forkhead box J1-like protein 2

Overview
Nameforkhead box J1-like protein 2 (AFX62229.1)
Smed IDSMED30026881
Length (bp)2113
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026881

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
dorsal stripeSMED30026881SMESG000072873.1 JX842844.1smed_ncbi_20200123PMID:23144623
Vij et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30026881SMESG000072874.1 SMESG000072873.1 Contig8724newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30026881SMESG000072874.1 SMESG000072873.1 Contig8724uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of forkhead box J1-like protein 2 vs. Ensembl Human
Match: FOXJ1 (forkhead box J1 [Source:HGNC Symbol;Acc:HGNC:3816])

HSP 1 Score: 110.923 bits (276), Expect = 2.825e-25
Identity = 65/180 (36.11%), Postives = 98/180 (54.44%), Query Frame = 2
Query:  173 IDDSLTNLNWLPNMNL------------------NKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            +DDSLT+L WL   ++                  +++   A P SP++A     G+     +P +S  S  +         DD   + Y T+   +PP+S+ +LICMA+Q    ++IT + I +WI  NF Y++  D +WQNS+R+ LS++KCF KVPR KDEP KGGFWR+   Y + L
Sbjct:   29 LDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDD---VDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERL 205          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 96.2857 bits (238), Expect = 1.091e-20
Identity = 52/158 (32.91%), Postives = 87/158 (55.06%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP + +         I    A+  + G  +  +     DP+       + DQ +       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:   16 MTSELESSLTSMDWLPQLTMRAA------IQKSDATQNAHGTGISKKNALL-DPNT------TLDQEE------VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 95.9005 bits (237), Expect = 6.303e-20
Identity = 51/158 (32.28%), Postives = 88/158 (55.70%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP + +     ++       A+  + G  +  +     DP+       + DQ +       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:   16 MTSELESSLTSMDWLPQLTMRAAIQKS------DATQNAHGTGISKKNALL-DPNT------TLDQEE------VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 95.9005 bits (237), Expect = 7.349e-20
Identity = 51/158 (32.28%), Postives = 88/158 (55.70%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP + +     ++       A+  + G  +  +     DP+       + DQ +       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:   16 MTSELESSLTSMDWLPQLTMRAAIQKS------DATQNAHGTGISKKNALL-DPNT------TLDQEE------VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 95.9005 bits (237), Expect = 7.349e-20
Identity = 51/158 (32.28%), Postives = 88/158 (55.70%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP + +     ++       A+  + G  +  +     DP+       + DQ +       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:   16 MTSELESSLTSMDWLPQLTMRAAIQKS------DATQNAHGTGISKKNALL-DPNT------TLDQEE------VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 86.2705 bits (212), Expect = 1.932e-18
Identity = 38/79 (48.10%), Postives = 55/79 (69.62%), Query Frame = 2
Query:  404 RPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSG 640
            +PPFS+ +LI MAI+D  + R+T   I E+I+ N+P+Y+     WQNS+R+ LS++KCF KVPR  D+P KG +W L  
Sbjct:   93 KPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDA 171          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 85.8853 bits (211), Expect = 1.630e-17
Identity = 42/98 (42.86%), Postives = 60/98 (61.22%), Query Frame = 2
Query:  341 ICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            I  ++ + +  R  + T+   +PP+S+ISLI MAIQ     ++T ++I  WI+  FPYYQ     WQNS+R+ LS + CF KV R  D+P KG FW L
Sbjct:  121 IQEFETVTEKIR-RHGTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTL 217          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 85.8853 bits (211), Expect = 1.908e-17
Identity = 40/84 (47.62%), Postives = 54/84 (64.29%), Query Frame = 2
Query:  383 YKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            + T+   +PP+S+ISLI MAIQ     ++T ++I  WI+  FPYYQ     WQNS+R+ LS + CF KV R  D+P KG FW L
Sbjct:  165 HGTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTL 248          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 85.5001 bits (210), Expect = 3.090e-17
Identity = 40/84 (47.62%), Postives = 54/84 (64.29%), Query Frame = 2
Query:  383 YKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            + T+   +PP+S+ISLI MAIQ     ++T ++I  WI+  FPYYQ     WQNS+R+ LS + CF KV R  D+P KG FW L
Sbjct:  229 HGTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTL 312          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 77.411 bits (189), Expect = 4.851e-15
Identity = 34/84 (40.48%), Postives = 56/84 (66.67%), Query Frame = 2
Query:  383 YKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            ++  +  +PP+S+I+LI M+I +  + ++T ++ICE+II  F YY+    +WQNS+R+ LS++ CF KV R    P KG +W L
Sbjct:  120 HRKSSHAKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWAL 203          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Fly
Match: slp1 (gene:FBgn0003430 transcript:FBtr0077499)

HSP 1 Score: 85.5001 bits (210), Expect = 1.055e-17
Identity = 37/79 (46.84%), Postives = 55/79 (69.62%), Query Frame = 2
Query:  398 TGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            T +PP+S+ +LI MAIQD  + R+T   I +++I  FPY++     WQNS+R+ LS++KCF K+PR  D+P KG +W L
Sbjct:  118 TKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWIL 196          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0346765)

HSP 1 Score: 85.1149 bits (209), Expect = 5.262e-17
Identity = 39/93 (41.94%), Postives = 60/93 (64.52%), Query Frame = 2
Query:  365 DSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGD 643
            D    + +++T  +PP+S+ISLI MAIQ+     +T ++I ++I+  FP+Y+     WQNS+R+ LS + CF K+PR  D+P KG FW L  D
Sbjct:  197 DKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPD 289          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0300259)

HSP 1 Score: 85.1149 bits (209), Expect = 5.427e-17
Identity = 39/93 (41.94%), Postives = 60/93 (64.52%), Query Frame = 2
Query:  365 DSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGD 643
            D    + +++T  +PP+S+ISLI MAIQ+     +T ++I ++I+  FP+Y+     WQNS+R+ LS + CF K+PR  D+P KG FW L  D
Sbjct:  197 DKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPD 289          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0345227)

HSP 1 Score: 85.1149 bits (209), Expect = 5.427e-17
Identity = 39/93 (41.94%), Postives = 60/93 (64.52%), Query Frame = 2
Query:  365 DSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGD 643
            D    + +++T  +PP+S+ISLI MAIQ+     +T ++I ++I+  FP+Y+     WQNS+R+ LS + CF K+PR  D+P KG FW L  D
Sbjct:  197 DKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPD 289          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0085321)

HSP 1 Score: 85.1149 bits (209), Expect = 5.427e-17
Identity = 39/93 (41.94%), Postives = 60/93 (64.52%), Query Frame = 2
Query:  365 DSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGD 643
            D    + +++T  +PP+S+ISLI MAIQ+     +T ++I ++I+  FP+Y+     WQNS+R+ LS + CF K+PR  D+P KG FW L  D
Sbjct:  197 DKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPD 289          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Zebrafish
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 118.627 bits (296), Expect = 4.784e-28
Identity = 73/219 (33.33%), Postives = 110/219 (50.23%), Query Frame = 2
Query:   74 MPHCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNL----------------------NKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSW------DQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDY 646
            MP      +A KF++ WL    + + +       DDSLT+L+WL N ++                      N+L     P SP +  + + G       P  S  S+ +             Q + +  I YKT+   +PP+S+ +LICMA+Q   +++IT + I  WI  NF YY+  + SWQNS+R+ LS++KCF KVPR+KDEP KGGFW++   Y
Sbjct:    1 MPVLMSPEIANKFKEKWLMLHPEDQDNVSGSVHFDDSLTSLHWLQNFSILSANPERTPSSGCHPQHLFYYKNQLGGTDSPSSPPAGDTAATGMPQTPGNPTTSCSSLANPYALQQAGHYITGQTNPAEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQY 219          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Zebrafish
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 118.627 bits (296), Expect = 4.784e-28
Identity = 73/219 (33.33%), Postives = 110/219 (50.23%), Query Frame = 2
Query:   74 MPHCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNL----------------------NKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSW------DQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDY 646
            MP      +A KF++ WL    + + +       DDSLT+L+WL N ++                      N+L     P SP +  + + G       P  S  S+ +             Q + +  I YKT+   +PP+S+ +LICMA+Q   +++IT + I  WI  NF YY+  + SWQNS+R+ LS++KCF KVPR+KDEP KGGFW++   Y
Sbjct:    1 MPVLMSPEIANKFKEKWLMLHPEDQDNVSGSVHFDDSLTSLHWLQNFSILSANPERTPSSGCHPQHLFYYKNQLGGTDSPSSPPAGDTAATGMPQTPGNPTTSCSSLANPYALQQAGHYITGQTNPAEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQY 219          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 111.694 bits (278), Expect = 1.186e-25
Identity = 72/215 (33.49%), Postives = 117/215 (54.42%), Query Frame = 2
Query:   89 RNVLARKFRQNWLNKFSDIRYSSFIDKE-IDDSLTNLNWLPNMN-LNKLTSQ-------------ALPISPISASSMSCGKYVDLRQPYASD----------PSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
              V+    +   L+  + ++ ++ +D + +DDSLT+L WL   + LN  T Q               P SP++    S G  +   +P A+           PS+ +   C  D++D      YK++   +PP+S+ +LICMA+Q   +++IT + I +WI  NF Y++  D +WQNS+R+ LS++KCF KVPR+KDEP KGGFW++   Y + L
Sbjct:   19 EEVVTAAAQAERLDTSTPLQCNTSLDSDNLDDSLTSLQWLQEFSILNASTGQHTSPSSHSHLMGSDAPSSPLAGDPASIGMPLTPGKPTAASFCRVPMFSALPSLVAHGHCP-DEVD------YKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERL 226          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 111.694 bits (278), Expect = 1.186e-25
Identity = 72/215 (33.49%), Postives = 117/215 (54.42%), Query Frame = 2
Query:   89 RNVLARKFRQNWLNKFSDIRYSSFIDKE-IDDSLTNLNWLPNMN-LNKLTSQ-------------ALPISPISASSMSCGKYVDLRQPYASD----------PSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
              V+    +   L+  + ++ ++ +D + +DDSLT+L WL   + LN  T Q               P SP++    S G  +   +P A+           PS+ +   C  D++D      YK++   +PP+S+ +LICMA+Q   +++IT + I +WI  NF Y++  D +WQNS+R+ LS++KCF KVPR+KDEP KGGFW++   Y + L
Sbjct:   19 EEVVTAAAQAERLDTSTPLQCNTSLDSDNLDDSLTSLQWLQEFSILNASTGQHTSPSSHSHLMGSDAPSSPLAGDPASIGMPLTPGKPTAASFCRVPMFSALPSLVAHGHCP-DEVD------YKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERL 226          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Zebrafish
Match: foxa (forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-990415-76])

HSP 1 Score: 95.9005 bits (237), Expect = 4.782e-21
Identity = 46/113 (40.71%), Postives = 67/113 (59.29%), Query Frame = 2
Query:  305 PYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGD 643
            P A+ P   ++I  S  +  +   ++ +T +  +PP+S+ISLICMAIQ     R+T  +I +WI   FPYY+     WQNS+R+ LS + CF +VPR  D P KG +W L  D
Sbjct:   48 PPANPPKAYAEINSSEPEFQELKSVYRRTLSHAKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFVRVPRSPDSPGKGSYWALHPD 160          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Xenopus
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:496834])

HSP 1 Score: 114.005 bits (284), Expect = 4.727e-26
Identity = 68/177 (38.42%), Postives = 97/177 (54.80%), Query Frame = 2
Query:  173 IDDSLTNLNWLP-----NMNLNKLTSQA----------LPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            +DDSLT+L WL      N N+ K  S             P SP++A     G      +P +S  S  S +      +     I YKT+   +PP+S+ +LICMA+Q   +++IT + I +WI  NF Y++  D +WQNS+R+ LS++KCF KVPR KDEP KGGFW++   Y   L
Sbjct:   97 LDDSLTSLQWLQEFSILNANVGKAPSSGDSHGYKHLSGAPCSPLAADPACLGMPHTPGKPISSSTSRASHL-----GLQPMEDIDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRL 268          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Xenopus
Match: prss2 (serine protease 2 [Source:Xenbase;Acc:XB-GENE-6065254])

HSP 1 Score: 108.612 bits (270), Expect = 6.455e-25
Identity = 68/177 (38.42%), Postives = 97/177 (54.80%), Query Frame = 2
Query:  176 DDSLTNLNWLPNMNL--NKLTSQA-----------LPISPISASSMSC-----GKYVDLRQP--YASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDY 646
            DDSLTNL WL + ++    L+S A            P SP +  + SC     GK   +  P  +AS P+     +           + Y+T+   +PP+S+ +LICMA++   Q ++T + I  WI  NF YY+  D SWQNS+R+ LS++KCF KVPR KDEP KGGFW++   Y
Sbjct:   22 DDSLTNLQWLQDFSILSTDLSSIANSRPPLPRASQGPCSPPAGDTASCQAPRTGKQRSVAVPTAWASLPTPSPSPV---------QEVDYRTNANIKPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYYRHADPSWQNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRY 189          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 96.2857 bits (238), Expect = 4.962e-20
Identity = 51/158 (32.28%), Postives = 89/158 (56.33%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP     K+T +A      +  S  C ++      + +    ++ ++     +D       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:   18 MTSELESSLTSMDWLP-----KITVRA------AIQSSDCSQHA-----HGTGIPKKNSVLDPNTTLDQEE---VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 156          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 95.9005 bits (237), Expect = 5.129e-20
Identity = 51/158 (32.28%), Postives = 89/158 (56.33%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP     K+T +A      +  S  C ++      + +    ++ ++     +D       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:   18 MTSELESSLTSMDWLP-----KITVRA------AIQSSDCSQHA-----HGTGIPKKNSVLDPNTTLDQEE---VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 156          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 95.9005 bits (237), Expect = 5.211e-20
Identity = 51/158 (32.28%), Postives = 89/158 (56.33%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP     K+T +A      +  S  C ++      + +    ++ ++     +D       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:    1 MTSELESSLTSMDWLP-----KITVRA------AIQSSDCSQHA-----HGTGIPKKNSVLDPNTTLDQEE---VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 139          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Mouse
Match: Foxj1 (forkhead box J1 [Source:MGI Symbol;Acc:MGI:1347474])

HSP 1 Score: 108.227 bits (269), Expect = 1.148e-24
Identity = 64/180 (35.56%), Postives = 97/180 (53.89%), Query Frame = 2
Query:  173 IDDSLTNLNWLPNMNL------------------NKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            +DDSLT+L WL   ++                  +++     P SP++A     G+     +P +S  S  +         DD   + Y T+   +PP+S+ +LICMA+Q    ++IT + I +WI  NF Y++  D +WQNS+R+ LS++KCF KVPR KDEP KGGFWR+   Y + L
Sbjct:   29 LDDSLTSLQWLQEFSILNAKAPTLPPGGTDPHGYHQVPGLVAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDD---VDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERL 205          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 95.5153 bits (236), Expect = 5.041e-20
Identity = 51/158 (32.28%), Postives = 88/158 (55.70%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP + +     ++       A+  + G  +  +     DP+       + DQ +       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:   16 MTSELESSLTSMDWLPQLTMRAAIQKS------DATQNAHGTGISKKNALL-DPNT------TLDQEE------VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 95.5153 bits (236), Expect = 6.028e-20
Identity = 51/158 (32.28%), Postives = 88/158 (55.70%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP + +     ++       A+  + G  +  +     DP+       + DQ +       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:   16 MTSELESSLTSMDWLPQLTMRAAIQKS------DATQNAHGTGISKKNALL-DPNT------TLDQEE------VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Mouse
Match: Foxj2 (forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805])

HSP 1 Score: 89.7373 bits (221), Expect = 6.339e-20
Identity = 51/159 (32.08%), Postives = 80/159 (50.31%), Query Frame = 2
Query:  170 EIDDSLTNLNWLPNMNL----NKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +++ SLT+++WLP + L     KL S +    P  A   S G   D     + D +                      H  G+P +S+ +LI  AI      ++T ++I  WI  NFPYY+     W+NS+R+ LS++KCF+KVPR +D+P KG +W +
Sbjct:    4 DLESSLTSIDWLPQLTLRATIEKLGSASQAGPPGGARKCSPGSPTDPNATLSKDEAA--------------------VHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTI 142          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 85.5001 bits (210), Expect = 5.891e-19
Identity = 49/149 (32.89%), Postives = 80/149 (53.69%), Query Frame = 2
Query:  170 EIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEK 616
            E++ SLT+++WLP + +         I    A+  + G  +  +     DP+   D            +   + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P K
Sbjct:   19 ELESSLTSMDWLPQLTMRA------AIQKSDATQNAHGTGISKKNALL-DPNTTLD------------QEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGK 148          
BLAST of forkhead box J1-like protein 2 vs. UniProt/SwissProt
Match: sp|F1R8Z9|FXJ1B_DANRE (Forkhead box protein J1-B OS=Danio rerio OX=7955 GN=foxj1b PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.611e-27
Identity = 73/219 (33.33%), Postives = 110/219 (50.23%), Query Frame = 2
Query:   74 MPHCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNL----------------------NKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSW------DQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDY 646
            MP      +A KF++ WL    + + +       DDSLT+L+WL N ++                      N+L     P SP +  + + G       P  S  S+ +             Q + +  I YKT+   +PP+S+ +LICMA+Q   +++IT + I  WI  NF YY+  + SWQNS+R+ LS++KCF KVPR+KDEP KGGFW++   Y
Sbjct:    1 MPVLMSPEIANKFKEKWLMLHPEDQDNVSGSVHFDDSLTSLHWLQNFSILSANPERTPSSGCHPQHLFYYKNQLGGTDSPSSPPAGDTAATGMPQTPGNPTTSCSSLANPYALQQAGHYITGQTNPAEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQY 219          
BLAST of forkhead box J1-like protein 2 vs. UniProt/SwissProt
Match: sp|Q708W1|FXJ1B_XENLA (Forkhead box protein J1-B OS=Xenopus laevis OX=8355 GN=foxj1-b PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.153e-25
Identity = 68/178 (38.20%), Postives = 97/178 (54.49%), Query Frame = 2
Query:  173 IDDSLTNLNWLP-----NMNLNKLTSQ-----------ALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            +DDSLT+L WL      N N+ K  S              P SP++A     G      +P +S  S  S +      +     I YKT+   +PP+S+ +LICMA+Q   +++IT + I +WI  NF Y++  D +WQNS+R+ LS++KCF KVPR KDEP KGGFW++   Y   L
Sbjct:   36 LDDSLTSLQWLQEFSILNANVGKTPSSSGDSHGYRHLSGAPCSPLAADPACLGMPHTPGKPISSSTSRASHL-----GLQPMEEIDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRL 208          
BLAST of forkhead box J1-like protein 2 vs. UniProt/SwissProt
Match: sp|Q5M7N6|FOXJ1_XENTR (Forkhead box protein J1 OS=Xenopus tropicalis OX=8364 GN=foxj1 PE=2 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 1.503e-25
Identity = 68/177 (38.42%), Postives = 97/177 (54.80%), Query Frame = 2
Query:  173 IDDSLTNLNWLP-----NMNLNKLTSQA----------LPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            +DDSLT+L WL      N N+ K  S             P SP++A     G      +P +S  S  S +      +     I YKT+   +PP+S+ +LICMA+Q   +++IT + I +WI  NF Y++  D +WQNS+R+ LS++KCF KVPR KDEP KGGFW++   Y   L
Sbjct:   36 LDDSLTSLQWLQEFSILNANVGKAPSSGDSHGYKHLFGAPCSPLAADPACLGMPHTPGKPISSSTSRASHL-----GLQPMEDIDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRL 207          
BLAST of forkhead box J1-like protein 2 vs. UniProt/SwissProt
Match: sp|Q708W2|FXJ1A_XENLA (Forkhead box protein J1-A OS=Xenopus laevis OX=8355 GN=foxj1-a PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 4.264e-25
Identity = 68/178 (38.20%), Postives = 95/178 (53.37%), Query Frame = 2
Query:  173 IDDSLTNLNWLP-----NMNLNKLTSQ-----------ALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            +DDSLT+L WL      N N  K  S              P SP++A     G      +P +S  S  S +      +     I YKT+   +PP+S+ +LICMA+Q   +++IT + I  WI  NF Y++  D +WQNS+R+ LS++KCF KVPR KDEP KGGFW++   Y   L
Sbjct:   36 LDDSLTSLQWLQEFSILNSNEGKTPSSSGDSHGYRQLSGAPCSPLAADPACLGMPHTPGKPISSSTSRASHL-----GLQPMEEIDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYNWITDNFCYFRHADPTWQNSIRHNLSLNKCFMKVPREKDEPGKGGFWKIDPQYADRL 208          
BLAST of forkhead box J1-like protein 2 vs. UniProt/SwissProt
Match: sp|F1QDF8|FXJ1A_DANRE (Forkhead box protein J1-A OS=Danio rerio OX=7955 GN=foxj1a PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 8.956e-25
Identity = 72/215 (33.49%), Postives = 117/215 (54.42%), Query Frame = 2
Query:   89 RNVLARKFRQNWLNKFSDIRYSSFIDKE-IDDSLTNLNWLPNMN-LNKLTSQ-------------ALPISPISASSMSCGKYVDLRQPYASD----------PSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
              V+    +   L+  + ++ ++ +D + +DDSLT+L WL   + LN  T Q               P SP++    S G  +   +P A+           PS+ +   C  D++D      YK++   +PP+S+ +LICMA+Q   +++IT + I +WI  NF Y++  D +WQNS+R+ LS++KCF KVPR+KDEP KGGFW++   Y + L
Sbjct:   19 EEVVTAAAQAERLDTSTPLQCNTSLDSDNLDDSLTSLQWLQEFSILNASTGQHTSPSSHSHLMGSDAPSSPLAGDPASIGMPLTPGKPTAASFCRVPMFSALPSLVAHGHCP-DEVD------YKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERL 226          
BLAST of forkhead box J1-like protein 2 vs. TrEMBL
Match: K7WR19 (Forkhead box J1-like protein 2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.745e-126
Identity = 183/183 (100.00%), Postives = 183/183 (100.00%), Query Frame = 2
Query:   80 HCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFW 628
            HCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFW
Sbjct:    1 HCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFW 183          
BLAST of forkhead box J1-like protein 2 vs. TrEMBL
Match: R7TG11 (Fork-head domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_222987 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.119e-33
Identity = 82/219 (37.44%), Postives = 121/219 (55.25%), Query Frame = 2
Query:   74 MPHCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASD-------------------------PSVRS--DIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQ 649
            MP  TR  LA++ RQNW+ K             +DDSLT+LNWL N+N+ K+ S   P SP    ++  G      + YA+                          P  R   D+    + ++   +I YK +   +PP+S+ +LICMA+++  ++++T + I  WI  NF YY++ D SWQNS+R+ LS++KCFQKVPRRKDEP KGGFWR++ +YQ
Sbjct:    1 MPPLTRETLAQRLRQNWMAKHPVDAPPPTNGAALDDSLTSLNWLHNLNIMKIASPTPPASPQPGDAVPGGLMTASSESYATSGNMQVNPNSILNVTNLPRNNLGRELPGCRGLVDLRAPCNPLE---KIDYKHNPHVKPPYSYATLICMAMKESKKNKVTLSGIYNWITENFMYYRMADPSWQNSIRHNLSLNKCFQKVPRRKDEPGKGGFWRINPEYQ 216          
BLAST of forkhead box J1-like protein 2 vs. TrEMBL
Match: A0A1S3IBP0 (forkhead box protein J1-B OS=Lingula unguis OX=7574 GN=LOC106162725 PE=4 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.329e-33
Identity = 89/209 (42.58%), Postives = 127/209 (60.77%), Query Frame = 2
Query:   74 MPHCTRNVLARKFRQNWLNKF-------SDIRYSSFIDKEIDDSLTNLNWLPNMN-LNKLTSQALPISPISASSMSCGKYVDLRQP--YASDPSVRSDIICSWDQIDD----STRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            MP  +++ LA KFRQNWL K        S    SS  +  +DDSLT+LNWL N+N +N   +   P SP      +    VD      YAS P ++ +   S+D +      + +I YKT+   +PP+S+ +LICMA+++  ++++T + I  WI  NF YY++ D SWQNS+R+ LS++KCFQKVPRRKDEP KGGFWR++ DY   L
Sbjct:    1 MPVLSKDTLAMKFRQNWLAKHPMEAATPSSGGNSSGNNGNLDDSLTSLNWLQNLNIMNFGAAPTPPASPQPQVECANDGKVDPNAILNYASTP-IKVEPPRSYDLMPATPVAAEKIDYKTNPYVKPPYSYATLICMAMKETKKAKMTLSAIYNWITDNFMYYRVADPSWQNSIRHNLSLNKCFQKVPRRKDEPGKGGFWRINPDYNDQL 208          
BLAST of forkhead box J1-like protein 2 vs. TrEMBL
Match: A0A0X3PFR8 (Forkhead box protein J1.2 (Fragment) OS=Schistocephalus solidus OX=70667 GN=FXJ12 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.298e-33
Identity = 79/191 (41.36%), Postives = 114/191 (59.69%), Query Frame = 2
Query:   98 LARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYAS---DPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYLN 661
            LA++FR+NWL    + R       E DDSLTNL WL  M+   L S  +P++P++    +     +   P+A    DP VR D               Y+T  TG+PPFS+ SLIC+A+++IG+ ++T + I  WI+ NF YY+  D+SWQNSVR+ LS++KCF+KVPR K E  KGGFWR++  +  +L 
Sbjct:   46 LAQQFRENWLRCSPNFR-------ETDDSLTNLTWLFEMSPFSLESDEVPVNPVNGPRATG----EPTHPFAGSLLDPQVRMD---------------YRTKWTGKPPFSYASLICLAMREIGKPKVTLSDIYGWIMANFAYYRHTDSSWQNSVRHNLSLNKCFEKVPREKGERGKGGFWRVNPRHADWLE 210          
BLAST of forkhead box J1-like protein 2 vs. TrEMBL
Match: A0A0X3NXC7 (Forkhead box protein J1.2 (Fragment) OS=Schistocephalus solidus OX=70667 GN=FXJ12 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 5.677e-33
Identity = 80/195 (41.03%), Postives = 116/195 (59.49%), Query Frame = 2
Query:   98 LARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSC--GKYVDLR--QPYAS---DPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYLN 661
            LA++FR+NWL    + R       E DDSLTNL WL  M+   L S  +P++P++    +   G  +  +   P+A    DP VR D               Y+T  TG+PPFS+ SLIC+A+++IG+ ++T + I  WI+ NF YY+  D+SWQNSVR+ LS++KCF+KVPR K E  KGGFWR++  +  +L 
Sbjct:   46 LAQQFRENWLRCSPNFR-------ETDDSLTNLTWLFEMSPFSLESDEVPVNPVNGPRATAFLGSNISWQPTHPFAGSLLDPQVRMD---------------YRTKWTGKPPFSYASLICLAMREIGKPKVTLSDIYGWIMANFAYYRHTDSSWQNSVRHNLSLNKCFEKVPREKGERGKGGFWRVNPRHADWLE 218          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000049290.1 (forkhead box J1 [Source:NCBI gene;Acc:103028087])

HSP 1 Score: 111.694 bits (278), Expect = 1.221e-25
Identity = 69/193 (35.75%), Postives = 106/193 (54.92%), Query Frame = 2
Query:  173 IDDSLTNLNWLPNMNL---------------------NKLTSQALPISPISASSMSCGKYVDLRQPYASD----------PSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            +DDSLT+L WL   ++                      +L ++A P SP++    S G  +   +P A+           PS+ +   C  D++D      YKT+   +PP+S+ +LICMA+Q   +S+IT + I +WI  NF Y++  D +WQNS+R+ LS++KCF KVPR+KDEP KGGFW++   Y + L
Sbjct:   47 LDDSLTSLQWLQEFSILNASGGQHVSTSSQHHSPFFGQQLGAEA-PASPLAGDPASIGMPLTPGKPIAASFCRVPSLSALPSLVAHGHCP-DEVD------YKTNPHIKPPYSYATLICMAMQASKKSKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERL 231          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 99.3673 bits (246), Expect = 2.732e-21
Identity = 52/164 (31.71%), Postives = 87/164 (53.05%), Query Frame = 2
Query:  143 IRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  S+ +  E++ SLT+++WLP + +     +A                 +   P  +  S   D   + DQ +       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:    5 VLSSAAMTSELESSLTSMDWLPQLTMRAAIQKA--------------DAQNAHGPGMAKKSALLDPNTTLDQEE------VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 148          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 97.8265 bits (242), Expect = 9.396e-21
Identity = 51/158 (32.28%), Postives = 84/158 (53.16%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP + +     +A                 +   P  +  S   D   + DQ +       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:    1 MTSELESSLTSMDWLPQLTMRAAIQKA--------------DAQNAHGPGMAKKSALLDPNTTLDQEE------VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 138          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Cavefish
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:103033433])

HSP 1 Score: 90.5077 bits (223), Expect = 5.596e-19
Identity = 54/166 (32.53%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  182 SLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPS------------VRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGD 643
            + +++N +P MN    T  + P+S  S  +MS      +       P+            V S +    ++  D  + + +++T  +PP+S+ISLI MAIQ      +T  +I +WI+  FP+Y+     WQNS+R+ LS + CF KVPR  D+P KG FW L  D
Sbjct:   54 AASSMNSMPYMN----TGMSHPVSGGSPGTMSTSLNASMSPMSGGSPTPMNSLASYSSMNVVSPVYGQANRARD-PKAYRRSYTHAKPPYSYISLITMAIQQSSSKMLTLNEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPD 214          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Cavefish
Match: foxi2 (forkhead box protein I1c [Source:NCBI gene;Acc:103023829])

HSP 1 Score: 88.9669 bits (219), Expect = 1.685e-18
Identity = 38/86 (44.19%), Postives = 60/86 (69.77%), Query Frame = 2
Query:  404 RPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYLN 661
            RPP+S+ +LI MAIQ   + R+T +QI +++  NFP+Y+     WQNS+R+ LS++ CF+KVPR +D+P KG +W L  + +K  +
Sbjct:  136 RPPYSYSALIAMAIQSAREKRLTLSQIYQYVADNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFD 221          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Sea Lamprey
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 111.694 bits (278), Expect = 1.569e-26
Identity = 65/173 (37.57%), Postives = 95/173 (54.91%), Query Frame = 2
Query:  173 IDDSLTNLNWLPNMNLNKLTSQALPISPISAS-----SMSCGKYVDLRQPYASDPS----VRSDIICSWDQIDDST------RIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDY 646
            +DDSLT+L WL   ++   + +A  +SP  AS     S   G     R   A  P      RS       Q+           + Y+T  + +PP+S+ +LICMA++   +S++T   I +WI+ NF YY+  D +WQNS+R+ LS++KCF KVPR+KDEP KGGFW +   Y
Sbjct:    1 LDDSLTSLQWLQEFSIQGSSLRAPQVSPGGASGPAPCSPPAGDTAGARGTPACTPQRPACGRSREGTGEQQVGGRAASPVPDEVDYRTDASVKPPYSYATLICMAMRSTHKSKVTLASIYKWIMDNFCYYRHADPTWQNSIRHNLSLNKCFVKVPRQKDEPGKGGFWAMDPQY 173          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Sea Lamprey
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 108.227 bits (269), Expect = 2.455e-25
Identity = 65/213 (30.52%), Postives = 102/213 (47.89%), Query Frame = 2
Query:   95 VLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNL-------------------------NKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
             +A + + NW     + R +      +DDSLT+L WL N ++                                L +     +S + G       P      V + ++   +Q    T I Y+T+   +PP+S+ +LICMA+Q   +S++T   I +WI  NF YY+  D  W+NS+R+ LS++KCF KVPR+KDEP KGGFW ++  Y   +
Sbjct:    6 AIADRVKANWRLLHPEDRDNDAGAVTLDDSLTSLQWLQNFSIANADLPRPPGQQQGRSWAAAGGGAGAPGWGDLLGVGAGPPASPTAGDTAGSTGPRTPGKPVSAAVMAQ-EQQQQQTEIDYRTNGAAKPPYSYATLICMAMQASKKSKVTLATIYKWITDNFCYYRHADPCWRNSIRHNLSLNKCFSKVPRQKDEPGKGGFWSINPQYADVV 217          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Sea Lamprey
Match: foxg1a (forkhead box G1a [Source:ZFIN;Acc:ZDB-GENE-990415-267])

HSP 1 Score: 85.8853 bits (211), Expect = 1.151e-19
Identity = 39/77 (50.65%), Postives = 55/77 (71.43%), Query Frame = 2
Query:  404 RPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +PPFS+ +LI MAI+   + R+T + I E+I+ NFPYY+     WQNS+R+ LS++KCF KVPR  D+P KG +W L
Sbjct:   32 KPPFSYNALIMMAIRQSPEKRLTLSGIYEYIMHNFPYYRQNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWML 108          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Sea Lamprey
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:30126])

HSP 1 Score: 89.3521 bits (220), Expect = 4.652e-19
Identity = 40/91 (43.96%), Postives = 58/91 (63.74%), Query Frame = 2
Query:  371 TRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGD 643
            ++++ + +T  +PP+S+ISLI MAIQ      +T  +I  WI+  FP+Y+     WQNS+R+ LS + CF KVPR  D+P KG FW L  D
Sbjct:  150 SKVYRRNYTHAKPPYSYISLITMAIQQSTHKMMTLNEIYSWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPD 240          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005206.1 (pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 gene:ENSPMAG00000004735.1 transcript:ENSPMAT00000005206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 1.504e-18
Identity = 41/94 (43.62%), Postives = 58/94 (61.70%), Query Frame = 2
Query:  362 DDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGD 643
            D + + + +++T  +PP+S+ISLI MAIQ      +T  +I  WI   FP+Y+     WQNS+R+ LS + CF KVPR  D+P KG FW L  D
Sbjct:  141 DAAFKGYRRSYTHAKPPYSYISLITMAIQQSSGKMLTLNEIYSWITDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPD 234          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 78.1814 bits (191), Expect = 2.238e-15
Identity = 37/88 (42.05%), Postives = 58/88 (65.91%), Query Frame = 2
Query:  404 RPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDY-QKYLNQ 664
            +PP S+ ++I  AI    +  I+   I ++I  N+ YY+   + WQNS+R+ LS++K F+KVPRR +EP KG  WR+S  Y Q++LN+
Sbjct:  340 KPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISESYQQEFLNK 427          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 74.7146 bits (182), Expect = 2.136e-14
Identity = 46/131 (35.11%), Postives = 72/131 (54.96%), Query Frame = 2
Query:  245 PISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDS-TRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            P+SP  +S ++  K    R    SD   RS+   + ++I  S  R         +PP+S+ +LIC+AI    + ++T +QI  WI ++FPYY+  D SWQNS+R+ LS++  F K  +  D   KG FW +
Sbjct:   59 PLSPDHSSPIAPSKAKRQR----SDTCARSNGNLTLEEILQSLERRRINGELAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCD--GKGHFWEV 183          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 63.5438 bits (153), Expect = 4.968e-11
Identity = 32/88 (36.36%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  404 RPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQK-YLNQ 664
            +PP S+ S+I  AI    +  I+   I ++I  N+ +Y+    +WQNSVR+ LS++K F+KVP+R  +  KG  W++S + ++ +LN+
Sbjct:  303 KPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLNK 390          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Nematostella
Match: EDO44876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL7])

HSP 1 Score: 101.293 bits (251), Expect = 9.253e-26
Identity = 43/81 (53.09%), Postives = 63/81 (77.78%), Query Frame = 2
Query:  404 RPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDY 646
            +PP+S+ +LICMA++D  + +IT + I +WI  NF +Y++ D +WQNS+R+ LS++KCF KVPR+KDEP KGGFWR+   Y
Sbjct:    1 KPPYSYATLICMAMRDTKRVKITLSAIYKWIKENFMFYRVADPTWQNSIRHNLSLNKCFVKVPRKKDEPGKGGFWRIDPAY 81          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Nematostella
Match: EDO42654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W7])

HSP 1 Score: 85.1149 bits (209), Expect = 4.134e-20
Identity = 37/83 (44.58%), Postives = 59/83 (71.08%), Query Frame = 2
Query:  404 RPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQK 652
            +PP+S+++LI MAI+     +IT + I ++II NFPYY++    WQNS+R+ LS++KCF K+PR + +P KG +W L   Y++
Sbjct:    3 KPPYSYVALISMAIKQSKGQKITLSGIYQFIIENFPYYRLNKRGWQNSIRHNLSLNKCFVKIPRERSDPGKGCYWALDPAYEE 85          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Nematostella
Match: EDO46828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP00])

HSP 1 Score: 82.0333 bits (201), Expect = 6.216e-19
Identity = 38/77 (49.35%), Postives = 54/77 (70.13%), Query Frame = 2
Query:  404 RPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +P FS+ +LI MAI+   + R+T + I E+I+ NFPYY+     WQNS+R+ LS++KCF KVPR  D+P KG +W L
Sbjct:    2 KPAFSYNALIMMAIRGSEEKRLTLSGIYEYIMKNFPYYRNNKQGWQNSIRHNLSLNKCFVKVPRNYDDPGKGNYWML 78          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Nematostella
Match: EDO42492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E3])

HSP 1 Score: 87.0409 bits (214), Expect = 8.014e-19
Identity = 40/93 (43.01%), Postives = 59/93 (63.44%), Query Frame = 2
Query:  365 DSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGD 643
            D  + + +++T  +PP+S+ISLI MAIQ      +T ++I ++I+  FPYY+     WQNS+R+ LS + CF KVPR  D P KG +W L  D
Sbjct:   27 DKEKAYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQFIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDRPGKGSYWTLHPD 119          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Nematostella
Match: EDO36951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH30])

HSP 1 Score: 80.4925 bits (197), Expect = 2.158e-18
Identity = 36/78 (46.15%), Postives = 51/78 (65.38%), Query Frame = 2
Query:  401 GRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            G+PP+S+  LI  AI      ++T + I   I  N+PYY+  D  WQNS+R+ LS+++ F KVPR +DEP KG FWR+
Sbjct:    3 GKPPYSYAQLIVQAILSATDKQLTLSGIYAHITKNYPYYRTADKGWQNSIRHNLSLNRYFVKVPRAQDEPGKGSFWRI 80          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Medaka
Match: foxj1b (forkhead box protein J1-B [Source:NCBI gene;Acc:101165351])

HSP 1 Score: 119.783 bits (299), Expect = 2.258e-28
Identity = 77/217 (35.48%), Postives = 113/217 (52.07%), Query Frame = 2
Query:  101 ARKFRQNWLNKFSDIRYSSFIDKE-IDDSLTNLNWLPNMNLNKLTSQ----ALPISPISASSMSCGKYVDLRQ--------PYASDPSVRSDII--------------------CSWDQI--DDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDY 646
            A KFR++WL+ F +     F D   +DDSLT+L+WL N ++     +    A P  P S   +   K +  ++        P A D +     +                    C+  QI    S  + YKT+   +PP+S+ SLICMA+Q   Q ++T + I  WI  NF YY+  + SWQNS+R+ LS++KCF+KVPR+KDEP KGGFW++   Y
Sbjct:   10 ASKFRESWLSVFPE---DPFTDAAPLDDSLTSLHWLQNFSILSADPERPNGAGPGCPSSQQHLCMMKRLGFQRAGTDSPSSPPAGDTAAAGMPLYPGSPVTSGSDSSASPRYPSCAHPQIQASPSAEVDYKTNPKVKPPYSYASLICMAMQASKQPKVTLSTIYNWITQNFCYYRHAEPSWQNSIRHNLSLNKCFKKVPRQKDEPGKGGFWQIDPQY 223          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Medaka
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:100301616])

HSP 1 Score: 112.464 bits (280), Expect = 6.599e-26
Identity = 64/179 (35.75%), Postives = 101/179 (56.42%), Query Frame = 2
Query:  173 IDDSLTNLNWLPNMNL----------------NKLTSQALPISPISASSMSCGKYVDLRQPYASDPS-VRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            +DDSLT+L WL + ++                 +      P SP++    S G  +   +P A+  S ++  ++      D +    Y+ +   +PPFS+ +LICMA+Q   +S+IT + I +WI  NF YY+  D +WQNS+R+ LS++KCF KVPR+KDEP KGGFW++   Y ++L
Sbjct:   42 LDDSLTSLQWLQDFSILGANVPQHAHQQPHFFGQQLGLDAPASPLAGDPASMGMPLTPGKPTAASYSRIQPGVVARGLTPDGAD---YRNNARVKPPFSYATLICMAMQASKKSKITLSCIYKWITDNFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHL 217          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Medaka
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:100301616])

HSP 1 Score: 112.464 bits (280), Expect = 6.606e-26
Identity = 64/179 (35.75%), Postives = 101/179 (56.42%), Query Frame = 2
Query:  173 IDDSLTNLNWLPNMNL----------------NKLTSQALPISPISASSMSCGKYVDLRQPYASDPS-VRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            +DDSLT+L WL + ++                 +      P SP++    S G  +   +P A+  S ++  ++      D +    Y+ +   +PPFS+ +LICMA+Q   +S+IT + I +WI  NF YY+  D +WQNS+R+ LS++KCF KVPR+KDEP KGGFW++   Y ++L
Sbjct:   60 LDDSLTSLQWLQDFSILGANVPQHAHQQPHFFGQQLGLDAPASPLAGDPASMGMPLTPGKPTAASYSRIQPGVVARGLTPDGAD---YRNNARVKPPFSYATLICMAMQASKKSKITLSCIYKWITDNFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHL 235          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Medaka
Match: ENSORLT00000031716.1 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 97.0561 bits (240), Expect = 1.123e-22
Identity = 54/155 (34.84%), Postives = 85/155 (54.84%), Query Frame = 2
Query:  170 EIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            E++ SLT+++WLP +++     +                 VDLR  +     V  D   + DQ + +       H  G+PP+S+ SLI  AI    + R+T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KVPR KD+P KG +W +
Sbjct:   22 ELESSLTSMDWLPQLSMRAAIQK-----------------VDLRNHHGKK-MVHLDPGTTLDQEEAAQ------HRDGKPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 152          
BLAST of forkhead box J1-like protein 2 vs. Ensembl Medaka
Match: FOXJ3 (forkhead box protein J3 [Source:NCBI gene;Acc:101158100])

HSP 1 Score: 94.7449 bits (234), Expect = 8.690e-20
Identity = 50/158 (31.65%), Postives = 82/158 (51.90%), Query Frame = 2
Query:  161 IDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRL 634
            +  E++ SLT+++WLP + +     +A                 +   P     S   D   + DQ +       + H  G+PP+S+ SLI  AI    + ++T ++I +WI  NFPYY+   + W+NS+R+ LS++KCF KV R KD+P KG +W +
Sbjct:    1 MTSELESSLTSMDWLPQLTMQAAIRKA--------------DAQNAHGPGMGKKSTLLDHNTTLDQEE------VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVARSKDDPGKGSYWAI 138          
BLAST of forkhead box J1-like protein 2 vs. Planmine SMEST
Match: SMESG000072873.1 (SMESG000072873.1)

HSP 1 Score: 1095.11 bits (2831), Expect = 0.000e+0
Identity = 596/596 (100.00%), Postives = 596/596 (100.00%), Query Frame = 2
Query:   74 MPHCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYLNQXXXXXXXXXXXXLGKPIYSQSSLYNDCYGSSNQCMSSFSQLSNTDSGHXXXXXXXXXXXXXXXXXXXXXXXYNFTNRNPQQNQYFNQMKRQKSKYQNSIVPFNIHSSYSQFQPHMNSNFLQDCNSDVRFCPSKNFYMNPAAISTPIGKANNAYPSHFPHYPYFSMNGKARNRQMVESERFFSNNRQGIHRFGSNSRQNSSLFSKSFTDSNYDXXXXXXXXXXXXXXXXXXXXLVHKRSYQFSVRSPDCRQFSQLNKTFPMGDNIDYRNYKSVAMKTNEDLRKPLKFLDQSDLPLSFSTSDQFLINPDLVKNELSFNSSPIFESEELSDSNLIQVKEELKSNSTGWWNQSQFDSCNLDALPLCEKLEPLVSSPFLGLDKEQQWVDEELNLEELDSILGLS 1861
            MPHCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYLNQSSSTSCPASSTTLGKPIYSQSSLYNDCYGSSNQCMSSFSQLSNTDSGHSSNLSSCSRKSHSKSSTCSAHSNYNFTNRNPQQNQYFNQMKRQKSKYQNSIVPFNIHSSYSQFQPHMNSNFLQDCNSDVRFCPSKNFYMNPAAISTPIGKANNAYPSHFPHYPYFSMNGKARNRQMVESERFFSNNRQGIHRFGSNSRQNSSLFSKSFTDSNYDSRLSSSLQPSSNSAFSSFRNLVHKRSYQFSVRSPDCRQFSQLNKTFPMGDNIDYRNYKSVAMKTNEDLRKPLKFLDQSDLPLSFSTSDQFLINPDLVKNELSFNSSPIFESEELSDSNLIQVKEELKSNSTGWWNQSQFDSCNLDALPLCEKLEPLVSSPFLGLDKEQQWVDEELNLEELDSILGLS
Sbjct:    1 MPHCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYLNQSSSTSCPASSTTLGKPIYSQSSLYNDCYGSSNQCMSSFSQLSNTDSGHSSNLSSCSRKSHSKSSTCSAHSNYNFTNRNPQQNQYFNQMKRQKSKYQNSIVPFNIHSSYSQFQPHMNSNFLQDCNSDVRFCPSKNFYMNPAAISTPIGKANNAYPSHFPHYPYFSMNGKARNRQMVESERFFSNNRQGIHRFGSNSRQNSSLFSKSFTDSNYDSRLSSSLQPSSNSAFSSFRNLVHKRSYQFSVRSPDCRQFSQLNKTFPMGDNIDYRNYKSVAMKTNEDLRKPLKFLDQSDLPLSFSTSDQFLINPDLVKNELSFNSSPIFESEELSDSNLIQVKEELKSNSTGWWNQSQFDSCNLDALPLCEKLEPLVSSPFLGLDKEQQWVDEELNLEELDSILGLS 596          
BLAST of forkhead box J1-like protein 2 vs. Planmine SMEST
Match: SMESG000010030.1 (SMESG000010030.1)

HSP 1 Score: 142.51 bits (358), Expect = 1.110e-35
Identity = 84/216 (38.89%), Postives = 123/216 (56.94%), Query Frame = 2
Query:   95 VLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMN---------------LNKLTSQALPISPISASSMSCGKYV----------DLRQPYASDPSVRSDIICSWDQ---IDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            VLA KF++NWL+K           KE+DDSLTNLNWL N+                LN+   Q LP     A+++    +V          +    ++S+PS    +  +      +D   R  YKT+ +G+PPFS+ +LICM+++++ +S+IT + I  WI  NF YY++ D+SWQNSVR+ LS++KCF+KVPR KDE  KGGFWR++  Y   L
Sbjct:   52 VLAEKFQKNWLDK------KGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPANNIIANNFVNNEINISKQSEFSNNFSSNPSFTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRL 261          
BLAST of forkhead box J1-like protein 2 vs. Planmine SMEST
Match: SMESG000067319.1 (SMESG000067319.1)

HSP 1 Score: 116.701 bits (291), Expect = 2.208e-27
Identity = 71/173 (41.04%), Postives = 99/173 (57.23%), Query Frame = 2
Query:  176 DDSLTNLNWLPNM-----NLNKLTSQALPISPIS--ASSMSCGKYVDLRQPYASD-----PSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            D+SLT+LNWL N+     N      + LP S +S  A+S +  K     Q Y        PS     + +    D   R  YK     +PP S+ +LICMA+ D+G+ +I   +I EWI  NF YY+  D+SWQNSVR+ LS+ KCF+KVPR+KDE  KGGFWR++ ++ + L
Sbjct:   66 DESLTSLNWLNNISIPISNTIPTNEEYLPSSTLSLNANSFNSNKI----QTYDKSVLQYFPSKLQAALRNEGLFDPIIRYEYKNSWKNKPPLSYTTLICMAMLDLGKPKIALNEIYEWIRENFLYYRKSDSSWQNSVRHNLSLKKCFEKVPRKKDERGKGGFWRINPNFTENL 234          
BLAST of forkhead box J1-like protein 2 vs. Planmine SMEST
Match: SMESG000067319.1 (SMESG000067319.1)

HSP 1 Score: 116.316 bits (290), Expect = 2.220e-27
Identity = 71/173 (41.04%), Postives = 99/173 (57.23%), Query Frame = 2
Query:  176 DDSLTNLNWLPNM-----NLNKLTSQALPISPIS--ASSMSCGKYVDLRQPYASD-----PSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 658
            D+SLT+LNWL N+     N      + LP S +S  A+S +  K     Q Y        PS     + +    D   R  YK     +PP S+ +LICMA+ D+G+ +I   +I EWI  NF YY+  D+SWQNSVR+ LS+ KCF+KVPR+KDE  KGGFWR++ ++ + L
Sbjct:   55 DESLTSLNWLNNISIPISNTIPTNEEYLPSSTLSLNANSFNSNKI----QTYDKSVLQYFPSKLQAALRNEGLFDPIIRYEYKNSWKNKPPLSYTTLICMAMLDLGKPKIALNEIYEWIRENFLYYRKSDSSWQNSVRHNLSLKKCFEKVPRKKDERGKGGFWRINPNFTENL 223          
BLAST of forkhead box J1-like protein 2 vs. Planmine SMEST
Match: SMESG000072183.1 (SMESG000072183.1)

HSP 1 Score: 113.62 bits (283), Expect = 2.153e-26
Identity = 78/200 (39.00%), Postives = 109/200 (54.50%), Query Frame = 2
Query:   95 VLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLNKLTSQ------ALPISPISASSMSCGKYVDL-RQPYAS---DPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYLNQ 664
            +LA  F +NW  +  +       +   DDSLTNLNWL N+N  K+  Q        P   + ++S     Y     Q  AS   D S  +  + S DQ     +  YK +   +P F+   LI  A++++G+ +IT + I  WI  NF YY+  D+SWQNSVR+ LS++K FQKVPRRKDEP KGGFWR++ D  K L+ 
Sbjct:   62 ILANTFHKNWSEQCGN-------ESGFDDSLTNLNWLHNVNPMKINEQMSHVHVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISADQFS-FDKPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDH 253          
The following BLAST results are available for this feature:
BLAST of forkhead box J1-like protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXJ12.825e-2536.11forkhead box J1 [Source:HGNC Symbol;Acc:HGNC:3816][more]
FOXJ31.091e-2032.91forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ36.303e-2032.28forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ37.349e-2032.28forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ37.349e-2032.28forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkh-21.932e-1848.10ForKHead transcription factor family [Source:UniP... [more]
pha-41.630e-1742.86Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.908e-1747.62Defective pharyngeal development protein 4 [Sourc... [more]
pha-43.090e-1747.62Defective pharyngeal development protein 4 [Sourc... [more]
unc-1304.851e-1540.48pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slp11.055e-1746.84gene:FBgn0003430 transcript:FBtr0077499[more]
fkh5.262e-1741.94gene:FBgn0000659 transcript:FBtr0346765[more]
fkh5.427e-1741.94gene:FBgn0000659 transcript:FBtr0300259[more]
fkh5.427e-1741.94gene:FBgn0000659 transcript:FBtr0345227[more]
fkh5.427e-1741.94gene:FBgn0000659 transcript:FBtr0085321[more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj1b4.784e-2833.33forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1b4.784e-2833.33forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1a1.186e-2533.49forkhead box J1a [Source:NCBI gene;Acc:767737][more]
foxj1a1.186e-2533.49forkhead box J1a [Source:NCBI gene;Acc:767737][more]
foxa4.782e-2140.71forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj14.727e-2638.42forkhead box J1 [Source:NCBI gene;Acc:496834][more]
prss26.455e-2538.42serine protease 2 [Source:Xenbase;Acc:XB-GENE-6065... [more]
ndel14.962e-2032.28nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel15.129e-2032.28nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel15.211e-2032.28nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxj11.148e-2435.56forkhead box J1 [Source:MGI Symbol;Acc:MGI:1347474... [more]
Foxj35.041e-2032.28forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj36.028e-2032.28forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj26.339e-2032.08forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805... [more]
Foxj35.891e-1932.89forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1R8Z9|FXJ1B_DANRE3.611e-2733.33Forkhead box protein J1-B OS=Danio rerio OX=7955 G... [more]
sp|Q708W1|FXJ1B_XENLA1.153e-2538.20Forkhead box protein J1-B OS=Xenopus laevis OX=835... [more]
sp|Q5M7N6|FOXJ1_XENTR1.503e-2538.42Forkhead box protein J1 OS=Xenopus tropicalis OX=8... [more]
sp|Q708W2|FXJ1A_XENLA4.264e-2538.20Forkhead box protein J1-A OS=Xenopus laevis OX=835... [more]
sp|F1QDF8|FXJ1A_DANRE8.956e-2533.49Forkhead box protein J1-A OS=Danio rerio OX=7955 G... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K7WR191.745e-126100.00Forkhead box J1-like protein 2 (Fragment) OS=Schmi... [more]
R7TG111.119e-3337.44Fork-head domain-containing protein OS=Capitella t... [more]
A0A1S3IBP01.329e-3342.58forkhead box protein J1-B OS=Lingula unguis OX=757... [more]
A0A0X3PFR82.298e-3341.36Forkhead box protein J1.2 (Fragment) OS=Schistocep... [more]
A0A0X3NXC75.677e-3341.03Forkhead box protein J1.2 (Fragment) OS=Schistocep... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000049290.11.221e-2535.75forkhead box J1 [Source:NCBI gene;Acc:103028087][more]
foxj32.732e-2131.71forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxj39.396e-2132.28forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxa25.596e-1932.53forkhead box A2 [Source:NCBI gene;Acc:103033433][more]
foxi21.685e-1844.19forkhead box protein I1c [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj1b1.569e-2637.57forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1b2.455e-2530.52forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxg1a1.151e-1950.65forkhead box G1a [Source:ZFIN;Acc:ZDB-GENE-990415-... [more]
foxa24.652e-1943.96forkhead box A2 [Source:NCBI gene;Acc:30126][more]
ENSPMAT00000005206.11.504e-1843.62pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 ge... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
FKH22.238e-1542.05Forkhead family transcription factor; rate-limitin... [more]
HCM12.136e-1435.11Forkhead transcription factor; drives S-phase acti... [more]
FKH14.968e-1136.36Forkhead family transcription factor; rate-limitin... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448769.253e-2653.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426544.134e-2044.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468286.216e-1949.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424928.014e-1943.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369512.158e-1846.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj1b2.258e-2835.48forkhead box protein J1-B [Source:NCBI gene;Acc:10... [more]
foxj16.599e-2635.75forkhead box J1 [Source:NCBI gene;Acc:100301616][more]
foxj16.606e-2635.75forkhead box J1 [Source:NCBI gene;Acc:100301616][more]
ENSORLT00000031716.11.123e-2234.84forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
FOXJ38.690e-2031.65forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of forkhead box J1-like protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072873.10.000e+0100.00SMESG000072873.1[more]
SMESG000010030.11.110e-3538.89SMESG000010030.1[more]
SMESG000067319.12.208e-2741.04SMESG000067319.1[more]
SMESG000067319.12.220e-2741.04SMESG000067319.1[more]
SMESG000072183.12.153e-2639.00SMESG000072183.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026881
GenBankAFX62229.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026881 ID=SMED30026881|Name=forkhead box J1-like protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2113bp
CTTAGAAAACTCATTGAAAATGTCTAGAAGTAGAATTTGAATAAGATCAA
AGAGTTTTGGATCCAAATCTATCATGCCCCACTGCACAAGGAACGTCTTG
GCCAGGAAATTCCGTCAAAATTGGCTAAATAAATTTTCAGATATCCGGTA
CAGCAGCTTTATTGACAAAGAGATTGACGACTCTTTGACGAACCTCAATT
GGCTTCCAAACATGAATCTGAATAAATTGACCTCCCAGGCTTTGCCTATT
TCACCAATATCGGCTTCTTCAATGAGTTGTGGAAAGTATGTTGACCTAAG
ACAACCGTATGCGTCAGACCCGAGTGTCAGAAGCGATATTATCTGCAGCT
GGGACCAAATCGACGATTCGACGAGAATATTCTATAAGACCCATACCACA
GGACGACCACCTTTCTCCCATATAAGCTTGATATGCATGGCTATTCAAGA
CATAGGTCAATCTAGAATTACCTCGACTCAGATTTGCGAGTGGATTATAA
TAAATTTCCCATACTACCAGATTCTGGACAATTCCTGGCAAAACTCCGTT
AGAAATCTTCTCTCAGTTAGTAAGTGTTTTCAAAAGGTACCCCGCCGTAA
AGATGAGCCAGAAAAAGGTGGCTTTTGGAGACTTAGTGGGGATTATCAGA
AGTATCTTAACCAATCATCTAGTACCTCATGTCCTGCCTCTAGTACTACC
CTAGGCAAGCCAATATATTCACAATCATCGCTATATAATGATTGCTACGG
ATCCAGTAACCAATGCATGTCCTCGTTTTCCCAATTGAGTAATACTGATT
CCGGACACAGTTCAAACCTTTCGAGTTGCTCTAGGAAATCCCACAGTAAA
TCATCTACATGTTCTGCGCATTCCAATTATAACTTTACCAACCGAAATCC
TCAACAAAACCAATATTTTAATCAAATGAAACGGCAGAAGTCCAAATACC
AGAACTCCATCGTTCCGTTCAACATCCATTCTTCTTACTCCCAATTCCAG
CCGCACATGAATTCTAATTTTCTACAAGACTGCAACAGCGACGTCAGATT
CTGTCCTTCCAAAAATTTCTACATGAATCCGGCTGCGATTTCGACACCAA
TCGGCAAAGCCAATAATGCATATCCTTCACATTTCCCTCACTATCCTTAT
TTCTCCATGAATGGGAAAGCGAGAAACCGTCAGATGGTAGAGAGTGAAAG
ATTTTTCAGCAATAATCGCCAAGGAATCCACAGATTTGGATCAAATAGTC
GACAGAACTCATCGTTATTCAGCAAATCCTTTACAGATTCCAATTACGAC
AGTAGACTTTCTTCATCTCTGCAACCATCCAGCAATTCGGCCTTTTCCTC
CTTTCGAAACTTGGTCCATAAAAGAAGCTATCAATTTTCCGTGCGAAGTC
CTGATTGCAGGCAATTCTCGCAACTGAATAAAACCTTCCCAATGGGAGAC
AATATTGATTATAGAAATTACAAAAGCGTCGCTATGAAGACCAATGAAGA
TCTGAGGAAACCTCTGAAATTCCTTGACCAATCCGATCTGCCGTTATCGT
TTTCCACATCAGACCAATTCCTTATAAATCCGGACTTGGTGAAAAATGAG
CTCTCGTTCAATAGCAGCCCAATTTTCGAGTCAGAAGAGCTGTCAGACTC
GAATTTGATCCAGGTGAAGGAAGAACTGAAATCCAATTCCACTGGATGGT
GGAACCAGTCTCAGTTCGATTCCTGCAATCTCGATGCGTTGCCGTTGTGT
GAGAAACTGGAGCCGCTGGTCTCCTCGCCATTTCTAGGACTAGATAAGGA
ACAACAATGGGTTGACGAAGAGCTTAATTTAGAGGAGTTGGACAGCATTT
TAGGGTTGAGTTGAAACTGTGTGAGAGGAAACTCTCGTTGAAAATCTGTG
ATGATATATTTTGTTTAGATTCGACTGAAGGGGGTCGTTTCCTCGCCTAC
ACCTTATTGGTAACAATCTGCGATAATTTTTTCGATGGGTGATTTGATCC
GAATGTCCTTATTTTTATCATATATCTTTATCCGGTCAATTGTGATCCTT
GTGTACAGAATATTTTGGCGCATTTTCAACTGTTTTTAATGGTTTGTTAA
TTTTCTAATTATG
back to top

protein sequence of SMED30026881-orf-1

>SMED30026881-orf-1 ID=SMED30026881-orf-1|Name=SMED30026881-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=597bp
MPHCTRNVLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMNLN
KLTSQALPISPISASSMSCGKYVDLRQPYASDPSVRSDIICSWDQIDDST
RIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQI
LDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYLNQSSS
TSCPASSTTLGKPIYSQSSLYNDCYGSSNQCMSSFSQLSNTDSGHSSNLS
SCSRKSHSKSSTCSAHSNYNFTNRNPQQNQYFNQMKRQKSKYQNSIVPFN
IHSSYSQFQPHMNSNFLQDCNSDVRFCPSKNFYMNPAAISTPIGKANNAY
PSHFPHYPYFSMNGKARNRQMVESERFFSNNRQGIHRFGSNSRQNSSLFS
KSFTDSNYDSRLSSSLQPSSNSAFSSFRNLVHKRSYQFSVRSPDCRQFSQ
LNKTFPMGDNIDYRNYKSVAMKTNEDLRKPLKFLDQSDLPLSFSTSDQFL
INPDLVKNELSFNSSPIFESEELSDSNLIQVKEELKSNSTGWWNQSQFDS
CNLDALPLCEKLEPLVSSPFLGLDKEQQWVDEELNLEELDSILGLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000055dorsal stripe
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 132..149
score: 38.14
coord: 111..124
score: 58.11
coord: 155..172
score: 57.23
IPR001766Fork head domainSMARTSM00339forkneu4coord: 109..198
e-value: 2.9E-23
score: 93.3
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 111..193
e-value: 4.9E-24
score: 84.4
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 111..188
score: 24.432
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 99..202
e-value: 3.8E-27
score: 96.2
NoneNo IPR availablePANTHERPTHR45881FAMILY NOT NAMEDcoord: 31..198
NoneNo IPR availablePANTHERPTHR45881:SF2coord: 31..198
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 111..197