SMED30026903

Overview
NameSMED30026903
Smed IDSMED30026903
Length (bp)781
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026903

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30026903SMESG000004650.1 Contig6619_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30026903 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.024784:2590..3351 -2849
v31.028223:4183..5086 +2628
Homology
BLAST of SMED30026903 vs. Ensembl Human
Match: ENY2 (ENY2 transcription and export complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:24449])

HSP 1 Score: 103.219 bits (256), Expect = 1.628e-27
Identity = 45/92 (48.91%), Postives = 74/92 (80.43%), Query Frame = -3
Query:  468 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CK+ I+ KG+++VTVD++VA +TP  R++VP+ VK+++L+R+R FL ++
Sbjct:    2 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 93          
BLAST of SMED30026903 vs. Ensembl Human
Match: ENY2 (ENY2 transcription and export complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:24449])

HSP 1 Score: 103.219 bits (256), Expect = 1.652e-27
Identity = 45/92 (48.91%), Postives = 74/92 (80.43%), Query Frame = -3
Query:  468 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CK+ I+ KG+++VTVD++VA +TP  R++VP+ VK+++L+R+R FL ++
Sbjct:    7 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 98          
BLAST of SMED30026903 vs. Ensembl Human
Match: ENY2 (ENY2 transcription and export complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:24449])

HSP 1 Score: 81.6481 bits (200), Expect = 3.125e-19
Identity = 38/78 (48.72%), Postives = 59/78 (75.64%), Query Frame = -3
Query:  522 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIAR----SMVP 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CK+ I+ KG+++VTVD++VA +TP  R    +M+P
Sbjct:    2 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRETGFAMLP 79          
BLAST of SMED30026903 vs. Ensembl Human
Match: ENY2 (ENY2 transcription and export complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:24449])

HSP 1 Score: 55.8398 bits (133), Expect = 4.022e-10
Identity = 25/46 (54.35%), Postives = 36/46 (78.26%), Query Frame = -3
Query:  606 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKD 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CKD
Sbjct:    7 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKD 52          
BLAST of SMED30026903 vs. Ensembl Human
Match: ENY2 (ENY2 transcription and export complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:24449])

HSP 1 Score: 55.4546 bits (132), Expect = 4.805e-10
Identity = 25/46 (54.35%), Postives = 36/46 (78.26%), Query Frame = -3
Query:  606 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKD 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CKD
Sbjct:    2 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKD 47          
BLAST of SMED30026903 vs. Ensembl Fly
Match: e(y)2 (gene:FBgn0000618 transcript:FBtr0073540)

HSP 1 Score: 73.559 bits (179), Expect = 1.373e-16
Identity = 31/74 (41.89%), Postives = 55/74 (74.32%), Query Frame = -3
Query:  477 TGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDN-VTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFL 695
            TG+R K+K+ +  RL E GW+D+V++ C++ +  KG +N  TV++++A VTP AR++VP+ VK+++L ++R  L
Sbjct:   14 TGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGTNNSFTVEQLIAEVTPKARTLVPDAVKKELLMKIRTIL 87          
BLAST of SMED30026903 vs. Ensembl Fly
Match: e(y)2b (gene:FBgn0040670 transcript:FBtr0081562)

HSP 1 Score: 56.6102 bits (135), Expect = 2.173e-10
Identity = 26/71 (36.62%), Postives = 43/71 (60.56%), Query Frame = -3
Query:  477 EREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFL 689
            ++  LKE +  RL E GW   +K   ++ I  +GVDN+  D++ A + P AR++VPE VK +++ R+   L
Sbjct:   23 DKAALKELLHTRLVECGWHKDIKEMIRNIIMERGVDNINRDQLAAQIVPQARALVPEVVKNEMMLRVHAAL 93          
BLAST of SMED30026903 vs. Ensembl Fly
Match: e(y)2b (gene:FBgn0040670 transcript:FBtr0344948)

HSP 1 Score: 56.6102 bits (135), Expect = 2.173e-10
Identity = 26/71 (36.62%), Postives = 43/71 (60.56%), Query Frame = -3
Query:  477 EREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFL 689
            ++  LKE +  RL E GW   +K   ++ I  +GVDN+  D++ A + P AR++VPE VK +++ R+   L
Sbjct:   23 DKAALKELLHTRLVECGWHKDIKEMIRNIIMERGVDNINRDQLAAQIVPQARALVPEVVKNEMMLRVHAAL 93          
BLAST of SMED30026903 vs. Ensembl Zebrafish
Match: eny2 (ENY2 transcription and export complex 2 subunit [Source:NCBI gene;Acc:436700])

HSP 1 Score: 101.293 bits (251), Expect = 4.395e-27
Identity = 43/93 (46.24%), Postives = 72/93 (77.42%), Query Frame = -3
Query:  465 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEND 743
             K +++RA I++KL   GERE+LKE ++ +L E GW+D++K  CK+ I+ KG++NVTV+++VA VTP  R++VP+ VK+++L+R+R FL ++ 
Sbjct:    2 SKESQMRAAINQKLIEMGERERLKELLRAKLIECGWRDQLKALCKEVIKEKGIENVTVEDLVAGVTPKGRALVPDSVKKELLQRIRAFLAQHS 94          
BLAST of SMED30026903 vs. Ensembl Zebrafish
Match: eny2 (ENY2 transcription and export complex 2 subunit [Source:NCBI gene;Acc:436700])

HSP 1 Score: 101.293 bits (251), Expect = 4.395e-27
Identity = 43/93 (46.24%), Postives = 72/93 (77.42%), Query Frame = -3
Query:  465 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEND 743
             K +++RA I++KL   GERE+LKE ++ +L E GW+D++K  CK+ I+ KG++NVTV+++VA VTP  R++VP+ VK+++L+R+R FL ++ 
Sbjct:    2 SKESQMRAAINQKLIEMGERERLKELLRAKLIECGWRDQLKALCKEVIKEKGIENVTVEDLVAGVTPKGRALVPDSVKKELLQRIRAFLAQHS 94          
BLAST of SMED30026903 vs. Ensembl Xenopus
Match: eny2 (enhancer of yellow 2 homolog [Source:NCBI gene;Acc:100170422])

HSP 1 Score: 102.834 bits (255), Expect = 1.927e-27
Identity = 45/92 (48.91%), Postives = 73/92 (79.35%), Query Frame = -3
Query:  468 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 743
            +K A+++A I++KL  TGERE+LKE ++ +L E GW+D++K  CKD I  KGV++VTVD++VA +TP  R++VP+ VK+++L+R+R FL ++
Sbjct:    2 NKDAQMKAAINQKLIETGERERLKELLRAKLIECGWRDQLKAHCKDVINEKGVEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRAFLAQH 93          
BLAST of SMED30026903 vs. Ensembl Mouse
Match: Eny2 (ENY2 transcription and export complex 2 subunit [Source:MGI Symbol;Acc:MGI:1919286])

HSP 1 Score: 103.219 bits (256), Expect = 1.118e-27
Identity = 45/92 (48.91%), Postives = 74/92 (80.43%), Query Frame = -3
Query:  468 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CK+ I+ KG+++VTVD++VA +TP  R++VP+ VK+++L+R+R FL ++
Sbjct:    2 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 93          
BLAST of SMED30026903 vs. Ensembl Mouse
Match: Eny2 (ENY2 transcription and export complex 2 subunit [Source:MGI Symbol;Acc:MGI:1919286])

HSP 1 Score: 103.219 bits (256), Expect = 1.134e-27
Identity = 45/92 (48.91%), Postives = 74/92 (80.43%), Query Frame = -3
Query:  468 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CK+ I+ KG+++VTVD++VA +TP  R++VP+ VK+++L+R+R FL ++
Sbjct:    7 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 98          
BLAST of SMED30026903 vs. Ensembl Mouse
Match: Eny2 (ENY2 transcription and export complex 2 subunit [Source:MGI Symbol;Acc:MGI:1919286])

HSP 1 Score: 55.8398 bits (133), Expect = 2.761e-10
Identity = 25/46 (54.35%), Postives = 36/46 (78.26%), Query Frame = -3
Query:  606 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKD 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CKD
Sbjct:    7 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKD 52          
BLAST of SMED30026903 vs. Ensembl Mouse
Match: Eny2 (ENY2 transcription and export complex 2 subunit [Source:MGI Symbol;Acc:MGI:1919286])

HSP 1 Score: 53.5286 bits (127), Expect = 1.510e-9
Identity = 24/45 (53.33%), Postives = 35/45 (77.78%), Query Frame = -3
Query:  609 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACK 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CK
Sbjct:    7 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCK 51          
BLAST of SMED30026903 vs. UniProt/SwissProt
Match: sp|B5FZ63|ENY2_TAEGU (Transcription and mRNA export factor ENY2 OS=Taeniopygia guttata OX=59729 GN=ENY2 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.283e-27
Identity = 46/92 (50.00%), Postives = 74/92 (80.43%), Query Frame = -3
Query:  468 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CKD I+ KG+++VTVD++VA +TP  R++VP+ VK+++L+R+R FL ++
Sbjct:    2 NKDAQMRATINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKDVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 93          
BLAST of SMED30026903 vs. UniProt/SwissProt
Match: sp|Q9JIX0|ENY2_MOUSE (Transcription and mRNA export factor ENY2 OS=Mus musculus OX=10090 GN=Eny2 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 7.933e-27
Identity = 45/92 (48.91%), Postives = 74/92 (80.43%), Query Frame = -3
Query:  468 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CK+ I+ KG+++VTVD++VA +TP  R++VP+ VK+++L+R+R FL ++
Sbjct:    7 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 98          
BLAST of SMED30026903 vs. UniProt/SwissProt
Match: sp|Q9NPA8|ENY2_HUMAN (Transcription and mRNA export factor ENY2 OS=Homo sapiens OX=9606 GN=ENY2 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 7.933e-27
Identity = 45/92 (48.91%), Postives = 74/92 (80.43%), Query Frame = -3
Query:  468 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CK+ I+ KG+++VTVD++VA +TP  R++VP+ VK+++L+R+R FL ++
Sbjct:    7 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 98          
BLAST of SMED30026903 vs. UniProt/SwissProt
Match: sp|Q3ZBJ0|ENY2_BOVIN (Transcription and mRNA export factor ENY2 OS=Bos taurus OX=9913 GN=ENY2 PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 7.933e-27
Identity = 45/92 (48.91%), Postives = 74/92 (80.43%), Query Frame = -3
Query:  468 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 743
            +K A++RA I++KL  TGERE+LKE ++ +L E GWKD++K  CK+ I+ KG+++VTVD++VA +TP  R++VP+ VK+++L+R+R FL ++
Sbjct:    7 NKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQH 98          
BLAST of SMED30026903 vs. UniProt/SwissProt
Match: sp|B2RYZ5|ENY2_XENTR (Transcription and mRNA export factor ENY2 OS=Xenopus tropicalis OX=8364 GN=eny2 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.021e-26
Identity = 45/92 (48.91%), Postives = 73/92 (79.35%), Query Frame = -3
Query:  468 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 743
            +K A+++A I++KL  TGERE+LKE ++ +L E GW+D++K  CKD I  KGV++VTVD++VA +TP  R++VP+ VK+++L+R+R FL ++
Sbjct:    2 NKDAQMKAAINQKLIETGERERLKELLRAKLIECGWRDQLKAHCKDVINEKGVEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRAFLAQH 93          
BLAST of SMED30026903 vs. TrEMBL
Match: A0A504YHC8 (Transcription and mRNA export factor ENY2 OS=Fasciola gigantica OX=46835 GN=FGIG_07811 PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 6.390e-36
Identity = 61/98 (62.24%), Postives = 82/98 (83.67%), Query Frame = -3
Query:  456 MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMENDFDI 749
            M +KRAEI++KI E L  TGERE+L+EF++ RL E+GW DKVK ACK+YIR KGVDN+TV+EVV A+TP AR  VP EV++DVLE++R+FL+++D D+
Sbjct:    1 MTEKRAEIKSKIAELLVKTGERERLREFVESRLVETGWNDKVKQACKEYIRTKGVDNITVEEVVQAITPSARQTVPVEVRQDVLEQLRKFLVQHDIDV 98          
BLAST of SMED30026903 vs. TrEMBL
Match: A0A2H1C2B4 (Transcription and mRNA export factor ENY2 OS=Fasciola hepatica OX=6192 GN=D915_007474 PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 6.390e-36
Identity = 61/98 (62.24%), Postives = 82/98 (83.67%), Query Frame = -3
Query:  456 MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMENDFDI 749
            M +KRAEI++KI E L  TGERE+L+EF++ RL E+GW DKVK ACK+YIR KGVDN+TV+EVV A+TP AR  VP EV++DVLE++R+FL+++D D+
Sbjct:    1 MTEKRAEIKSKIAELLVKTGERERLREFVESRLVETGWNDKVKQACKEYIRTKGVDNITVEEVVQAITPSARQTVPVEVRQDVLEQLRKFLVQHDIDV 98          
BLAST of SMED30026903 vs. TrEMBL
Match: A0A183AS00 (Transcription and mRNA export factor ENY2 OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS9735 PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 7.847e-36
Identity = 61/98 (62.24%), Postives = 82/98 (83.67%), Query Frame = -3
Query:  456 MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMENDFDI 749
            M +KRAEI++KI E L  TGERE+L+EF++ RL E+GW DKVK ACK+YIR KGVDN+TV+EVV A+TP AR  VP EV++DVLE++R+FL+++D D+
Sbjct:    1 MTEKRAEIKSKIAELLVKTGERERLREFVENRLVETGWNDKVKQACKEYIRTKGVDNITVEEVVQAITPSARQTVPVEVRQDVLEQLRKFLVQHDIDV 98          
BLAST of SMED30026903 vs. TrEMBL
Match: A0A4S2LGC6 (Transcription and mRNA export factor ENY2 OS=Opisthorchis felineus OX=147828 GN=CRM22_007434 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 4.617e-35
Identity = 60/98 (61.22%), Postives = 81/98 (82.65%), Query Frame = -3
Query:  456 MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMENDFDI 749
            M +KR EI+ KI + L  TGERE+L+EF++ RL E+GW DKVK ACK+YIR+KGVDN+TV+EVV A+TP AR +VP EV++DVLE +R+FL++ND D+
Sbjct:    1 MSEKRNEIKNKISDLLMKTGERERLREFVENRLIETGWNDKVKQACKEYIRSKGVDNITVEEVVQAITPSARQIVPVEVRQDVLEHLRKFLVQNDIDV 98          
BLAST of SMED30026903 vs. TrEMBL
Match: A0A5J4N6K1 (Transcription and mRNA export factor ENY2 OS=Paragonimus westermani OX=34504 GN=DEA37_0001947 PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.148e-34
Identity = 64/117 (54.70%), Postives = 90/117 (76.92%), Query Frame = -3
Query:  399 MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMENDFDI*HQNFQHIKYFYFTYSANF 749
            M +KRAEI++KI + L  TGERE+L+EF++ RL E+GW DKVK ACK+YIR KGVDN+TV+EVV A+TP+AR +VP EV++DVLE++R+FL+++D D+  Q   H     F Y+  +
Sbjct:    1 MTEKRAEIKSKIADLLVKTGERERLREFVENRLTETGWNDKVKQACKEYIRTKGVDNITVEEVVQAITPLARQIVPVEVRQDVLEQLRKFLVQHDIDV--QLNDHKASTPFRYNGEW 115          
BLAST of SMED30026903 vs. Ensembl Cavefish
Match: eny2 (ENY2 transcription and export complex 2 subunit [Source:NCBI gene;Acc:103039940])

HSP 1 Score: 99.7525 bits (247), Expect = 1.445e-26
Identity = 43/93 (46.24%), Postives = 71/93 (76.34%), Query Frame = -3
Query:  465 DKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEND 743
             K  ++RA I++KL   GERE+LKE ++ +L E GW+D++K  CK+ I+ KG++NVTV+++VA VTP  R++VP+ VK+++L+R+R FL ++ 
Sbjct:    2 SKELQMRAAINQKLIEMGERERLKELLRAKLIECGWRDQLKAHCKEVIKEKGIENVTVEDLVAGVTPKGRALVPDSVKKELLQRIRAFLAQHS 94          
BLAST of SMED30026903 vs. Ensembl Cavefish
Match: eny2 (ENY2 transcription and export complex 2 subunit [Source:NCBI gene;Acc:103039940])

HSP 1 Score: 82.0333 bits (201), Expect = 1.848e-19
Identity = 35/84 (41.67%), Postives = 61/84 (72.62%), Query Frame = -3
Query:  465 IHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEND 716
            ++E L +      LKE ++ +L E GW+D++K  CK+ I+ KG++NVTV+++VA VTP  R++VP+ VK+++L+R+R FL ++ 
Sbjct:   34 VYETLCSFLFSCWLKELLRAKLIECGWRDQLKAHCKEVIKEKGIENVTVEDLVAGVTPKGRALVPDSVKKELLQRIRAFLAQHS 117          
BLAST of SMED30026903 vs. Ensembl Sea Lamprey
Match: eny2 (ENY2 transcription and export complex 2 subunit [Source:NCBI gene;Acc:436700])

HSP 1 Score: 105.916 bits (263), Expect = 2.041e-29
Identity = 45/91 (49.45%), Postives = 74/91 (81.32%), Query Frame = -3
Query:  468 KRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 740
            K A++RA I++KL  TGERE+LKE ++ RL E GWKD+++  CKD IR+KG+++VTV+++++ +TP  R++VP+ VK+++L+R+R FL +N
Sbjct:   11 KDAQMRAAINQKLIETGERERLKELLKTRLMECGWKDQLRAHCKDVIRDKGLEHVTVEDLISEITPKGRALVPDNVKKELLQRIRAFLAQN 101          
BLAST of SMED30026903 vs. Ensembl Yeast
Match: SUS1 (Component of both the SAGA histone acetylase and TREX-2 complexes; interacts with RNA polymerase II; involved in mRNA export coupled transcription activation and elongation; involved in post-transcriptional tethering of active genes to the nuclear periphery and to non-nascent mRNP [Source:SGD;Acc:S000028510])

HSP 1 Score: 47.3654 bits (111), Expect = 7.011e-8
Identity = 27/88 (30.68%), Postives = 49/88 (55.68%), Query Frame = -3
Query:  471 AEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLME 734
            A+++++I + L  +G  E +   ++ RL + GW DKVK   K  +      N T  ++++ V P A  MV +  +  VL+++R+FL E
Sbjct:    6 AQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFT--QILSTVEPKALEMVSDSTRETVLKQIREFLEE 91          
BLAST of SMED30026903 vs. Ensembl Nematostella
Match: EDO41625 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S403])

HSP 1 Score: 100.523 bits (249), Expect = 3.968e-27
Identity = 43/88 (48.86%), Postives = 70/88 (79.55%), Query Frame = -3
Query:  471 AEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLME 734
             +++A I++ L  +GERE+LKE ++ +L E GW+D++K  CK+ I+ KG+DNVTV+++V  +TP  R++VP+EVKR++L+R+RQFL E
Sbjct:   11 PQMKASINQALVESGERERLKELLRTKLIECGWRDQLKDYCKEIIKQKGLDNVTVEDLVKTITPKGRALVPDEVKRELLQRIRQFLAE 98          
BLAST of SMED30026903 vs. Ensembl Medaka
Match: ENY2 (transcription and mRNA export factor ENY2 [Source:NCBI gene;Acc:101173720])

HSP 1 Score: 98.2117 bits (243), Expect = 5.482e-26
Identity = 42/88 (47.73%), Postives = 70/88 (79.55%), Query Frame = -3
Query:  468 EIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMEN 731
            +++A I++KL   GERE+LKE ++ +L ESGWKD++K  CKD +R KG+++VTV+++V  VTP  R++VP+ VK+++L+R+R FL ++
Sbjct:    6 QLKASINQKLIEMGERERLKELLRAKLVESGWKDQLKAHCKDVVREKGLEHVTVEDLVTEVTPKGRALVPDNVKKELLQRIRAFLAQH 93          
BLAST of SMED30026903 vs. Ensembl Medaka
Match: ENY2 (transcription and mRNA export factor ENY2 [Source:NCBI gene;Acc:101173720])

HSP 1 Score: 75.485 bits (184), Expect = 4.337e-17
Identity = 33/67 (49.25%), Postives = 51/67 (76.12%), Query Frame = -3
Query:  531 EIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARS 731
            +++A I++KL   GERE+LKE ++ +L ESGWKD++K  CKD +R KG+++VTV+++V  VTP  R 
Sbjct:    6 QLKASINQKLIEMGERERLKELLRAKLVESGWKDQLKAHCKDVVREKGLEHVTVEDLVTEVTPKGRG 72          
BLAST of SMED30026903 vs. Ensembl Medaka
Match: ENY2 (transcription and mRNA export factor ENY2 [Source:NCBI gene;Acc:101173720])

HSP 1 Score: 75.485 bits (184), Expect = 4.337e-17
Identity = 33/67 (49.25%), Postives = 51/67 (76.12%), Query Frame = -3
Query:  531 EIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARS 731
            +++A I++KL   GERE+LKE ++ +L ESGWKD++K  CKD +R KG+++VTV+++V  VTP  R 
Sbjct:    6 QLKASINQKLIEMGERERLKELLRAKLVESGWKDQLKAHCKDVVREKGLEHVTVEDLVTEVTPKGRG 72          
BLAST of SMED30026903 vs. Planmine SMEST
Match: SMESG000004650.1 (SMESG000004650.1)

HSP 1 Score: 197.593 bits (501), Expect = 6.561e-65
Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = -3
Query:  456 MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMENDFDI 749
            MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMENDFDI
Sbjct:    1 MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMENDFDI 98          
BLAST of SMED30026903 vs. Planmine SMEST
Match: SMESG000018930.1 (SMESG000018930.1)

HSP 1 Score: 76.6406 bits (187), Expect = 9.908e-18
Identity = 36/90 (40.00%), Postives = 60/90 (66.67%), Query Frame = -3
Query:  480 MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQF 749
            M   R ++ A+   KL+ +GE+E ++ FI+ + +E GW DKV  AC  YI+ KGV++ TV E VAA+TP +R ++P+++K  V E +++ 
Sbjct:    1 MGKTREDVAAEYDRKLSESGEQENIRNFIRDKFKEIGWYDKVHEACVKYIKAKGVEDCTVSETVAALTPKSRILIPDDLKLAVYEWLKRI 90          
BLAST of SMED30026903 vs. Planmine SMEST
Match: SMESG000004604.1 (SMESG000004604.1)

HSP 1 Score: 60.8474 bits (146), Expect = 7.054e-12
Identity = 32/103 (31.07%), Postives = 60/103 (58.25%), Query Frame = -3
Query:  462 MEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKDKVKVACKDYIRNKGVDN-------VTVDEVVAAVTPIARSMVPEEVKRDVLERMRQFLMENDF 749
            M +  +E+  KI+  + + G+R+KLK+FI +RL + GW D VK  C  +I N  V+N       + ++++V  V  +   ++P+++K++VL +M   L + D 
Sbjct:    1 MNEPPSELVEKINVLIDSLGQRQKLKQFISRRLTDVGWCDVVKSQCSKFIDN-TVENLKIPPQSIPLEDIVQNVMKMCIELIPKDLKKEVLLKMLSMLADQDM 102          
The following BLAST results are available for this feature:
BLAST of SMED30026903 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENY21.628e-2748.91ENY2 transcription and export complex 2 subunit [S... [more]
ENY21.652e-2748.91ENY2 transcription and export complex 2 subunit [S... [more]
ENY23.125e-1948.72ENY2 transcription and export complex 2 subunit [S... [more]
ENY24.022e-1054.35ENY2 transcription and export complex 2 subunit [S... [more]
ENY24.805e-1054.35ENY2 transcription and export complex 2 subunit [S... [more]
back to top
BLAST of SMED30026903 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026903 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
e(y)21.373e-1641.89gene:FBgn0000618 transcript:FBtr0073540[more]
e(y)2b2.173e-1036.62gene:FBgn0040670 transcript:FBtr0081562[more]
e(y)2b2.173e-1036.62gene:FBgn0040670 transcript:FBtr0344948[more]
back to top
BLAST of SMED30026903 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eny24.395e-2746.24ENY2 transcription and export complex 2 subunit [S... [more]
eny24.395e-2746.24ENY2 transcription and export complex 2 subunit [S... [more]
back to top
BLAST of SMED30026903 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eny21.927e-2748.91enhancer of yellow 2 homolog [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30026903 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Eny21.118e-2748.91ENY2 transcription and export complex 2 subunit [S... [more]
Eny21.134e-2748.91ENY2 transcription and export complex 2 subunit [S... [more]
Eny22.761e-1054.35ENY2 transcription and export complex 2 subunit [S... [more]
Eny21.510e-953.33ENY2 transcription and export complex 2 subunit [S... [more]
back to top
BLAST of SMED30026903 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B5FZ63|ENY2_TAEGU1.283e-2750.00Transcription and mRNA export factor ENY2 OS=Taeni... [more]
sp|Q9JIX0|ENY2_MOUSE7.933e-2748.91Transcription and mRNA export factor ENY2 OS=Mus m... [more]
sp|Q9NPA8|ENY2_HUMAN7.933e-2748.91Transcription and mRNA export factor ENY2 OS=Homo ... [more]
sp|Q3ZBJ0|ENY2_BOVIN7.933e-2748.91Transcription and mRNA export factor ENY2 OS=Bos t... [more]
sp|B2RYZ5|ENY2_XENTR1.021e-2648.91Transcription and mRNA export factor ENY2 OS=Xenop... [more]
back to top
BLAST of SMED30026903 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YHC86.390e-3662.24Transcription and mRNA export factor ENY2 OS=Fasci... [more]
A0A2H1C2B46.390e-3662.24Transcription and mRNA export factor ENY2 OS=Fasci... [more]
A0A183AS007.847e-3662.24Transcription and mRNA export factor ENY2 OS=Echin... [more]
A0A4S2LGC64.617e-3561.22Transcription and mRNA export factor ENY2 OS=Opist... [more]
A0A5J4N6K11.148e-3454.70Transcription and mRNA export factor ENY2 OS=Parag... [more]
back to top
BLAST of SMED30026903 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eny21.445e-2646.24ENY2 transcription and export complex 2 subunit [S... [more]
eny21.848e-1941.67ENY2 transcription and export complex 2 subunit [S... [more]
back to top
BLAST of SMED30026903 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eny22.041e-2949.45ENY2 transcription and export complex 2 subunit [S... [more]
back to top
BLAST of SMED30026903 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SUS17.011e-830.68Component of both the SAGA histone acetylase and T... [more]
back to top
BLAST of SMED30026903 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO416253.968e-2748.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30026903 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENY25.482e-2647.73transcription and mRNA export factor ENY2 [Source:... [more]
ENY24.337e-1749.25transcription and mRNA export factor ENY2 [Source:... [more]
ENY24.337e-1749.25transcription and mRNA export factor ENY2 [Source:... [more]
back to top
BLAST of SMED30026903 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000004650.16.561e-65100.00SMESG000004650.1[more]
SMESG000018930.19.908e-1840.00SMESG000018930.1[more]
SMESG000004604.17.054e-1231.07SMESG000004604.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026903 ID=SMED30026903|Name=SMED30026903|organism=Schmidtea mediterranea sexual|type=transcript|length=781bp
TTAGCTAATCCTCTTAAAATCATATTGGTACTCAAAGGGTTAATCATTGG
TTATGCAATTAAAAAGCCCGCCAATTAATGAAATAACCGAATAAAAATAC
GATAAGAATACAGCAAGGAATTTATTAGTTCATTAACATAATTATCTTTG
AATACTTATTCGAATGATGATTTTTCTCGAGTTTTCCTTTATTTATTAGA
AATTTTCCATCATTTTCGGTTATTTATTTAAAATAAATTTAAATGATTAA
TTTCAACAAACCCTCAAGTGAGTCATTTTTAATTTCTATCGGAAAAAATA
TTTTCACTAATTTTACCGAATATTTAATGGAGGTGTTTCGCAAAGGAGAA
AAAAAATGATAAATTCATTTACTACAATATGGTTTTTATATATTAAATAA
AGTTAGCTGAATACGTAAAATAAAAGTATTTGATATGCTGAAAATTCTGG
TGTTAAATGTCAAAATCATTTTCCATCAAAAATTGTCTCATTCGTTCTAA
AACGTCACGCTTCACCTCTTCTGGCACCATAGAACGGGCGATTGGAGTTA
CCGCTGCAACGACTTCATCGACAGTAACATTGTCAACGCCTTTATTGCGA
ATATAATCTTTACAAGCTACTTTGACTTTATCTTTCCAGCCAGATTCTTC
AAGACGCTTCTGAATAAATTCCTTAAGTTTTTCTCTTTCACCGGTAGCTG
TAAGTTTTTCATGGATTTTCGCTCGAATTTCAGCTCTTTTGTCTTCCATT
GTCAATAGTCTATGATAAAATCTACGACTCG
back to top

protein sequence of SMED30026903-orf-1

>SMED30026903-orf-1 ID=SMED30026903-orf-1|Name=SMED30026903-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
SRRFYHRLLTMEDKRAEIRAKIHEKLTATGEREKLKEFIQKRLEESGWKD
KVKVACKDYIRNKGVDNVTVDEVVAAVTPIARSMVPEEVKRDVLERMRQF
LMENDFDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium