NVGG ++TT+LSTL RYP+SM+  MF G  P ++  D+ GN F+DRDG LF Y+LNFLR+  LTLP  F     L+ EAD+Y ++ L++ L
Sbjct:    5 DWTHMMMDTVTLNVGGHLYTTSLSTLQRYPDSMLGAMFRGDFPTTR--DTQGNYFIDRDGPLFRYILNFLRTSKLTLPCDFKETELLRKEADFYQIEPLIQCL 105          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd6b (potassium channel tetramerization domain containing 6b [Source:NCBI gene;Acc:436601])

HSP 1 Score: 99.3673 bits (246), Expect = 2.544e-24
Identity = 47/93 (50.54%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            T+NVGG ++TT++STL RYP+SM+  MF G  P ++  D+ GN F+DRDG LF Y+LNFLR+  LTLP  F   + L+ EAD+Y ++ L++ L
Sbjct:   15 TLNVGGHLYTTSISTLQRYPDSMLGAMFRGDFPTTR--DAQGNYFIDRDGTLFRYILNFLRTSELTLPVDFTELDLLRKEADFYQIEPLIQCL 105          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd6b (potassium channel tetramerization domain containing 6b [Source:NCBI gene;Acc:436601])

HSP 1 Score: 99.3673 bits (246), Expect = 2.679e-24
Identity = 47/93 (50.54%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            T+NVGG ++TT++STL RYP+SM+  MF G  P ++  D+ GN F+DRDG LF Y+LNFLR+  LTLP  F   + L+ EAD+Y ++ L++ L
Sbjct:   15 TLNVGGHLYTTSISTLQRYPDSMLGAMFRGDFPTTR--DAQGNYFIDRDGTLFRYILNFLRTSELTLPVDFTELDLLRKEADFYQIEPLIQCL 105          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd4 (potassium channel tetramerization domain containing 4 [Source:ZFIN;Acc:ZDB-GENE-040704-71])

HSP 1 Score: 90.5077 bits (223), Expect = 8.411e-21
Identity = 51/140 (36.43%), Postives = 74/140 (52.86%), Query Frame = 1
Query:  106 KNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNSTNSKFVGYFIEIMEFEEASSFNRFYT 525
            K  ++   TINVGG ++     TL ++P S++  M  G   P   +DS GN F+DRDG +F ++LNFLR G L LP+ F     L+ EA++Y L EL +AL+ +   Q T            F+E+ +  E S   R Y 
Sbjct:   27 KKPSSGTITINVGGYLYAAQRHTLAKHPGSLLEEMVTGK-KPVLHVDSMGNTFIDRDGPIFRHILNFLRLGELVLPEDFKETELLRREANFYRLSELAQALQDWEQQQATQREPA-------FLEVTDSHERSQGLRVYC 158          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: spdl1 (spindle apparatus coiled-coil protein 1 [Source:Xenbase;Acc:XB-GENE-5754925])

HSP 1 Score: 105.916 bits (263), Expect = 2.050e-26
Identity = 55/116 (47.41%), Postives = 75/116 (64.66%), Query Frame = 1
Query:   91 DRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK----IYRTD 426
            D  D   +     T+NVGG ++TT+LSTL RYP+SM+  MF G  P ++  DS GN F+DRDG LF Y+LNFLR+  LTLP  F  F+ L+ EAD+Y ++ L++ L     +Y TD
Sbjct:   20 DNGDWGYMMTDPVTLNVGGHVYTTSLSTLTRYPDSMLGAMFRGDFPTAR--DSQGNYFIDRDGALFRYILNFLRTSELTLPVDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPTD 133          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: spdl1 (spindle apparatus coiled-coil protein 1 [Source:Xenbase;Acc:XB-GENE-5754925])

HSP 1 Score: 105.916 bits (263), Expect = 2.969e-26
Identity = 55/116 (47.41%), Postives = 75/116 (64.66%), Query Frame = 1
Query:   91 DRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK----IYRTD 426
            D  D   +     T+NVGG ++TT+LSTL RYP+SM+  MF G  P ++  DS GN F+DRDG LF Y+LNFLR+  LTLP  F  F+ L+ EAD+Y ++ L++ L     +Y TD
Sbjct:   37 DNGDWGYMMTDPVTLNVGGHVYTTSLSTLTRYPDSMLGAMFRGDFPTAR--DSQGNYFIDRDGALFRYILNFLRTSELTLPVDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPTD 150          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: spdl1 (spindle apparatus coiled-coil protein 1 [Source:Xenbase;Acc:XB-GENE-5754925])

HSP 1 Score: 107.071 bits (266), Expect = 3.990e-25
Identity = 53/103 (51.46%), Postives = 72/103 (69.90%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK----IYRTD 426
            T+NVGG ++TT+LSTL RYP+SM+  MF G  P ++  DS GN F+DRDG LF Y+LNFLR+  LTLP  F  F+ L+ EAD+Y ++ L++ L     +Y TD
Sbjct:  504 TLNVGGHVYTTSLSTLTRYPDSMLGAMFRGDFPTAR--DSQGNYFIDRDGALFRYILNFLRTSELTLPVDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPTD 604          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: clip1 (CAP-Gly domain containing linker protein 1 [Source:Xenbase;Acc:XB-GENE-1012946])

HSP 1 Score: 83.9593 bits (206), Expect = 3.888e-18
Identity = 44/106 (41.51%), Postives = 71/106 (66.98%), Query Frame = 1
Query:  115 TNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDS-NGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQ 429
            +N    I+VGG ++T++L+TL +YP+S I+R+F G+ P    +DS   + F+DRDG +F Y+L+FLR+  L LP+ F  FN L  EA YY L  +++ L+ ++ D+
Sbjct:   57 SNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEP--IVLDSLKQHYFIDRDGEIFRYILSFLRTSKLLLPEDFKEFNLLYEEAKYYQLHPMVKELERWKQDK 160          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: clip1 (CAP-Gly domain containing linker protein 1 [Source:Xenbase;Acc:XB-GENE-1012946])

HSP 1 Score: 83.5741 bits (205), Expect = 3.969e-18
Identity = 44/106 (41.51%), Postives = 71/106 (66.98%), Query Frame = 1
Query:  115 TNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDS-NGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQ 429
            +N    I+VGG ++T++L+TL +YP+S I+R+F G+ P    +DS   + F+DRDG +F Y+L+FLR+  L LP+ F  FN L  EA YY L  +++ L+ ++ D+
Sbjct:   28 SNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEP--IVLDSLKQHYFIDRDGEIFRYILSFLRTSKLLLPEDFKEFNLLYEEAKYYQLHPMVKELERWKQDK 131          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd21 (potassium channel tetramerisation domain containing 21 [Source:MGI Symbol;Acc:MGI:3643121])

HSP 1 Score: 98.5969 bits (244), Expect = 9.965e-24
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            T+NVGG ++TT+L+TL  +P+SM+  MF G +P  +  DS GN F+DRDG +F Y+LNFLR+  L LP+ F     L+ EAD+Y +  L+EAL+
Sbjct:    6 TLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKR--DSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQ 97          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd6 (potassium channel tetramerisation domain containing 6 [Source:MGI Symbol;Acc:MGI:1918643])

HSP 1 Score: 87.8113 bits (216), Expect = 5.796e-20
Identity = 51/106 (48.11%), Postives = 71/106 (66.98%), Query Frame = 1
Query:   91 DRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            D  D   + +   T+NVGG ++TT+L+TL RYP+SM+  MF G  P ++  D  GN F+DRDG LF YVLNFLR+  LTLP  F  F+ L+ EAD+Y ++ L++ L
Sbjct:    2 DNGDWGYMMSDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTAR--DPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCL 105          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd6 (potassium channel tetramerisation domain containing 6 [Source:MGI Symbol;Acc:MGI:1918643])

HSP 1 Score: 87.8113 bits (216), Expect = 5.796e-20
Identity = 51/106 (48.11%), Postives = 71/106 (66.98%), Query Frame = 1
Query:   91 DRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            D  D   + +   T+NVGG ++TT+L+TL RYP+SM+  MF G  P ++  D  GN F+DRDG LF YVLNFLR+  LTLP  F  F+ L+ EAD+Y ++ L++ L
Sbjct:    2 DNGDWGYMMSDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTAR--DPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCL 105          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd11 (potassium channel tetramerisation domain containing 11 [Source:MGI Symbol;Acc:MGI:2448712])

HSP 1 Score: 86.6557 bits (213), Expect = 2.455e-19
Identity = 44/104 (42.31%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGS--IPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTT 435
            T+NVGG +++TTL TL R+P+SM+  MF     +P + +   +G+ F+DRDG  F ++LNFLR G L LP G+     L+ EAD+Y +  LL+AL+     + T
Sbjct:   18 TLNVGGTLYSTTLETLTRFPDSMLGAMFRADTLMPANLNPQGDGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLKAEADFYQIRPLLDALRELEASRGT 121          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd15 (potassium channel tetramerisation domain containing 15 [Source:MGI Symbol;Acc:MGI:2385276])

HSP 1 Score: 85.8853 bits (211), Expect = 6.414e-19
Identity = 47/112 (41.96%), Postives = 70/112 (62.50%), Query Frame = 1
Query:  115 TNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDS-NGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNS 447
             N    I+VGG ++T++L+TL +YP+S I+R+F G+ P    +DS   + F+DRDG +F Y+L+FLR+  L LPD F  FN L  EA YY L  ++  L+ ++ DQ     S
Sbjct:   54 ANAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEP--IVLDSLKQHYFIDRDGEIFRYILSFLRTSKLLLPDDFKDFNLLYEEARYYQLQPMVRELERWQQDQEQRRRS 163          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DG99|KCTD6_DANRE (BTB/POZ domain-containing protein KCTD6 OS=Danio rerio OX=7955 GN=kctd6 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.022e-23
Identity = 47/93 (50.54%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            T+NVGG ++TT++STL RYP+SM+  MF G  P ++  D+ GN F+DRDG LF Y+LNFLR+  LTLP  F   + L+ EAD+Y ++ L++ L
Sbjct:   15 TLNVGGHLYTTSISTLQRYPDSMLGAMFRGDFPTTR--DAQGNYFIDRDGTLFRYILNFLRTSELTLPVDFTELDLLRKEADFYQIEPLIQCL 105          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4G0X4|KCD21_HUMAN (BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 7.643e-23
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            T+NVGG ++TT+L+TL  +P+SM+  MF G +P  +  DS GN F+DRDG +F Y+LNFLR+  L LP+ F     L+ EAD+Y +  L+EAL+
Sbjct:    6 TLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKR--DSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQ 97          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3URF8|KCD21_MOUSE (BTB/POZ domain-containing protein KCTD21 OS=Mus musculus OX=10090 GN=Kctd21 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 7.801e-23
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            T+NVGG ++TT+L+TL  +P+SM+  MF G +P  +  DS GN F+DRDG +F Y+LNFLR+  L LP+ F     L+ EAD+Y +  L+EAL+
Sbjct:    6 TLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKR--DSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQ 97          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BNL5|KCTD6_MOUSE (BTB/POZ domain-containing protein KCTD6 OS=Mus musculus OX=10090 GN=Kctd6 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.054e-19
Identity = 51/106 (48.11%), Postives = 71/106 (66.98%), Query Frame = 1
Query:   91 DRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            D  D   + +   T+NVGG ++TT+L+TL RYP+SM+  MF G  P ++  D  GN F+DRDG LF YVLNFLR+  LTLP  F  F+ L+ EAD+Y ++ L++ L
Sbjct:    2 DNGDWGYMMSDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTAR--DPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCL 105          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NC69|KCTD6_HUMAN (BTB/POZ domain-containing protein KCTD6 OS=Homo sapiens OX=9606 GN=KCTD6 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 4.396e-19
Identity = 51/106 (48.11%), Postives = 70/106 (66.04%), Query Frame = 1
Query:   91 DRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            D  D   +     T+NVGG ++TT+L+TL RYP+SM+  MF G  P ++  D  GN F+DRDG LF YVLNFLR+  LTLP  F  F+ L+ EAD+Y ++ L++ L
Sbjct:    2 DNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTAR--DPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCL 105          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A267F2N0 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000784g3 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.791e-52
Identity = 94/244 (38.52%), Postives = 141/244 (57.79%), Query Frame = 1
Query:  115 TNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNSTNSKF-------VGYFIEIMEFEEASSFNRFYTHGDLHHNSHWRVTPKNGGLIVSGHQDVLKSLPIS-------YSPESVSPDYPSVIVHSRHKMEIFHYLSSKSWQLTHTGLSYGTDSDGSYIIHEYVWQKP 804
            + +   +NVGGI+HTTT +TLC++P SM+A MF GS  PS   D  G++F+DRDG LF +VLN+LR   L LPDGF  F+ L+ EAD++GL  LL A +  R    +      ++          Y +E++EFEE + F RFY       +++     K+GGL++SGH + L++LP+            + +  Y SV V +  K+ +FH+++   W L      Y TDSDGSY++H+Y+W  P
Sbjct:    4 SEQAVVLNVGGIVHTTTRATLCKFPGSMLAVMFGGSFTPSVLRDPAGHVFIDRDGRLFRHVLNYLRCSRLCLPDGFQEFDLLEAEADFFGLPGLLAACRERRDAHVSQQQQPQAQAPSAADIPFKYLVEVLEFEETAYFYRFYMPPPNRQSNNGAF--KSGGLVISGHSEALRALPLQRPAEEPAGGAAAAADSYQSVSVSNSEKLALFHHMARTGWALRSDAFGYSTDSDGSYMVHKYIWLWP 245          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A210QZJ6 (BTB/POZ domain-containing protein KCTD21 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT25428 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 6.268e-26
Identity = 68/211 (32.23%), Postives = 114/211 (54.03%), Query Frame = 1
Query:  133 INVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNSTNSKFVGYFIEIMEFEEASSFNRFYTHGDLHHNSHWRVTPKNGGLIVSGHQDVLKSLPISYSPESVSP--------DYPSVIVHSRH-KMEIFHYLSSKSWQLTHT 738
            +NVGG+++TTT +TLC+Y +SM+  MFIGS+    + D N   F+DRDG +F Y+LNFLRS  L+LPD F  F+ L +EAD+Y +  L++AL + R ++   +  T+     +F+E++E    +      T     +NS  +        +++G +DV+ SLP     E  S         DY  + ++  + ++ +   L +  W +  T
Sbjct:    9 LNVGGVMYTTTKATLCKYRDSMLGAMFIGSM--RSATDQNDCPFIDRDGEMFKYILNFLRSSKLSLPDDFKDFDLLAVEADFYQIQPLIDALSMLRDERQRDDLKTH-----FFVEVIEVRTGT------TATMPSNNSRVKT-------VLAGRKDVILSLPSELVGEGASEKLQKNEGFDYVELQLNGANVRLRLAETLRNGGWHIVDT 199          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A2G8KXD4 (Putative BTB/POZ domain-containing protein KCTD6-like OS=Stichopus japonicus OX=307972 GN=BSL78_10441 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.052e-24
Identity = 65/168 (38.69%), Postives = 88/168 (52.38%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNSTNSKF----VGYFIEIMEFEEASSFNRFYTHGDLHHNSHWRVTPKNGGLIVSGHQDVLKSLP 621
            ++NVGG I+TT  +TL RYP+SM+  MF G +P   ++D+ G   +D DG LF YVLNFLR   L LP+ F   + L  EADYY + EL+EALK  R ++  +      K     V  F+E+ EFE A              N HW         I+    D+LK +P
Sbjct:    6 SLNVGGHIYTTARTTLVRYPDSMLGSMFSGRMP--TTVDNEGRFLIDGDGPLFRYVLNFLRRSELILPENFPELDMLMAEADYYQISELVEALKNIRDNKIAIQEEIKRKLDEPKVQEFLEV-EFECA--------------NGHW---------IIFARADILKKIP 147          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: R7U610 (BTB domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_154970 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.340e-24
Identity = 65/173 (37.57%), Postives = 98/173 (56.65%), Query Frame = 1
Query:  112 ITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNSTNSKFVGYFIEIMEFEEASSFNRFYTHGDLHHNSHWRVTPKNGGLIVSGHQDVLKSLPISY 630
            + + +  +NVGG+ +TTT +TL R+PNSM+  MF GS+P ++  D +G+ F+DRDG LFGYVLNFLRS  L LPD F   + L +EAD++ ++ L++A+  Y+  +      T     G  +E++E    S      T     +NS  +        IVSG  DV+  LP  +
Sbjct:   23 MCDDLLRLNVGGVSYTTTKATLSRFPNSMLGAMFNGSMPTTR--DDSGSYFIDRDGHLFGYVLNFLRSSQLALPDNFSLIDQLSLEADFFQVEPLIQAINEYKKRRQHPAART-----GCLLEVIEVRTGS------TATMPTNNSRVKT-------IVSGRSDVISHLPSEF 175          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: V4AKW4 (BTB domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_79214 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 5.253e-24
Identity = 51/93 (54.84%), Postives = 68/93 (73.12%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            T+NVGG ++TTT STLC+YP+SM+  M  G      SIDSNG+ F+DRDG +F +VLNFLRS  L+LP  F +F+ L IEAD+Y +  L+EA+
Sbjct:    4 TLNVGGYLYTTTKSTLCKYPDSMLGVMMSGKF--DTSIDSNGHRFIDRDGAMFQHVLNFLRSSHLSLPSDFKTFDLLSIEADFYQIQPLIEAI 94          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: kctd6a (potassium channel tetramerization domain containing 6 [Source:NCBI gene;Acc:103045563])

HSP 1 Score: 99.7525 bits (247), Expect = 1.754e-24
Identity = 49/93 (52.69%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            T+NVGG I+TT+LSTL RYP+SM+  MF G  P ++  D+ GN F+DRDG LF +VLNFLR+  LTLP  F     L+ EAD+Y ++ L+++L
Sbjct:   15 TLNVGGHIYTTSLSTLQRYPDSMLGAMFRGDFPTAR--DAQGNFFIDRDGPLFRFVLNFLRTSELTLPYDFKETELLRKEADFYQIEPLIQSL 105          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: kctd6a (potassium channel tetramerization domain containing 6 [Source:NCBI gene;Acc:103045563])

HSP 1 Score: 99.7525 bits (247), Expect = 1.754e-24
Identity = 49/93 (52.69%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            T+NVGG I+TT+LSTL RYP+SM+  MF G  P ++  D+ GN F+DRDG LF +VLNFLR+  LTLP  F     L+ EAD+Y ++ L+++L
Sbjct:   15 TLNVGGHIYTTSLSTLQRYPDSMLGAMFRGDFPTAR--DAQGNFFIDRDGPLFRFVLNFLRTSELTLPYDFKETELLRKEADFYQIEPLIQSL 105          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: kctd6b (BTB/POZ domain-containing protein KCTD6 [Source:NCBI gene;Acc:103028649])

HSP 1 Score: 98.2117 bits (243), Expect = 6.229e-24
Identity = 46/93 (49.46%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            T+NVGG ++TT+++TL RYP+SM+  MF G  P ++  D+ GN F+DRDG LF Y+LNFLR+  LTLP  F   + L+ EAD+Y ++ L++ L
Sbjct:   15 TLNVGGHLYTTSIATLQRYPDSMLGAMFRGDFPTTR--DAQGNYFIDRDGTLFRYILNFLRTSELTLPSDFVETDLLRKEADFYQIEPLIQCL 105          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: KCTD12 (potassium channel tetramerization domain containing 12 [Source:HGNC Symbol;Acc:HGNC:14678])

HSP 1 Score: 86.6557 bits (213), Expect = 2.582e-19
Identity = 42/92 (45.65%), Postives = 56/92 (60.87%), Query Frame = 1
Query:  133 INVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            +NVGG ++ T  STL   P+S++ RMF    P   S D+ G  FLDRDG LF Y+L++LR G L LPD F     L+ EA+++ L EL   L
Sbjct:   17 LNVGGQVYVTRRSTLVSVPDSLLGRMFGQQSPAELSTDTKGRFFLDRDGFLFRYILDYLRDGNLVLPDYFRERAGLRREAEFFQLRELARRL 108          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: kctd8 (potassium channel tetramerization domain containing 8 [Source:NCBI gene;Acc:103044733])

HSP 1 Score: 82.4185 bits (202), Expect = 8.945e-18
Identity = 44/108 (40.74%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  121 KVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNN 444
            +V  +NVGG ++ T  +TL   P++ +  MF    P     DS G  F+DRDG LF YVL+FLR   L LP+ F     LQ EA+++ L ELL  L      Q +LN+
Sbjct:   21 EVIELNVGGQVYVTKRATLLSVPDTPLHAMFARRAPRELPRDSRGRFFIDRDGFLFRYVLDFLRDRQLVLPEHFPERERLQREAEHFQLGELLRILGPKVAKQGSLND 128          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: kctd6a (potassium channel tetramerization domain containing 6a [Source:ZFIN;Acc:ZDB-GENE-050208-474])

HSP 1 Score: 95.5153 bits (236), Expect = 1.223e-23
Identity = 45/99 (45.45%), Postives = 70/99 (70.71%), Query Frame = 1
Query:  112 ITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            I ++  T+NVGG +++T+ +TL RY +SM+  MF G +P ++  D+ G+ F+DRDG LF YVLNFLR+  LTLP  F   + L+ EAD+Y +++L++ L
Sbjct:    9 IMSEPVTLNVGGHLYSTSRATLTRYSDSMLGAMFSGDLPTAR--DAQGHYFIDRDGPLFRYVLNFLRTSELTLPQDFKEIDLLRKEADFYQIEQLIQCL 105          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: KCTD18 (potassium channel tetramerization domain containing 18 [Source:HGNC Symbol;Acc:HGNC:26446])

HSP 1 Score: 73.559 bits (179), Expect = 1.225e-16
Identity = 38/88 (43.18%), Postives = 54/88 (61.36%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGL 387
            +  +NVGG+  T    +LCRY +SM+  MF G  P  Q  DS G   ++RDG LF Y+L++L  GVL +P    +  +LQ EADY+G+
Sbjct:   14 ILRLNVGGVAMTARRDSLCRYKDSMLGAMFSGRFPLKQ--DSTGACVIERDGQLFKYLLDYLH-GVLRIPTDEKTRIALQGEADYFGI 98          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: KCTD18 (potassium channel tetramerization domain containing 18 [Source:HGNC Symbol;Acc:HGNC:26446])

HSP 1 Score: 74.7146 bits (182), Expect = 4.029e-16
Identity = 38/88 (43.18%), Postives = 54/88 (61.36%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGL 387
            +  +NVGG+  T    +LCRY +SM+  MF G  P  Q  DS G   ++RDG LF Y+L++L  GVL +P    +  +LQ EADY+G+
Sbjct:   14 ILRLNVGGVAMTARRDSLCRYKDSMLGAMFSGRFPLKQ--DSTGACVIERDGQLFKYLLDYLH-GVLRIPTDEKTRIALQGEADYFGI 98          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: kctd12b (potassium channel tetramerisation domain containing 12b [Source:ZFIN;Acc:ZDB-GENE-050417-104])

HSP 1 Score: 73.559 bits (179), Expect = 2.715e-15
Identity = 41/112 (36.61%), Postives = 66/112 (58.93%), Query Frame = 1
Query:  121 KVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNSTNS 456
            +V  +NVGG ++ T  +TL   P+S++ R+F   I  +    +    F+DRDG LF Y+L++LR   L LP+ F   + LQ EA+++GL EL  +L   R   +T N+ T++
Sbjct:   20 EVIELNVGGQVYLTRCATLVSAPDSLLGRIFSCLIDRACRFRTLLCYFIDRDGFLFRYILDYLRDNRLVLPEHFPERSRLQREAEFFGLPELARSLAPRRI--STQNSITDA 129          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: kctd7 (potassium channel tetramerization domain containing 7 [Source:NCBI gene;Acc:735248])

HSP 1 Score: 58.151 bits (139), Expect = 3.004e-10
Identity = 43/126 (34.13%), Postives = 60/126 (47.62%), Query Frame = 1
Query:  121 KVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGS--IPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNSTNSKFVGYFIEIMEF 492
            +V  +NVGG    T LSTL     SM+A MF G   +P     D  G  F+DRD   FG +LNFLRSG +   +       +  EA Y+GL  LL  L+       TL      +    F++++ +
Sbjct:    3 EVVQLNVGGTHFATLLSTLRSCEGSMLAAMFSGRHRLPR----DHVGRFFIDRDPAYFGDILNFLRSGEVPCHE---RARGVHREAHYFGLQPLLACLE-------TLQPLAGERVRQAFLDLLPY 114          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO34594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNY3])

HSP 1 Score: 92.4337 bits (228), Expect = 1.071e-23
Identity = 44/96 (45.83%), Postives = 65/96 (67.71%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            +  +NVGG ++TT+  TL R  +SM+  MF G    + + D+ GN F+DRDG LF Y+LNFLR+  L LPD F  F  L +EAD+Y +++L++AL+
Sbjct:    1 IVNLNVGGYVYTTSYKTLTRCRDSMLGAMFSGR--QNLARDTRGNFFIDRDGSLFRYILNFLRTSELCLPDSFDEFQQLSLEADFYQIEDLIKALQ 94          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO43731 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXW1])

HSP 1 Score: 86.2705 bits (212), Expect = 2.229e-21
Identity = 43/94 (45.74%), Postives = 63/94 (67.02%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            ++NVGG  +T+T  TL +YP S++A+M  G IP  +  D  G  F+DRDG  F Y+L FLR+G LT+P+G+  F  L  EA++Y L+ L+E +K
Sbjct:    2 SLNVGGYNYTSTAYTLTQYPKSVLAQMCNGIIPVPR--DLKGQQFIDRDGATFRYILTFLRTGKLTVPEGYKYFRELLTEAEFYRLEPLVELIK 93          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO32194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVR4])

HSP 1 Score: 82.8037 bits (203), Expect = 5.117e-20
Identity = 49/96 (51.04%), Postives = 65/96 (67.71%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            +  +NVGG   TTTL TL  +P+SM+  MF G IP ++  DSNG  F+DRDG LF Y+LNFLRS VL+LP  F  +  L  EAD+Y ++ L+E +K
Sbjct:   10 IIDLNVGGNHFTTTLLTLTTFPDSMLGSMFSGRIPVNR--DSNGRFFIDRDGTLFRYILNFLRSNVLSLPANFKDYELLLNEADFYQIEPLIEEIK 103          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO28987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVR4])

HSP 1 Score: 82.8037 bits (203), Expect = 5.117e-20
Identity = 49/96 (51.04%), Postives = 65/96 (67.71%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            +  +NVGG   TTTL TL  +P+SM+  MF G IP ++  DSNG  F+DRDG LF Y+LNFLRS VL+LP  F  +  L  EAD+Y ++ L+E +K
Sbjct:   10 IIDLNVGGNHFTTTLLTLTTFPDSMLGSMFSGRIPVNR--DSNGRFFIDRDGTLFRYILNFLRSNVLSLPANFKDYELLLNEADFYQIEPLIEEIK 103          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO34699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNM1])

HSP 1 Score: 80.1073 bits (196), Expect = 1.035e-17
Identity = 41/98 (41.84%), Postives = 64/98 (65.31%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIG--SIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALK 411
            V  +NVGG ++TT+L TL +   S+++ MF G   IP     DS G  F+DRDGVLF Y+L++LR+  L LP+GF+    L +EA+++ L  ++ A++
Sbjct:   16 VVELNVGGQLYTTSLPTLLKDSESLLSSMFSGRQKIPR----DSRGRFFIDRDGVLFRYILDYLRNCKLALPEGFNERERLTMEAEHFKLKGMVRAIQ 109          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: kctd6b (potassium channel tetramerization domain containing 6 [Source:NCBI gene;Acc:101166793])

HSP 1 Score: 99.3673 bits (246), Expect = 2.351e-24
Identity = 48/93 (51.61%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  130 TINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            T+NVGG ++TT+LSTL RYP+SM+  MF G  P ++  D+ GN F+DRDG LF Y+LNFLR+  LTLP  F   + L+ EAD+Y ++ L++ L
Sbjct:   15 TLNVGGHLYTTSLSTLQRYPDSMLGAMFRGDFPTAR--DAQGNYFIDRDGTLFRYILNFLRTSELTLPVDFTETDLLRKEADFYQIEPLIQCL 105          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000003771.2 (uncharacterized LOC101156882 [Source:NCBI gene;Acc:101156882])

HSP 1 Score: 82.0333 bits (201), Expect = 5.019e-18
Identity = 44/108 (40.74%), Postives = 70/108 (64.81%), Query Frame = 1
Query:  115 TNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDS-NGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTT 435
            +N    I+VGG ++T++L+ L RYP+S IAR+F G+ P    +DS   + F+DRDG +F Y+LNFLR+  L +P+ F  +  L  EA ++ L  LLE L+ ++ +Q +
Sbjct:   21 SNAPVHIDVGGHMYTSSLAMLTRYPDSRIARLFNGTEP--LVLDSLKQHYFIDRDGPMFRYILNFLRTSKLLVPEDFREYCLLYEEAVFFQLAPLLEELERWKAEQES 126          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028746.1 (uncharacterized LOC101156882 [Source:NCBI gene;Acc:101156882])

HSP 1 Score: 82.4185 bits (202), Expect = 5.914e-18
Identity = 44/108 (40.74%), Postives = 70/108 (64.81%), Query Frame = 1
Query:  115 TNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDS-NGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTT 435
            +N    I+VGG ++T++L+ L RYP+S IAR+F G+ P    +DS   + F+DRDG +F Y+LNFLR+  L +P+ F  +  L  EA ++ L  LLE L+ ++ +Q +
Sbjct:   33 SNAPVHIDVGGHMYTSSLAMLTRYPDSRIARLFNGTEP--LVLDSLKQHYFIDRDGPMFRYILNFLRTSKLLVPEDFREYCLLYEEAVFFQLAPLLEELERWKAEQES 138          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: KCTD1 (potassium channel tetramerization domain containing 1 [Source:NCBI gene;Acc:101161754])

HSP 1 Score: 80.1073 bits (196), Expect = 3.910e-17
Identity = 43/106 (40.57%), Postives = 68/106 (64.15%), Query Frame = 1
Query:  115 TNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDS-NGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQ 429
            +N    I+VGG ++T++L+TL ++P S I R+F G+ P    +DS   + F+DRDG +F Y+LNFLR+  L +P+ F  ++ L  EA Y+ L  +L  L+ +R DQ
Sbjct:   36 SNAPVHIDVGGHMYTSSLATLTKFPESRIGRLFDGTEP--IVLDSLKQHYFIDRDGHMFRYILNFLRTSKLLIPEDFKDYSLLYEEARYFQLQPMLAELERWRQDQ 139          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: KCTD1 (potassium channel tetramerization domain containing 1 [Source:NCBI gene;Acc:101161754])

HSP 1 Score: 80.1073 bits (196), Expect = 3.910e-17
Identity = 43/106 (40.57%), Postives = 68/106 (64.15%), Query Frame = 1
Query:  115 TNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDS-NGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQ 429
            +N    I+VGG ++T++L+TL ++P S I R+F G+ P    +DS   + F+DRDG +F Y+LNFLR+  L +P+ F  ++ L  EA Y+ L  +L  L+ +R DQ
Sbjct:   36 SNAPVHIDVGGHMYTSSLATLTKFPESRIGRLFDGTEP--IVLDSLKQHYFIDRDGHMFRYILNFLRTSKLLIPEDFKDYSLLYEEARYFQLQPMLAELERWRQDQ 139          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000017037.1 (SMESG000017037.1)

HSP 1 Score: 503.827 bits (1296), Expect = 0.000e+0
Identity = 245/246 (99.59%), Postives = 246/246 (100.00%), Query Frame = 1
Query:   76 MNNHYDRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNSTNSKFVGYFIEIMEFEEASSFNRFYTHGDLHHNSHWRVTPKNGGLIVSGHQDVLKSLPISYSPESVSPDYPSVIVHSRHKMEIFHYLSSKSWQLTHTGLSYGTDSDGSYIIHEYVWQKPVLN 813
            MNNHYDRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNSTNSKFVGYFIEIMEFEEASSFNRFYTHGDLH+NSHWRVTPKNGGLIVSGHQDVLKSLPISYSPESVSPDYPSVIVHSRHKMEIFHYLSSKSWQLTHTGLSYGTDSDGSYIIHEYVWQKPVLN
Sbjct:    1 MNNHYDRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEALKIYRTDQTTLNNSTNSKFVGYFIEIMEFEEASSFNRFYTHGDLHNNSHWRVTPKNGGLIVSGHQDVLKSLPISYSPESVSPDYPSVIVHSRHKMEIFHYLSSKSWQLTHTGLSYGTDSDGSYIIHEYVWQKPVLN 246          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000042930.1 (SMESG000042930.1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.064e-17
Identity = 45/95 (47.37%), Postives = 60/95 (63.16%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            +  +NVGG  +TT LSTLCRYP+SM+A MF G     Q  D++GN FLD +G+ F Y+L++LR+  L  P     F  +  EA YYG+  L EAL
Sbjct:   21 IINLNVGGHFYTTRLSTLCRYPDSMLATMFSGRHTIDQ--DASGNYFLDNNGIYFSYLLDYLRNETLP-PKEMAVF--VYKEAGYYGISNLQEAL 110          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000042930.1 (SMESG000042930.1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.206e-17
Identity = 45/95 (47.37%), Postives = 60/95 (63.16%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            +  +NVGG  +TT LSTLCRYP+SM+A MF G     Q  D++GN FLD +G+ F Y+L++LR+  L  P     F  +  EA YYG+  L EAL
Sbjct:   21 IINLNVGGHFYTTRLSTLCRYPDSMLATMFSGRHTIDQ--DASGNYFLDNNGIYFSYLLDYLRNETLP-PKEMAVF--VYKEAGYYGISNLQEAL 110          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000027727.1 (SMESG000027727.1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.165e-17
Identity = 45/95 (47.37%), Postives = 60/95 (63.16%), Query Frame = 1
Query:  124 VYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSIPPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGLDELLEAL 408
            +  +NVGG  +TT LSTLCRYP+SM+A MF G     Q  D++GN FLD +G+ F Y+L++LR+  L  P     F  +  EA YYG+  L EAL
Sbjct:   21 IINLNVGGHFYTTRLSTLCRYPDSMLATMFSGRHTIDQ--DASGNYFLDNNGIYFSYLLDYLRNETLP-PKEMAVF--VYKEAGYYGISNLQEAL 110          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000025160.1 (SMESG000025160.1)

HSP 1 Score: 71.633 bits (174), Expect = 3.559e-14
Identity = 42/117 (35.90%), Postives = 65/117 (55.56%), Query Frame = 1
Query:   82 NHYDRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMF----------IGSIPPSQSI-----DSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEADYYGL 387
            N Y  N++ N+  K+  +NVGG  ++T LSTL + PNS +A+MF               P++S+     DS+ + F+DRDG LF ++L +LR+  L LPD F     L+ E  +Y +
Sbjct:   15 NEYSNNNV-NVDEKIVQLNVGGQDYSTLLSTLIKQPNSWLAKMFYPLQNSFDLSFSVSLPNKSLVDLPKDSDNHYFIDRDGYLFQFILEYLRTDRLFLPDNFDEITRLKNEFQFYKI 130          
The following BLAST results are available for this feature:
BLAST of BTB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCTD215.867e-2548.94potassium channel tetramerization domain containin... [more]
KCTD215.911e-2548.94potassium channel tetramerization domain containin... [more]
KCTD211.989e-2448.94potassium channel tetramerization domain containin... [more]
KCTD211.592e-2348.94potassium channel tetramerization domain containin... [more]
KCTD111.272e-2044.23potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VM106R.15.691e-1641.05pep chromosome:WBcel235:II:10827716:10829556:-1 ge... [more]
D2045.87.178e-1538.71pep chromosome:WBcel235:III:10482288:10483926:1 ge... [more]
B0281.68.715e-1131.30pep chromosome:WBcel235:II:2301308:2302229:-1 gene... [more]
C17F4.84.165e-1037.76pep chromosome:WBcel235:II:3230817:3234813:-1 gene... [more]
ZC239.44.330e-1035.51pep chromosome:WBcel235:II:3214452:3215565:1 gene:... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ktl5.680e-1943.00gene:FBgn0038839 transcript:FBtr0347575[more]
Ktl5.680e-1943.00gene:FBgn0038839 transcript:FBtr0083986[more]
twz4.614e-1538.10gene:FBgn0034636 transcript:FBtr0071692[more]
twz5.259e-1538.10gene:FBgn0034636 transcript:FBtr0308642[more]
CG104651.260e-1137.76gene:FBgn0033017 transcript:FBtr0086094[more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR352234.11.985e-2450.54pep chromosome:GRCz11:CHR_ALT_CTG23_1_16:19672488:... [more]
kctd6a2.343e-2447.57potassium channel tetramerization domain containin... [more]
kctd6b2.544e-2450.54potassium channel tetramerization domain containin... [more]
kctd6b2.679e-2450.54potassium channel tetramerization domain containin... [more]
kctd48.411e-2136.43potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spdl12.050e-2647.41spindle apparatus coiled-coil protein 1 [Source:Xe... [more]
spdl12.969e-2647.41spindle apparatus coiled-coil protein 1 [Source:Xe... [more]
spdl13.990e-2551.46spindle apparatus coiled-coil protein 1 [Source:Xe... [more]
clip13.888e-1841.51CAP-Gly domain containing linker protein 1 [Source... [more]
clip13.969e-1841.51CAP-Gly domain containing linker protein 1 [Source... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kctd219.965e-2448.94potassium channel tetramerisation domain containin... [more]
Kctd65.796e-2048.11potassium channel tetramerisation domain containin... [more]
Kctd65.796e-2048.11potassium channel tetramerisation domain containin... [more]
Kctd112.455e-1942.31potassium channel tetramerisation domain containin... [more]
Kctd156.414e-1941.96potassium channel tetramerisation domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DG99|KCTD6_DANRE2.022e-2350.54BTB/POZ domain-containing protein KCTD6 OS=Danio r... [more]
sp|Q4G0X4|KCD21_HUMAN7.643e-2348.94BTB/POZ domain-containing protein KCTD21 OS=Homo s... [more]
sp|Q3URF8|KCD21_MOUSE7.801e-2348.94BTB/POZ domain-containing protein KCTD21 OS=Mus mu... [more]
sp|Q8BNL5|KCTD6_MOUSE4.054e-1948.11BTB/POZ domain-containing protein KCTD6 OS=Mus mus... [more]
sp|Q8NC69|KCTD6_HUMAN4.396e-1948.11BTB/POZ domain-containing protein KCTD6 OS=Homo sa... [more]
back to top
BLAST of BTB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F2N01.791e-5238.52BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A210QZJ66.268e-2632.23BTB/POZ domain-containing protein KCTD21 OS=Mizuho... [more]
A0A2G8KXD41.052e-2438.69Putative BTB/POZ domain-containing protein KCTD6-l... [more]
R7U6101.340e-2437.57BTB domain-containing protein OS=Capitella teleta ... [more]
V4AKW45.253e-2454.84BTB domain-containing protein (Fragment) OS=Lottia... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kctd6a1.754e-2452.69potassium channel tetramerization domain containin... [more]
kctd6a1.754e-2452.69potassium channel tetramerization domain containin... [more]
kctd6b6.229e-2449.46BTB/POZ domain-containing protein KCTD6 [Source:NC... [more]
KCTD122.582e-1945.65potassium channel tetramerization domain containin... [more]
kctd88.945e-1840.74potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kctd6a1.223e-2345.45potassium channel tetramerization domain containin... [more]
KCTD181.225e-1643.18potassium channel tetramerization domain containin... [more]
KCTD184.029e-1643.18potassium channel tetramerization domain containin... [more]
kctd12b2.715e-1536.61potassium channel tetramerisation domain containin... [more]
kctd73.004e-1034.13potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345941.071e-2345.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437312.229e-2145.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321945.117e-2051.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289875.117e-2051.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346991.035e-1741.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kctd6b2.351e-2451.61potassium channel tetramerization domain containin... [more]
ENSORLT00000003771.25.019e-1840.74uncharacterized LOC101156882 [Source:NCBI gene;Acc... [more]
ENSORLT00000028746.15.914e-1840.74uncharacterized LOC101156882 [Source:NCBI gene;Acc... [more]
KCTD13.910e-1740.57potassium channel tetramerization domain containin... [more]
KCTD13.910e-1740.57potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017037.10.000e+099.59SMESG000017037.1[more]
SMESG000042930.11.064e-1747.37SMESG000042930.1[more]
SMESG000042930.11.206e-1747.37SMESG000042930.1[more]
SMESG000027727.13.165e-1747.37SMESG000027727.1[more]
SMESG000025160.13.559e-1435.90SMESG000025160.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026908 ID=SMED30026908|Name=BTB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=932bp
ATAGAAATTAAATTAAGGTTTTTATAGTAAAGATTTACTTATGATATAAA
TAGAATATCGTGTATTTATAAAGAAATGAATAATCATTACGACAGAAACG
ACCTAAAGAATATTACCAACAAAGTTTATACTATTAACGTTGGAGGAATT
ATACATACAACAACCTTATCAACTTTATGCAGATATCCTAATTCTATGAT
TGCTAGAATGTTTATTGGTTCGATTCCACCATCACAATCAATTGATTCTA
ACGGAAATATATTTCTGGACAGGGATGGTGTATTGTTTGGCTATGTGTTA
AACTTTTTACGCAGCGGAGTTTTAACTTTACCAGATGGTTTCCATTCCTT
TAACAGTTTACAAATCGAAGCAGATTATTACGGGTTAGATGAATTATTAG
AAGCTCTCAAAATATACAGAACTGATCAAACTACTTTAAATAACTCAACT
AACTCTAAATTCGTTGGTTATTTTATAGAAATTATGGAATTTGAAGAAGC
TTCCAGTTTCAATCGGTTTTATACTCACGGTGATTTACACCATAACAGTC
ACTGGAGAGTTACACCGAAAAACGGCGGATTAATTGTGTCTGGACATCAG
GATGTACTCAAAAGTTTGCCCATTTCGTATTCTCCTGAAAGTGTATCTCC
TGATTACCCGAGTGTAATCGTTCACAGTAGACACAAAATGGAAATATTTC
ATTATTTATCGTCTAAAAGCTGGCAGCTCACTCATACTGGACTTTCATAT
GGAACTGATTCCGATGGATCTTACATTATTCACGAATATGTATGGCAGAA
ACCAGTTTTAAACTAATTGATGCTACTAGCAATTATTGATACGCAATGTA
GTTTTTCCTCTAGATTTGATAGAGAACATATTTTAAAATTGTATTTTTGT
ACATATTTTGAATAAAAATCAAAGCAAATTTT
back to top

protein sequence of SMED30026908-orf-1

>SMED30026908-orf-1 ID=SMED30026908-orf-1|Name=SMED30026908-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MNNHYDRNDLKNITNKVYTINVGGIIHTTTLSTLCRYPNSMIARMFIGSI
PPSQSIDSNGNIFLDRDGVLFGYVLNFLRSGVLTLPDGFHSFNSLQIEAD
YYGLDELLEALKIYRTDQTTLNNSTNSKFVGYFIEIMEFEEASSFNRFYT
HGDLHHNSHWRVTPKNGGLIVSGHQDVLKSLPISYSPESVSPDYPSVIVH
SRHKMEIFHYLSSKSWQLTHTGLSYGTDSDGSYIIHEYVWQKPVLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR003131T1-type_BTB
IPR011333SKP1/BTB/POZ_sf
Vocabulary: biological process
TermDefinition
GO:0051260protein homooligomerization
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: molecular function
TermDefinition
GO:0030506ankyrin binding
GO:0042802identical protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 19..108
e-value: 1.6E-16
score: 60.4
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 7..118
e-value: 3.0E-31
score: 109.7
NoneNo IPR availablePANTHERPTHR14499POTASSIUM CHANNEL TETRAMERIZATION DOMAIN-CONTAININGcoord: 16..144
NoneNo IPR availableCDDcd18365BTB_POZ_KCTD6_likecoord: 19..111
e-value: 5.11167E-37
score: 123.66
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 17..116