HORMA domain-containing protein

Overview
NameHORMA domain-containing protein
Smed IDSMED30026877
Length (bp)1619
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HORMA domain-containing protein (SMED30026877) t-SNE clustered cells

Violin plots show distribution of expression levels for HORMA domain-containing protein (SMED30026877) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HORMA domain-containing protein (SMED30026877) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HORMA domain-containing protein (SMED30026877) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026877

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30026877SMESG000066514.1 Contig82newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026877SMESG000066514.1 Contig82uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026877SMESG000066514.1 Contig4866newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026877SMESG000066514.1 Contig4866uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026877SMESG000035878.1 Contig82newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026877SMESG000035878.1 Contig82uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026877SMESG000075530.1 Contig4866newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026877SMESG000075530.1 Contig4866uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30026877SMESG000066514.1 SmedASXL_015454SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026877SMESG000066514.1 SmedASXL_015454SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30026877SMESG000066514.1 dd_Smed_v4_2201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026877SMESG000066514.1 dd_Smed_v4_2201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026877SMESG000066514.1 dd_Smed_v4_2201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30026877SMESG000066514.1 dd_Smed_v4_2201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026877SMESG000066514.1 dd_Smed_v4_2201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026877SMESG000066514.1 dd_Smed_v4_2201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026877SMESG000066514.1 dd_Smed_v4_2201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026877SMESG000066514.1 dd_Smed_v4_2201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026877SMESG000066514.1 dd_Smed_v4_2201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026877SMESG000066514.1 Contig10893newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026877SMESG000066514.1 Contig10893uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30026877SMESG000066514.1 dd_Smed_v6_2201_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30026877SMESG000066514.1 dd_Smed_v6_2201_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30026877SMESG000066514.1 dd_Smed_v6_2201_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HORMA domain-containing protein vs. Ensembl Human
Match: HORMAD1 (HORMA domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25245])

HSP 1 Score: 188.734 bits (478), Expect = 6.195e-54
Identity = 95/242 (39.26%), Postives = 145/242 (59.92%), Query Frame = 1
Query:   28 MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN 753
            M  A L +    + +FP   +TE QSLV +K+L AV++S I Y+R IFPE A+  ++L+ + +KILRED  CPG+++++ W+ GC+DAL + YL+ VV+  YT+ +DP T+ E Y FKF Y  +     +D  SK  S   +++  D      KK+++ L+R + +      PLP  V +TMKL YYDE+TP DY+P GF+  D  G   E E +   +G V T FH F++ + T++    N
Sbjct:    1 MATAQLQRTPMSALVFPNKISTEHQSLVLVKRLLAVSVSCITYLRGIFPECAYGTRYLDDLCVKILREDKNCPGSTQLVKWMLGCYDALQKKYLRMVVLAVYTNPEDPQTISECYQFKFKYTNNGPL--MDFISKNQSNESSMLSTD-----TKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFEGEPMYLNVGEVSTPFHIFKVKVTTERERMEN 235          
BLAST of HORMA domain-containing protein vs. Ensembl Human
Match: HORMAD2 (HORMA domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28383])

HSP 1 Score: 183.341 bits (464), Expect = 6.852e-53
Identity = 99/273 (36.26%), Postives = 159/273 (58.24%), Query Frame = 1
Query:   70 MFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGF-RHETETINAKLGHVETDFHSFRMILKTDK---VSFTNNYVKSSKSSNCNKPEFEKENETPVLNETRKITPNCSRTCSE 876
            +FP+  T E +SL  +KKLFA +IS I Y+R +FPE ++ ++HL+ + LKILRED KCPG+  +I W++GCFDAL++ YL+  V+  YTD    + V E Y FKF Y ++  ++  D+ S + S       N+D    IKK+++ L+R L +     +PLP  V +TMKL YY+ +TP DY+P GF+    + F   + E IN ++G V T FHS ++ + T+    +   NN  + + ++       + + E    +  +++   CS+  SE
Sbjct:   20 VFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGT-NNED----IKKASVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEGVNSHFLLFDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFVCSQQSSE 287          
BLAST of HORMA domain-containing protein vs. Ensembl Human
Match: HORMAD2 (HORMA domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28383])

HSP 1 Score: 183.341 bits (464), Expect = 6.852e-53
Identity = 99/273 (36.26%), Postives = 159/273 (58.24%), Query Frame = 1
Query:   70 MFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGF-RHETETINAKLGHVETDFHSFRMILKTDK---VSFTNNYVKSSKSSNCNKPEFEKENETPVLNETRKITPNCSRTCSE 876
            +FP+  T E +SL  +KKLFA +IS I Y+R +FPE ++ ++HL+ + LKILRED KCPG+  +I W++GCFDAL++ YL+  V+  YTD    + V E Y FKF Y ++  ++  D+ S + S       N+D    IKK+++ L+R L +     +PLP  V +TMKL YY+ +TP DY+P GF+    + F   + E IN ++G V T FHS ++ + T+    +   NN  + + ++       + + E    +  +++   CS+  SE
Sbjct:   20 VFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGT-NNED----IKKASVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEGVNSHFLLFDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFVCSQQSSE 287          
BLAST of HORMA domain-containing protein vs. Ensembl Human
Match: HORMAD1 (HORMA domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25245])

HSP 1 Score: 175.637 bits (444), Expect = 4.094e-49
Identity = 92/242 (38.02%), Postives = 141/242 (58.26%), Query Frame = 1
Query:   28 MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN 753
            M  A L +    + +FP   +TE QSLV +K+L AV++S I Y+R IFPE A+  ++L+ + +KILRED  CPG+++++ W+ GC+DAL + Y+       YT+ +DP T+ E Y FKF Y  +     +D  SK  S   +++  D      KK+++ L+R + +      PLP  V +TMKL YYDE+TP DY+P GF+  D  G   E E +   +G V T FH F++ + T++    N
Sbjct:    1 MATAQLQRTPMSALVFPNKISTEHQSLVLVKRLLAVSVSCITYLRGIFPECAYGTRYLDDLCVKILREDKNCPGSTQLVKWMLGCYDALQKKYV-------YTNPEDPQTISECYQFKFKYTNNGPL--MDFISKNQSNESSMLSTD-----TKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFEGEPMYLNVGEVSTPFHIFKVKVTTERERMEN 228          
BLAST of HORMA domain-containing protein vs. Ensembl Human
Match: HORMAD1 (HORMA domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25245])

HSP 1 Score: 119.398 bits (298), Expect = 1.313e-30
Identity = 62/167 (37.13%), Postives = 94/167 (56.29%), Query Frame = 1
Query:  253 SKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN 753
            +K+  W+ GC+DAL + YL+ VV+  YT+ +DP T+ E Y FKF Y  +     +D  SK  S   +++  D      KK+++ L+R + +      PLP  V +TMKL YYDE+TP DY+P GF+  D  G   E E +   +G V T FH F++ + T++    N
Sbjct:    5 NKISRWMLGCYDALQKKYLRMVVLAVYTNPEDPQTISECYQFKFKYTNNGPL--MDFISKNQSNESSMLSTD-----TKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFEGEPMYLNVGEVSTPFHIFKVKVTTERERMEN 164          
BLAST of HORMA domain-containing protein vs. Ensembl Celegans
Match: him-3 (High Incidence of Males (Increased X chromosome loss); Meiotic chromosome core protein [Source:UniProtKB/TrEMBL;Acc:G5EBG0])

HSP 1 Score: 62.7734 bits (151), Expect = 1.308e-10
Identity = 53/207 (25.60%), Postives = 92/207 (44.44%), Query Frame = 1
Query:   22 NKMPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQD-----SVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGF 627
            +++P+A       W   FP     E+ S +F  +    A + I+  R I  E  F  + ++  KL +    S  P A +V +   G  DA+ + YL+   I FY    + D + E ++F+F YG +     S++  +D    +   L+A   + D  + +  ST+  L   I      +PLP+    + + + Y E  P DY P G+
Sbjct:   13 SEIPIA-----SQWKATFPVDLEIEKNSEMFALRYIKCASAFILDRRGILDEKCFKTRTID--KLLVTAFQSSVPAAKRVSSTFDGLRDAIQQGYLREFAIVFYKKPNEED-INEVFAFRFAYGDEGEIFVSLNNGIDTNESSQELLQAKFVDTDNTKQMFASTIKKLHRCI---KKMEPLPQGSDASFR-VSYTEKAPKDYTPEGY 207          
BLAST of HORMA domain-containing protein vs. Ensembl Celegans
Match: him-3 (High Incidence of Males (Increased X chromosome loss); Meiotic chromosome core protein [Source:UniProtKB/TrEMBL;Acc:G5EBG0])

HSP 1 Score: 62.7734 bits (151), Expect = 1.308e-10
Identity = 53/207 (25.60%), Postives = 92/207 (44.44%), Query Frame = 1
Query:   22 NKMPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQD-----SVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGF 627
            +++P+A       W   FP     E+ S +F  +    A + I+  R I  E  F  + ++  KL +    S  P A +V +   G  DA+ + YL+   I FY    + D + E ++F+F YG +     S++  +D    +   L+A   + D  + +  ST+  L   I      +PLP+    + + + Y E  P DY P G+
Sbjct:   13 SEIPIA-----SQWKATFPVDLEIEKNSEMFALRYIKCASAFILDRRGILDEKCFKTRTID--KLLVTAFQSSVPAAKRVSSTFDGLRDAIQQGYLREFAIVFYKKPNEED-INEVFAFRFAYGDEGEIFVSLNNGIDTNESSQELLQAKFVDTDNTKQMFASTIKKLHRCI---KKMEPLPQGSDASFR-VSYTEKAPKDYTPEGY 207          
BLAST of HORMA domain-containing protein vs. Ensembl Celegans
Match: htp-1 (Him-Three Paralog [Source:UniProtKB/TrEMBL;Acc:Q20305])

HSP 1 Score: 60.8474 bits (146), Expect = 8.769e-10
Identity = 57/231 (24.68%), Postives = 111/231 (48.05%), Query Frame = 1
Query:   52 EKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTD------SGLEAVIKNDDAPETIKKSTLSLLRTL-ILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETI-NAKLGHVETDFHSFRM 720
            +K WSK+FP I +   +S  FM +   VA S ++  R+I  +  +F K+    KLK +    + P ++++   +R   DA    +LK V +    +  D +  IE +S KF Y ++   V   +T K        + L  ++   +  ++++   ++++R++  L     +PLPE+     +L Y ++  P ++  +GF   D + F    + I +A +GH+    H+  M
Sbjct:   21 DKKWSKLFPRIVSDPDRSSNFMTRAIYVAFSAVLRNRNILGQ-EYFTKNYITEKLKCMTLCFRNPRSNQIAQLLRNAGDATKDGFLKEVSLVITNNEGDLE-AIEVFSMKFIYFENGGVVARLSTDKNGQEDPHFAKLAQLVY--EGGDSVRDQMVTIVRSVQFLCTKVLEPLPEEFTANFRLEYTND-APSNFRIDGFE--DSSTFYTLPDDIQSATIGHLRPGCHAANM 244          
BLAST of HORMA domain-containing protein vs. Ensembl Celegans
Match: htp-2 (Him-Three Paralog [Source:UniProtKB/TrEMBL;Acc:Q95XC8])

HSP 1 Score: 57.7658 bits (138), Expect = 9.342e-9
Identity = 55/229 (24.02%), Postives = 103/229 (44.98%), Query Frame = 1
Query:   52 EKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTY---GQDSVSVKLDNTSKTDSGLEAVIK-NDDAPETIKKSTLSLLRTL-ILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINA-KLGHVETDFHSFRM 720
            +KTWSK+FP+I +   +S  FM +   V  S ++  R+I  E  +F K+     L  +    K   A ++   +R   DA    +LK + +   T+       IE +S KF Y   G     +  DN  + D     + +   +  E+++   ++++R++  L     +PLP +     +L Y ++  P ++  +GF   D + F    + I +  +GH+    H+  M
Sbjct:   21 DKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNIL-EKEYFSKNYITENLSCMTLSFKNLRAHQIAQLLRAAGDATKDGFLKEISL-VVTEHDGDVEAIEVFSMKFIYFENGGVVARLSTDNNDQEDPHFAELAQLRYEGAESVRDQMVTIVRSVQFLCTKVLEPLPAEFTANFRLKYTND-APSNFRIDGFD--DSSTFYTLPDGIQSVTIGHLRPGHHAAHM 244          
BLAST of HORMA domain-containing protein vs. Ensembl Celegans
Match: set-26 (Histone-lysine N-methyltransferase set-26 [Source:UniProtKB/Swiss-Prot;Acc:Q9U263])

HSP 1 Score: 49.6766 bits (117), Expect = 5.790e-6
Identity = 20/52 (38.46%), Postives = 30/52 (57.69%), Query Frame = 1
Query:  871 SEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDIC 1026
            +EE + +RC CG +  DG  I CE CK WQH  C G+  +    + + C++C
Sbjct:  789 AEESWTMRCHCGMDHGDGDTIECEGCKTWQHMACMGLTLKSNTSK-YKCEMC 839          
BLAST of HORMA domain-containing protein vs. Ensembl Fly
Match: MBD-R2 (gene:FBgn0038016 transcript:FBtr0082611)

HSP 1 Score: 56.6102 bits (135), Expect = 5.423e-8
Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 1
Query:  877 EEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNLKATDIKLK 1071
            +E  + C C   ++DG+MI CE C  WQH  C GI++E  VP+ +VC IC   NP      ++ K
Sbjct:  914 QEEIINCICEYGEEDGLMIQCELCLCWQHGACNGIVKEADVPDKYVCYIC--RNPQRGRDSMRFK 976          
BLAST of HORMA domain-containing protein vs. Ensembl Fly
Match: upSET (gene:FBgn0036398 transcript:FBtr0333050)

HSP 1 Score: 52.7582 bits (125), Expect = 8.174e-7
Identity = 20/45 (44.44%), Postives = 27/45 (60.00%), Query Frame = 1
Query:  892 RCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDIC 1026
            RC C    DDG MI C+ C  WQH  C G I+   +PE ++C++C
Sbjct:  856 RCICELTHDDGYMICCDKCSAWQHVDCMG-IDRQNIPEEYMCELC 899          
BLAST of HORMA domain-containing protein vs. Ensembl Fly
Match: upSET (gene:FBgn0036398 transcript:FBtr0075768)

HSP 1 Score: 52.7582 bits (125), Expect = 8.174e-7
Identity = 20/45 (44.44%), Postives = 27/45 (60.00%), Query Frame = 1
Query:  892 RCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDIC 1026
            RC C    DDG MI C+ C  WQH  C G I+   +PE ++C++C
Sbjct:  856 RCICELTHDDGYMICCDKCSAWQHVDCMG-IDRQNIPEEYMCELC 899          
BLAST of HORMA domain-containing protein vs. Ensembl Fly
Match: ash1 (gene:FBgn0005386 transcript:FBtr0306009)

HSP 1 Score: 51.6026 bits (122), Expect = 2.035e-6
Identity = 33/104 (31.73%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  805 KENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNLKATDIKLKEFNED--RQEICLIR 1110
            KE ++P++       P      S +E  +RC CG  KD+G+MI C  C  WQH+ C    + D   + + C+ C    P     +I L+EF E+  R  + L+R
Sbjct: 1830 KERDSPIVPLKVTPPPLLPIEASPDEDVIRCICGLYKDEGLMIQCSKCMVWQHTEC---TKADIDADNYQCERC---EPREVDREIPLEEFTEEGHRYYLSLMR 1927          
BLAST of HORMA domain-containing protein vs. Ensembl Fly
Match: ash1 (gene:FBgn0005386 transcript:FBtr0306010)

HSP 1 Score: 51.6026 bits (122), Expect = 2.035e-6
Identity = 33/104 (31.73%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  805 KENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNLKATDIKLKEFNED--RQEICLIR 1110
            KE ++P++       P      S +E  +RC CG  KD+G+MI C  C  WQH+ C    + D   + + C+ C    P     +I L+EF E+  R  + L+R
Sbjct: 1830 KERDSPIVPLKVTPPPLLPIEASPDEDVIRCICGLYKDEGLMIQCSKCMVWQHTEC---TKADIDADNYQCERC---EPREVDREIPLEEFTEEGHRYYLSLMR 1927          
BLAST of HORMA domain-containing protein vs. Ensembl Zebrafish
Match: hormad1 (HORMA domain containing 1 [Source:NCBI gene;Acc:436630])

HSP 1 Score: 187.193 bits (474), Expect = 7.137e-54
Identity = 94/224 (41.96%), Postives = 138/224 (61.61%), Query Frame = 1
Query:   67 KMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDK 738
            +M P + + EQQSLV +KKL A+AIS+I Y+R +F E A+  K++  +K+ ILREDS CPGA ++++W++GCFDAL R YL+ V++  Y D  +P  V E Y FK  Y +     ++D  SK    L  +     A +  +KS++ L+R L +      PLP+ V + MKLLYYDE+TP +Y+P GF+  D      E E +N  +G V T FHS +M + T+K
Sbjct:   14 QMLPDVVSNEQQSLVLVKKLLAIAISSITYLRGLFSEKAYGRKYVGELKVYILREDS-CPGAQQIVHWLQGCFDALQRRYLRMVLLSIYCDPDNPQKVTECYQFKIKYTEKGP--QMDFESKNGQSLTKM-----ACDNTQKSSMLLVRKLYMLMQNLGPLPDDVCLNMKLLYYDEVTPQEYQPPGFKEDDNGTLMFEREPVNLTMGEVVTPFHSIKMNVTTEK 229          
BLAST of HORMA domain-containing protein vs. Ensembl Zebrafish
Match: zte38 (zebrafish testis-expressed 38 [Source:ZFIN;Acc:ZDB-GENE-060312-39])

HSP 1 Score: 164.851 bits (416), Expect = 3.671e-46
Identity = 87/250 (34.80%), Postives = 140/250 (56.00%), Query Frame = 1
Query:   91 TEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTNNYVKSSKSSNCNKPEFEKENETPVLNETR 840
            TE QSLVF+K++  +A+S+I Y+R IFPE ++  ++LE + +K+L++D   PGA K+I W+ GCFDAL++ YL+ +VIG +T   D + VIESY FKF Y +     ++D  S  +  +   +      E  KK++  L+R L L     + LP  V +TMKL Y D++TP +YEP GF+         E   ++ ++G +++ +H+ ++ +   +            S N      E E ETP L+  R
Sbjct:   21 TEAQSLVFVKRMVVIAVSSITYLRGIFPEDSYRSRYLEDLCIKVLKQDCSSPGAHKLIKWLMGCFDALEKRYLQMLVIGVHTSPHDSNHVIESYQFKFRYSEH--GPQMDILSNVNGDIRVTL------EDTKKASTLLIRKLFLLMQNLEALPTAVHLTMKLYYNDDVTPPEYEPPGFKAGANESLWFEGTAVHFRVGDLQSRYHTMKLRVTAAQSRLGKLQDGGQLSEN------EMEMETPSLHHIR 256          
BLAST of HORMA domain-containing protein vs. Ensembl Zebrafish
Match: phf20l1 (PHD finger protein 20 like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5837])

HSP 1 Score: 62.003 bits (149), Expect = 1.577e-9
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 1
Query:  886 FVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICAD 1032
             VRC C  ++++G MI CE C  WQHS+C G++ ED +PE ++C IC D
Sbjct:  821 IVRCICEMDEENGFMIQCEECMCWQHSVCMGLL-EDSIPEQYICYICRD 868          
BLAST of HORMA domain-containing protein vs. Ensembl Zebrafish
Match: phf20l1 (PHD finger protein 20 like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5837])

HSP 1 Score: 61.6178 bits (148), Expect = 1.824e-9
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 1
Query:  886 FVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICAD 1032
             VRC C  ++++G MI CE C  WQHS+C G++ ED +PE ++C IC D
Sbjct:  693 IVRCICEMDEENGFMIQCEECMCWQHSVCMGLL-EDSIPEQYICYICRD 740          
BLAST of HORMA domain-containing protein vs. Ensembl Zebrafish
Match: phf20a (PHD finger protein 20, a [Source:ZFIN;Acc:ZDB-GENE-070912-270])

HSP 1 Score: 58.5362 bits (140), Expect = 1.772e-8
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  775 SSNCNKPEFEKENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADAN 1038
            S +C   E E E +  V+      +   S T S+E   VRC C  ++++  M+ CE C  WQH  C G++EE+ VPE + C IC D++
Sbjct:  558 SESCGWSEDEMEADLDVITSPLSCSSVASTTESQE--TVRCVCEADEENDFMLQCEECLYWQHGTCMGLLEEN-VPERYSCFICRDSS 642          
BLAST of HORMA domain-containing protein vs. Ensembl Xenopus
Match: gstm1 (glutathione S-transferase mu 1 [Source:Xenbase;Acc:XB-GENE-971384])

HSP 1 Score: 162.54 bits (410), Expect = 1.380e-44
Identity = 86/223 (38.57%), Postives = 129/223 (57.85%), Query Frame = 1
Query:   70 MFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDK 738
            + P   TTE QSLV +K+L AV++S I Y+R +FPEYA+  ++LE I +KILRED  CPG+++++ W+ GC+DAL + Y                TV E Y FKF Y   +    +D  S  ++G    I +D     +K++++ L+R L +      PLP  V++TMKL YYDE+TP DY+P GF+  +  G   E E +   +G V T FH  ++ + T+K
Sbjct:   15 ILPNRVTTETQSLVLVKRLLAVSVSCITYLRGLFPEYAYGTRYLEDICVKILREDKSCPGSTQLVKWMLGCYDALQKKY----------------TVTECYQFKFKY--TAFGPTMDFVS--NNGSSTSICSD-----VKRTSVMLIRKLYVLMQNLGPLPNDVYLTMKLFYYDEVTPADYQPPGFKEGNCEGLMFEGEPMYLNVGEVATPFHVLKVKVTTEK 212          
BLAST of HORMA domain-containing protein vs. Ensembl Xenopus
Match: PHF20L1 (PHD finger protein 20 like 1 [Source:NCBI gene;Acc:100145157])

HSP 1 Score: 60.4622 bits (145), Expect = 5.688e-9
Identity = 25/49 (51.02%), Postives = 34/49 (69.39%), Query Frame = 1
Query:  886 FVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICAD 1032
             VRC C  ++++G MI CE C  WQHS C G++EE  +PE +VC IC+D
Sbjct:  559 IVRCVCEIDEENGFMIQCEECLCWQHSACMGLLEES-IPEQYVCYICSD 606          
BLAST of HORMA domain-containing protein vs. Ensembl Xenopus
Match: PHF20L1 (PHD finger protein 20 like 1 [Source:NCBI gene;Acc:100145157])

HSP 1 Score: 60.077 bits (144), Expect = 7.250e-9
Identity = 25/49 (51.02%), Postives = 34/49 (69.39%), Query Frame = 1
Query:  886 FVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICAD 1032
             VRC C  ++++G MI CE C  WQHS C G++EE  +PE +VC IC+D
Sbjct:  571 IVRCVCEIDEENGFMIQCEECLCWQHSACMGLLEES-IPEQYVCYICSD 618          
BLAST of HORMA domain-containing protein vs. Ensembl Xenopus
Match: PHF20 (PHD finger protein 20 [Source:NCBI gene;Acc:100126218])

HSP 1 Score: 54.6842 bits (130), Expect = 3.336e-7
Identity = 23/49 (46.94%), Postives = 29/49 (59.18%), Query Frame = 1
Query:  886 FVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICAD 1032
             VRC C    ++  MI CE C  WQH +C G++ ED VPE + C IC D
Sbjct:  634 IVRCMCEVQDENDFMIQCEECLCWQHGVCMGLL-EDNVPEKYKCYICQD 681          
BLAST of HORMA domain-containing protein vs. Ensembl Xenopus
Match: KMT2E (lysine (K)-specific methyltransferase 2E [Source:NCBI gene;Acc:779539])

HSP 1 Score: 51.9878 bits (123), Expect = 1.759e-6
Identity = 20/46 (43.48%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  889 VRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDIC 1026
             RC CG   DDG MI C+ C  WQH  C G I+   +P++++C+ C
Sbjct:   99 TRCICGFTHDDGYMICCDKCSVWQHIDCMG-IDRQNIPDIYLCERC 143          
BLAST of HORMA domain-containing protein vs. Ensembl Mouse
Match: Hormad2 (HORMA domain containing 2 [Source:MGI Symbol;Acc:MGI:1923078])

HSP 1 Score: 183.341 bits (464), Expect = 4.872e-53
Identity = 91/224 (40.62%), Postives = 140/224 (62.50%), Query Frame = 1
Query:   70 MFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKT-DSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGF-RHETETINAKLGHVETDFHSFRMILKTD 735
            +FP+  T E +SLV +KKLFA  IS I Y+R +FPE ++ D+ L+ + LKILRED KCPG+  +I W++GCFDAL++ YL   V+  YT+ K+P+ V E Y F+F Y +   ++  D++S + +SG ++        E IKK+   L+R L +      PLP  V +TMKL YY+ +TP DY+P GF+    + F   E E ++ ++G V + FHS ++ + T+
Sbjct:   20 IFPSQVTNEHESLVVVKKLFATCISCITYLRGLFPESSYRDRRLDDLSLKILREDKKCPGSLHIIKWIQGCFDALEKRYLHMAVLTLYTNPKEPEKVTEIYQFRFKYTKKGTTMDFDSSSTSFESGTDS--------EDIKKACSLLIRQLYILMQNLGPLPNDVILTMKLHYYNSVTPHDYQPPGFKEAVNSHFLLFEGEPVSLRMGSVSSGFHSMKVKVTTE 235          
BLAST of HORMA domain-containing protein vs. Ensembl Mouse
Match: Hormad2 (HORMA domain containing 2 [Source:MGI Symbol;Acc:MGI:1923078])

HSP 1 Score: 183.341 bits (464), Expect = 4.872e-53
Identity = 91/224 (40.62%), Postives = 140/224 (62.50%), Query Frame = 1
Query:   70 MFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKT-DSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGF-RHETETINAKLGHVETDFHSFRMILKTD 735
            +FP+  T E +SLV +KKLFA  IS I Y+R +FPE ++ D+ L+ + LKILRED KCPG+  +I W++GCFDAL++ YL   V+  YT+ K+P+ V E Y F+F Y +   ++  D++S + +SG ++        E IKK+   L+R L +      PLP  V +TMKL YY+ +TP DY+P GF+    + F   E E ++ ++G V + FHS ++ + T+
Sbjct:   20 IFPSQVTNEHESLVVVKKLFATCISCITYLRGLFPESSYRDRRLDDLSLKILREDKKCPGSLHIIKWIQGCFDALEKRYLHMAVLTLYTNPKEPEKVTEIYQFRFKYTKKGTTMDFDSSSTSFESGTDS--------EDIKKACSLLIRQLYILMQNLGPLPNDVILTMKLHYYNSVTPHDYQPPGFKEAVNSHFLLFEGEPVSLRMGSVSSGFHSMKVKVTTE 235          
BLAST of HORMA domain-containing protein vs. Ensembl Mouse
Match: Hormad1 (HORMA domain containing 1 [Source:MGI Symbol;Acc:MGI:1915231])

HSP 1 Score: 184.496 bits (467), Expect = 1.185e-52
Identity = 91/233 (39.06%), Postives = 139/233 (59.66%), Query Frame = 1
Query:   70 MFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQ-----DSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN 753
            +FP   +TE QSL+F+K+L AV++S I Y+R IFPE A+  ++L+ + +KIL+ED  CPG+S+++ W+ GC+DAL + YL+ +++  YT+  DP T+ E Y FKF Y +     D +S   +N S T S               KK+++ L+R + +      PLP  V +TMKL YYDE+TP DY+P GF+  D  G   + +     +G V T FH+FR+ + T+K    N
Sbjct:   16 VFPNKISTEHQSLMFVKRLLAVSVSCITYLRGIFPERAYGTRYLDDLCVKILKEDKNCPGSSQLVKWMLGCYDALQKKYLRMIILAVYTNPGDPQTISECYQFKFKYTKNGPIMDFISKNQNNKSSTTSA------------DTKKASILLIRKIYVLMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFDGDPTYLNVGEVPTPFHTFRLKVTTEKERMEN 236          
BLAST of HORMA domain-containing protein vs. Ensembl Mouse
Match: Hormad1 (HORMA domain containing 1 [Source:MGI Symbol;Acc:MGI:1915231])

HSP 1 Score: 184.496 bits (467), Expect = 1.185e-52
Identity = 91/233 (39.06%), Postives = 139/233 (59.66%), Query Frame = 1
Query:   70 MFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQ-----DSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN 753
            +FP   +TE QSL+F+K+L AV++S I Y+R IFPE A+  ++L+ + +KIL+ED  CPG+S+++ W+ GC+DAL + YL+ +++  YT+  DP T+ E Y FKF Y +     D +S   +N S T S               KK+++ L+R + +      PLP  V +TMKL YYDE+TP DY+P GF+  D  G   + +     +G V T FH+FR+ + T+K    N
Sbjct:   16 VFPNKISTEHQSLMFVKRLLAVSVSCITYLRGIFPERAYGTRYLDDLCVKILKEDKNCPGSSQLVKWMLGCYDALQKKYLRMIILAVYTNPGDPQTISECYQFKFKYTKNGPIMDFISKNQNNKSSTTSA------------DTKKASILLIRKIYVLMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFDGDPTYLNVGEVPTPFHTFRLKVTTEKERMEN 236          
BLAST of HORMA domain-containing protein vs. Ensembl Mouse
Match: Hormad1 (HORMA domain containing 1 [Source:MGI Symbol;Acc:MGI:1915231])

HSP 1 Score: 184.496 bits (467), Expect = 1.185e-52
Identity = 91/233 (39.06%), Postives = 139/233 (59.66%), Query Frame = 1
Query:   70 MFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQ-----DSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN 753
            +FP   +TE QSL+F+K+L AV++S I Y+R IFPE A+  ++L+ + +KIL+ED  CPG+S+++ W+ GC+DAL + YL+ +++  YT+  DP T+ E Y FKF Y +     D +S   +N S T S               KK+++ L+R + +      PLP  V +TMKL YYDE+TP DY+P GF+  D  G   + +     +G V T FH+FR+ + T+K    N
Sbjct:   16 VFPNKISTEHQSLMFVKRLLAVSVSCITYLRGIFPERAYGTRYLDDLCVKILKEDKNCPGSSQLVKWMLGCYDALQKKYLRMIILAVYTNPGDPQTISECYQFKFKYTKNGPIMDFISKNQNNKSSTTSA------------DTKKASILLIRKIYVLMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFDGDPTYLNVGEVPTPFHTFRLKVTTEKERMEN 236          
BLAST of HORMA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2KIY6|HORM1_BOVIN (HORMA domain-containing protein 1 OS=Bos taurus OX=9913 GN=HORMAD1 PE=2 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 2.630e-54
Identity = 97/242 (40.08%), Postives = 146/242 (60.33%), Query Frame = 1
Query:   28 MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN 753
            M  A L +    + +FP   +TEQQSLV +K+L AV++S I Y+R IFPE A+  ++L+ + +KILRED  CPG+++++ W+ GC+DAL + YL+ VV+  YT+ +DP T+ E Y FKF Y  +     +D TSK  S    +   D      KK+++ L+R + +      PLP  V +TMKL YYDE+TP DY+P GF+  D  G   E E +   +G V T FH+F++ + T++    N
Sbjct:    1 MATAQLQRTSMSALIFPNKISTEQQSLVLVKRLLAVSVSCITYLRGIFPECAYGTRYLDDLCVKILREDKNCPGSTQLVKWMLGCYDALHKKYLRMVVLAVYTNPEDPQTISECYQFKFKYTSNGPV--MDFTSKNQSNEPNMSSAD-----TKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFEGEPMYLNVGEVPTPFHTFKVKVTTERERMEN 235          
BLAST of HORMA domain-containing protein vs. UniProt/SwissProt
Match: sp|A6QQY4|HORM2_BOVIN (HORMA domain-containing protein 2 OS=Bos taurus OX=9913 GN=HORMAD2 PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.805e-54
Identity = 89/223 (39.91%), Postives = 141/223 (63.23%), Query Frame = 1
Query:   70 MFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFR-TCDYAGFRHETETINAKLGHVETDFHSFRMILKTD 735
            +FP+  T E +SL+ +KKLFA +IS I Y+R +FPE ++ ++HL+ + LKILRED KCPG+  +I W++GCFDAL++ YL+  V+  YT+ K+P+ V E Y FKF Y ++  ++  D+++ +        K+    E IKK+++ L+R L +      PLP  V +TM L YY+ +TP+DY+P GF+          E E +N ++G V T FHS ++ + T+
Sbjct:   20 VFPSQITNEHESLIMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHIIKWIQGCFDALEKRYLRMAVLTLYTNPKEPEKVTEIYQFKFKYTKEGATMDFDSSNTS-------FKSGTNSEDIKKASVLLIRKLYMLMQNLGPLPNDVILTMTLHYYNAVTPNDYQPPGFKEGVSSHLLLFEGEPVNLQVGMVSTGFHSMKVKVTTE 235          
BLAST of HORMA domain-containing protein vs. UniProt/SwissProt
Match: sp|E2IUK4|HORM1_PIG (HORMA domain-containing protein 1 OS=Sus scrofa OX=9823 GN=HORMAD1 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.438e-53
Identity = 99/244 (40.57%), Postives = 147/244 (60.25%), Query Frame = 1
Query:   28 MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTNNY 759
            M  A L +    + +FP   +TEQQSLV +K+L AV++S I Y+R IFPE A+  ++L+ + +KILRED  CPG+++++ W+ GC+DAL + YL+ VV+  YT+ +DP T+ E Y FKF Y   S    +D  SK  S   ++   D      KK+++ L+R + +      PLP  V +TMKL YYDE+TP DY+P GF+  D  G   E E +   +G V T FH+F++ + T+K    N Y
Sbjct:    1 MATAQLQRTSMSALVFPNKISTEQQSLVLVKRLLAVSVSCITYLRGIFPECAYGTRYLDDLCVKILREDKNCPGSTQLVKWMLGCYDALQKKYLRMVVLAVYTNPEDPQTISECYQFKFKYT--SNGPIMDFISKNQSSESSMSSAD-----TKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFEGEPMYLNVGEVPTPFHTFKVKVTTEKERMENIY 237          
BLAST of HORMA domain-containing protein vs. UniProt/SwissProt
Match: sp|E2RSQ2|HORM1_CANLF (HORMA domain-containing protein 1 OS=Canis lupus familiaris OX=9615 GN=HORMAD1 PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.568e-53
Identity = 97/242 (40.08%), Postives = 146/242 (60.33%), Query Frame = 1
Query:   28 MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN 753
            M  A L +    + +FP   +TEQQSLV +K+L AV++S I Y+R IFPE A+  ++L+ + +KILRED  CPG+++++ W+ GC+DAL + YL+ VV+  YT+ +DP T+ E Y FKF Y  +     +D  SK  S   ++   D      KK+++ L+R + +      PLP  V +TMKL YYDE+TP DY+P GF+  D  G   E E +   +G V T FH+F++ + T+K    N
Sbjct:    1 MATAQLQRTSMSALVFPNKISTEQQSLVLVKRLLAVSVSCITYLRGIFPECAYGTRYLDDLCVKILREDKNCPGSTQLVKWMLGCYDALQKKYLRMVVLAVYTNPEDPQTISECYQFKFKYASNGPV--MDFISKNQSSESSMSSAD-----TKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFEGEPMYLNVGEVPTPFHTFKVKVTTEKERMEN 235          
BLAST of HORMA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86X24|HORM1_HUMAN (HORMA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=HORMAD1 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.975e-53
Identity = 95/242 (39.26%), Postives = 145/242 (59.92%), Query Frame = 1
Query:   28 MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN 753
            M  A L +    + +FP   +TE QSLV +K+L AV++S I Y+R IFPE A+  ++L+ + +KILRED  CPG+++++ W+ GC+DAL + YL+ VV+  YT+ +DP T+ E Y FKF Y  +     +D  SK  S   +++  D      KK+++ L+R + +      PLP  V +TMKL YYDE+TP DY+P GF+  D  G   E E +   +G V T FH F++ + T++    N
Sbjct:    1 MATAQLQRTPMSALVFPNKISTEHQSLVLVKRLLAVSVSCITYLRGIFPECAYGTRYLDDLCVKILREDKNCPGSTQLVKWMLGCYDALQKKYLRMVVLAVYTNPEDPQTISECYQFKFKYTNNGPL--MDFISKNQSNESSMLSTD-----TKKASILLIRKIYILMQNLGPLPNDVCLTMKLFYYDEVTPPDYQPPGFKDGDCEGVIFEGEPMYLNVGEVSTPFHIFKVKVTTERERMEN 235          
BLAST of HORMA domain-containing protein vs. TrEMBL
Match: A0A3Q0KSN1 (HORMA domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 6.731e-108
Identity = 205/536 (38.25%), Postives = 294/536 (54.85%), Query Frame = 1
Query:   28 MPVALLTKEK--TWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKD--PD-----TVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTNNYVKSSKSSNCNKPEFE---------KENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNL----KATDIKLKEFN-EDRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINVGKGVFHTLLKEGAL--VNPKRKTK---NKGCDLIYCFYNNFFRLSKVVDKVALESLVLNKYFNSVVENNSPAKRKRKIDEVNLSKFTDNMSINENNLNFAIASQDSLIVEKCNKRRKGGIATTPV 1551
            M  A+  K+    WSKMFP     E QSLVF+KKLFAVA+S ++Y R IFPE AF DK LEGI+LKIL+E S  P +SK++ W++GCFDA+DRH+LK+  I  Y+  KD  P       +IESY F+ +YGQ+ +S+ L   +K +S     I +    E  +K+TLSLL+ +  AG     LP ++ +TMKL YYDE+TP+ Y P GF+  D   F  E + IN +LG+V+T  HS +M ++T +   + + VKS+KS+  ++   E         K NE   L+ + +     S     E +  RCPCG NKDDG+MI+C+ C  WQH++CF I++E  VP  HVC+ICA   P L      TD  ++  + E R+  CL RR L  C + D + P  +A  LG+E  V +G+F+ L+KE  +    P+R  K    +  + I C    FF  + + DK ++ S  +           +P KR       + SK T     +E        SQD       +KRRK  +A TP+
Sbjct:    1 MATAVAVKQNIGNWSKMFPNELGVEIQSLVFIKKLFAVAVSYVLYFRDIFPESAFHDKQLEGIELKILKESSMLPASSKIVYWLKGCFDAIDRHFLKSATIALYSADKDLHPSEFCEYNIIESYCFRLSYGQEKLSLDLKTENKRESSTLCEISDFSEIEA-RKATLSLLKNIQTAGERLSKLPSELMITMKLQYYDEVTPESYVPPGFKRADNVSFNFEEDNINIRLGNVKTAHHSIKMHIQTSRRLLSGS-VKSTKSTQEDESIHELSLGSLNASKVNENDDLSLSFQQQTLVSDENESESYEARCPCGVNKDDGVMILCDGCDKWQHAVCFRILQEGDVPTSHVCEICAKLKPELLRTGGTTDETIQNLSVEARKATCLFRRVLALCLNEDSVSPAFIARSLGIEYTVARGLFNRLIKEQVIKGAGPRRGEKLVEKEYLENIVC--PRFFSHNSLHDKTSMVSPQMLTAQKPTTIRRTPGKRAH-----DASKSTSEKEYDE----LFNPSQDYRASPTTSKRRKMDMANTPI 523          
BLAST of HORMA domain-containing protein vs. TrEMBL
Match: A0A5K4EXM2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 8.962e-108
Identity = 203/534 (38.01%), Postives = 295/534 (55.24%), Query Frame = 1
Query:   28 MPVALLTKEK--TWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKD--PD-----TVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTNNYVKSSKSSNCNKPEFE---------KENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNL----KATDIKLKEFN-EDRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINVGKGVFHTLLKEGAL--VNPKRKTKNKGCDLIYCFYNNFFRLSKVVDKVALESLVLNKYF-NSVVENNSPAKRKRKIDEVNLSKFTDNMSINENNLNFAIASQDSLIVEKCNKRRKGGIATTPV 1551
            M  A+  K+    WSKMFP     E QSLVF+KKLFAVA+S ++Y R IFPE AF DK LEGI+LKIL+E S  P +SK++ W++GCFDA+DRH+LK+  I  Y+  KD  P       +IESY F+ +YGQ+ +S+ L   +K +S     I +    E  +K+TLSLL+ +  AG     LP ++ +TMKL YYDE+TP+ Y P GF+  D   F  E + IN +LG+V+T  HS +M ++T +   + + VKS+KS+  ++   E         K NE   L+ + +     S     E +  RCPCG NKDDG+MI+C+ C  WQH++CF I++E  VP  HVC+ICA   P L      TD  ++  + E R+  CL RR L  C + D + P  +A  LG+E  V +G+F+ L+KE  +    P+R                     K+V+K  LE++V  ++F ++ + + +  KR       + SK T     +E        SQD       +KRRK  +A TP+
Sbjct:    1 MATAVAVKQNIGNWSKMFPNELGVEIQSLVFIKKLFAVAVSYVLYFRDIFPESAFHDKQLEGIELKILKESSMLPASSKIVYWLKGCFDAIDRHFLKSATIALYSADKDLHPSEFCEYNIIESYCFRLSYGQEKLSLDLKTENKRESSTLCEISDFSEIEA-RKATLSLLKNIQTAGERLSKLPSELMITMKLQYYDEVTPESYVPPGFKRADNVSFNFEEDNINIRLGNVKTAHHSIKMHIQTSRRLLSGS-VKSTKSTQEDESIHELSLGSLNASKVNENDDLSLSFQQQTLVSDENESESYEARCPCGVNKDDGVMILCDGCDKWQHAVCFRILQEGDVPTSHVCEICAKLKPELLRTGGTTDETIQNLSVEARKATCLFRRVLALCLNEDSVSPAFIARSLGIEYTVARGLFNRLIKEQVIKGAGPRRG-------------------EKLVEKEYLENIVCPRFFSHNSLHDKTSMKRAH-----DASKSTSEKEYDE----LFNPSQDYRASPTTSKRRKMDMANTPI 504          
BLAST of HORMA domain-containing protein vs. TrEMBL
Match: A0A504YP75 (HORMA domain-containing protein 2 OS=Fasciola gigantica OX=46835 GN=FGIG_01587 PE=4 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 2.094e-104
Identity = 208/551 (37.75%), Postives = 315/551 (57.17%), Query Frame = 1
Query:   28 MPVALLTKE--KTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFY----------TDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN---------NYVKSSKSS-----------NCNKPEFEKENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNL----KATDIKLKEFN-EDRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINVGKGVFHTLLKEGAL--VNPKRKTKNKGCDLI--YCFYNNFFRLSKVVDKVALESLVLNKY-FNSVVENNS-PAKRKRKIDEVNLSKFTDNMSINENNLNFAIASQDSLIVEKCNKRRKGGIATTPV 1551
            M  A+  KE   +WS++FPT   TE  SLVF+KKLFAVA+S ++Y+R +FPE AFFDK LEG++LKILRED K P +SKV+ W+RGCFDA+DR +LK+ +I  Y          TD +D   +IESYSFK TY   S+S+++ +T++  S     + N  + E IK++T++LL T+  A +    +PE +F+TM+L Y++E TP+DY P GFR  D   F  +   +N ++G+V+T FHS +M ++T+    +N         N ++ S+ S             +K   E E  + +  ++ +     S T   E + VRCPCG NKDDG+MI+C+ C  WQH++CF I+EE  VP  H+C++C  + PNL      TDI L+    E+R+  CL+RRA++ C S D + P  +A  L V+    +G+F+ L+KEGAL    PKR  K    + +    F   F   SK + +V LES   N+   NS     S P+   R+     L    ++   ++ +   + A +DS +  +  +R++ GIA TP+
Sbjct:    1 MATAVAAKEIVGSWSRLFPTELGTEVYSLVFVKKLFAVAVSYVLYLRRLFPENAFFDKQLEGVRLKILREDVKFPSSSKVVYWLRGCFDAIDRQFLKSAIITLYSQDQSDGISKTDYEDCK-IIESYSFKLTYANSSISLQVLSTNEESSSSTFKLSN-GSNEDIKRATINLLGTIRSACSKLRRIPENLFMTMRLQYFEETTPEDYIPPGFRAADDITFLFDGNPVNLRIGNVQTAFHSIKMNIQTNSEFLSNFKGISLNVDNNIELSQQSVDLDEEVAGVQTQSKSALEDELSSSLRQQSLQ-----SETDQSEMYDVRCPCGVNKDDGVMILCDGCGMWQHAVCFRILEEKDVPSSHICELCCVSKPNLLLDGGLTDITLQGITKENRKSQCLLRRAVLLCASLDSVSPSLIAKNLEVDYTTARGIFNRLVKEGALKDAGPKRGEKLVQKEFLETVVFGRVFQTDSKQLGEV-LESRDANQSPKNSNTPTTSHPSATMRRTPRRKLETPCESFLESQLDCRESQAPEDSPV--QVKRRKRSGIANTPI 541          
BLAST of HORMA domain-containing protein vs. TrEMBL
Match: A0A4Z2CM86 (HORMA domain-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_009285 PE=4 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 8.903e-103
Identity = 205/538 (38.10%), Postives = 298/538 (55.39%), Query Frame = 1
Query:   28 MPVALLTKEK--TWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDT------VIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTNNYVKSSKSSNCNKPEFE---------KENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNL----KATDIKLKEFN-EDRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINVGKGVFHTLLKEGAL--VNPKRKTK---NKGCDLIYCFYNNFFRLSKVVDKVALESLVLNKYFN---SVVENNSPAKRKRKIDEVNLSKFTDNMSINENNLNFAIASQDSLIVEKCNKRRKGGIATTPV 1551
            M  AL  K+    WSKMFP     E QSLVF+KKLFAVA+S ++Y R IFPE AF DK LEGI+LKIL+E S  P +SK++ W++GCFDA+DR +LK+  I  Y+  KD  +      V ESY F+ +Y +  +S+ L + +K +      I N    E I+K+TL+LL+ + +A      LP ++ +TMKL YYDE+TP++Y P GF+  D   F  E + IN +LG+V T  HS +M ++T +   + + VKS++S+  ++   E         K NE   L+ + +     S     + +  RCPCG NKDDG+MI+C+ C  WQH++CF I+EE  VP  HVC+ICA   P L      TD  ++  N E R+  CL RRAL  C S D +    +A  LGVE  V +G+F+ L+KE  +    P+R  K    +  + I C    FF  + + +K++L ++V  +      S     +P KR       N SK T +   +E    F   +QDS      +KR+K  +A TP+
Sbjct:    1 MATALEIKQNIGNWSKMFPNELGVELQSLVFIKKLFAVAVSYVLYFRDIFPESAFHDKQLEGIELKILKESSILPASSKIVYWLKGCFDAIDRQFLKSATIALYSTKKDSHSNICEYNVFESYCFRLSYCRKKLSLDLTSENKREPSSVCEISNCSEAE-IRKATLNLLKNIQIASERLSKLPPELMITMKLQYYDEVTPENYVPPGFKRADDVTFTFEEDNINVRLGNVRTVHHSIKMHIQTSRRLLSGS-VKSTQSTQEDESIHELSLCSLGTSKANEKDDLSLSFQQQTLRSNENESQIYEARCPCGVNKDDGVMILCDGCDKWQHAVCFRILEEGDVPTSHVCEICAKLKPELLQAGGITDETIQNLNVEARKATCLFRRALALCLSEDSVSSAFIARSLGVEYTVARGLFNRLIKEQVVKGQGPRRGEKLVEKEYLENIIC--PRFFSCTSLEEKLSLGTMVSPQLLTPQKSTAALRTPGKRA-----YNASKSTVDKECDE----FFHYNQDSE-TSPSSKRKKMDMANTPI 524          
BLAST of HORMA domain-containing protein vs. TrEMBL
Match: A0A2C9KAD6 (HORMA domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052935 PE=4 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 9.184e-103
Identity = 182/426 (42.72%), Postives = 241/426 (56.57%), Query Frame = 1
Query:   55 KTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKT------------------DKVSFTNNYVKSSKSSNCNKPEFEKENETPVLN----ETRKITPNCSRT--------CSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICAD-ANPNLKATDIKLKEF-NEDRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINVGKGVFHTLLKEGALV 1236
            KTW  +FP    TEQ+S +F+KKL AVAISNI Y+R+IFPE+A+ DK LE + LKILR++S CPGA +VI WV+GCFDALD+ YLK ++IG Y D  DP++VIESY+FKF+Y          N  K  S   +        E  KK+T+ LLRTL++  NT   LP+ V +TMKL YYDE+TP DYEP GFR  + + F    E  N  +G V T FH  ++ +KT                  D+V   +N    ++S+   +   EK      LN      +K++P    +          EE F VRCPCG N+DDG+M+MC  CK WQH ICF I  ED+ P  H+CD+CA   N  L+ TD  L      +RQ  CL RR L  C     I   QL+  LG++ NV +G+ + L KE  L+
Sbjct:   13 KTWESIFPNEQVTEQKSALFVKKLLAVAISNITYLRAIFPEHAYGDKSLEDLNLKILRDESSCPGACQVIKWVKGCFDALDKKYLKTLIIGIYIDPNDPESVIESYTFKFSYNNHGEIDIYRNDKKVSSAYSS--------EETKKATIRLLRTLVILTNTLTSLPDNVMMTMKLFYYDEVTPADYEPPGFRPANDSAFHFAEEATNIAIGEVVTPFHMVKLRIKTGSKQFEFEDEPVEVMEHSDQVMSISNAGLDNESNMLQEITSEKAKSVSALNIELKGDKKLSPTQPDSKKSPGKPKPDEENFLVRCPCGCNEDDGLMVMCSCCKFWQHGICFLIKSEDKAPTDHICDVCAKPGNAKLEPTDSYLSSLCTVERQGTCLWRRTLSACLEYKRIIAPQLSRRLGIDNNVAQGLINRLEKEKFLI 430          
BLAST of HORMA domain-containing protein vs. Ensembl Cavefish
Match: hormad1 (HORMA domain containing 1 [Source:NCBI gene;Acc:103046361])

HSP 1 Score: 189.504 bits (480), Expect = 3.353e-55
Identity = 92/225 (40.89%), Postives = 140/225 (62.22%), Query Frame = 1
Query:   64 SKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDK 738
            S+M P +  TEQQSLV +KKL A+A+S+I Y+R +FPE A+  K++E  K+ ILRE   CPGAS+++ W++GCFDAL + YL+ +++  Y+D + P  V E Y F+  Y +     +LD  SK    +  +  ND     IKK+++ L+R L        PLP+ V + MKL YYDE+TP+DY+P GF+  + +    E E +N  +G V T FH+ ++ + T+K
Sbjct:   14 SQMLPRVVATEQQSLVVVKKLLAIAVSSITYLRGLFPEKAYGSKYIEEQKVMILREQRTCPGASQIVQWLQGCFDALQKRYLRLILLSIYSDPEFPQKVTECYQFRIQYTEK--GPRLDFESKNQKRVTKMDCND-----IKKASILLVRKLYTLMQNLGPLPDSVCLNMKLSYYDEVTPEDYQPVGFKEGNNSTLVFEKEPVNLTMGEVVTPFHTLKVDVTTEK 231          
BLAST of HORMA domain-containing protein vs. Ensembl Cavefish
Match: hormad1 (HORMA domain containing 1 [Source:NCBI gene;Acc:103046361])

HSP 1 Score: 189.119 bits (479), Expect = 8.567e-55
Identity = 92/225 (40.89%), Postives = 140/225 (62.22%), Query Frame = 1
Query:   64 SKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDK 738
            S+M P +  TEQQSLV +KKL A+A+S+I Y+R +FPE A+  K++E  K+ ILRE   CPGAS+++ W++GCFDAL + YL+ +++  Y+D + P  V E Y F+  Y +     +LD  SK    +  +  ND     IKK+++ L+R L        PLP+ V + MKL YYDE+TP+DY+P GF+  + +    E E +N  +G V T FH+ ++ + T+K
Sbjct:   14 SQMLPRVVATEQQSLVVVKKLLAIAVSSITYLRGLFPEKAYGSKYIEEQKVMILREQRTCPGASQIVQWLQGCFDALQKRYLRLILLSIYSDPEFPQKVTECYQFRIQYTEK--GPRLDFESKNQKRVTKMDCND-----IKKASILLVRKLYTLMQNLGPLPDSVCLNMKLSYYDEVTPEDYQPVGFKEGNNSTLVFEKEPVNLTMGEVVTPFHTLKVDVTTEK 231          
BLAST of HORMA domain-containing protein vs. Ensembl Cavefish
Match: hormad1 (HORMA domain containing 1 [Source:NCBI gene;Acc:103046361])

HSP 1 Score: 189.119 bits (479), Expect = 1.291e-54
Identity = 92/225 (40.89%), Postives = 140/225 (62.22%), Query Frame = 1
Query:   64 SKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDK 738
            S+M P +  TEQQSLV +KKL A+A+S+I Y+R +FPE A+  K++E  K+ ILRE   CPGAS+++ W++GCFDAL + YL+ +++  Y+D + P  V E Y F+  Y +     +LD  SK    +  +  ND     IKK+++ L+R L        PLP+ V + MKL YYDE+TP+DY+P GF+  + +    E E +N  +G V T FH+ ++ + T+K
Sbjct:   14 SQMLPRVVATEQQSLVVVKKLLAIAVSSITYLRGLFPEKAYGSKYIEEQKVMILREQRTCPGASQIVQWLQGCFDALQKRYLRLILLSIYSDPEFPQKVTECYQFRIQYTEK--GPRLDFESKNQKRVTKMDCND-----IKKASILLVRKLYTLMQNLGPLPDSVCLNMKLSYYDEVTPEDYQPVGFKEGNNSTLVFEKEPVNLTMGEVVTPFHTLKVDVTTEK 231          
BLAST of HORMA domain-containing protein vs. Ensembl Cavefish
Match: zte38 (zebrafish testis-expressed 38 [Source:ZFIN;Acc:ZDB-GENE-060312-39])

HSP 1 Score: 174.866 bits (442), Expect = 4.855e-50
Identity = 85/222 (38.29%), Postives = 137/222 (61.71%), Query Frame = 1
Query:   61 WSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFR--TCDYAGFRHETETINAKLGHVETDFHSFRM 720
            W  +F     T++QSLVF+K++  +A+S+I Y+R IFPE A+  ++LE + +K++RED   P A + + W+ GCFDAL++ YL+ V+IG + D  D + VIESY FKF Y +    + +      ++ +E  +  +D     KK+++ L+R L L     D LP++V++TMKL YYD++TP DYEP GF+   CD   F  E   ++ ++G + T FH  ++
Sbjct:   23 WDSLFQQELRTQEQSLVFVKRMLVLAVSSITYLRGIFPEDAYRSRYLEDLCIKVIREDCSSPAACRTVKWMMGCFDALEKEYLQIVLIGVHRDPDDTNHVIESYQFKFKYSEHGPQMDI----LRNNSMEMSVTMEDT----KKASVLLIRKLFLLMQNLDALPDEVYLTMKLYYYDDVTPPDYEPPGFKEGVCDSLWF--EGTAVHFRVGDLHTPFHVLKV 234          
BLAST of HORMA domain-containing protein vs. Ensembl Cavefish
Match: phf20l1 (PHD finger protein 20 like 1 [Source:NCBI gene;Acc:103026102])

HSP 1 Score: 62.003 bits (149), Expect = 1.115e-9
Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 1
Query:  886 FVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICAD 1032
             VRC C  ++++G MI CE C  WQHS+C G++ ED +PE ++C IC D
Sbjct:  750 IVRCICEMDEENGFMIQCEECMCWQHSVCMGLL-EDSIPEQYICYICRD 797          
BLAST of HORMA domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009606.1 (pep scaffold:Pmarinus_7.0:GL481528:14094:14964:-1 gene:ENSPMAG00000008686.1 transcript:ENSPMAT00000009606.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 4.055e-17
Identity = 34/92 (36.96%), Postives = 53/92 (57.61%), Query Frame = 1
Query:  478 ETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTN 753
            E  K++T+ L+R L +     D +PE V +TMKL YYDE+TP+DY+P GFR         + +    ++GHV + FHS ++ +  D+    N
Sbjct:   15 EETKRATILLIRKLFVLMQHLDEMPEDVSLTMKLFYYDEVTPEDYQPPGFRASSTDPLNFQGDPATLRVGHVASTFHSMKLRITVDRSQVDN 106          
BLAST of HORMA domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004065.1 (pep scaffold:Pmarinus_7.0:GL479372:18838:35317:1 gene:ENSPMAG00000003707.1 transcript:ENSPMAT00000004065.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.868e-10
Identity = 24/49 (48.98%), Postives = 32/49 (65.31%), Query Frame = 1
Query:  886 FVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICAD 1032
             VRC CG N++ G MI CE C  WQHS+C G  EE+ +P+ + C +C D
Sbjct:  646 IVRCSCGINEETGFMIQCEMCSCWQHSVCMGFTEEN-IPDRYSCHVCQD 693          
BLAST of HORMA domain-containing protein vs. Ensembl Sea Lamprey
Match: kmt2e (lysine (K)-specific methyltransferase 2E [Source:ZFIN;Acc:ZDB-GENE-030131-4120])

HSP 1 Score: 54.6842 bits (130), Expect = 3.248e-8
Identity = 21/46 (45.65%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  889 VRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDIC 1026
             RC CG   DDG MI C+ C  WQH  C G I+  R+P+ ++C+ C
Sbjct:  117 TRCVCGFTHDDGYMICCDKCSVWQHIDCMG-IDRQRIPDTYLCEFC 161          
BLAST of HORMA domain-containing protein vs. Ensembl Yeast
Match: HOP1 (Meiosis-specific protein required for chromosome synapsis; displays Red1p dependent localization to the unsynapsed axial-lateral elements of the synaptonemal complex; required for chiasma formation; in vitro, displays the ability to promote intra- and intermolecular synapsis between double-stranded DNA molecules and to fold DNA into rigid protein-DNA filaments [Source:SGD;Acc:S000001334])

HSP 1 Score: 73.1738 bits (178), Expect = 3.537e-14
Identity = 90/422 (21.33%), Postives = 174/422 (41.23%), Query Frame = 1
Query:  100 QSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHL-----------------EGIKLKILREDSKCPGASKVINWV-RGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETI-----KKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDY---AGFRHETETINAKL--GHVETDFHSFRMILKTDKVSFTNNYVKSSKSSNCNKPEFE---KENETPVLNETRKITP----------------NCSRTCSEEEFFV---------RCPCGGN--KDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNLKATDIKLKEFNEDRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINV 1191
            QS   ++ +  ++   + ++R +FP+  F D+                     IK+K L    K   A  +++W+ +G F ++    LKA+ +G +  ++DP  ++E+Y F F Y +++      N S    G +     D   ETI     ++    L+R  I+   + +PLP+K F+TM+L++ D +  +DY+P  F+   +   A  +  T   N  +  G + T  H   + + +   + T++  K+  ++      F+   ++ E   L E+    P                N S+   +   FV          C CG    K   ++  C++C+   H IC+G      + +   C       P+L   D K  +F    Q++ +IR+   +        P  + +++   INV
Sbjct:   21 QSQKLLQTMLTMSFGCLAFLRGLFPDDIFVDQRFVPEKVEKNYNKQNTSQNNSIKIKTLIR-GKSAQADLLLDWLEKGVFKSIRLKCLKALSLGIF--LEDPTDLLENYIFSFDYDEENNVNINVNLSGNKKGSKNA---DPENETISLLDSRRMVQQLMRRFIIITQSLEPLPQKKFLTMRLMFNDNVD-EDYQPELFKDATFDKRATLKVPTNLDNDAIDVGTLNTKHHKVALSVLS---AATSSMEKAGNTNFIRVDPFDLILQQQEENKLEESVPTKPQNFVTSQTTNVLGNLLNSSQASIQPTQFVSNNPVTGICSCECGLEVPKAATVLKTCKSCRKTLHGICYGNFLHSSIEKCFTCIF----GPSL---DTKWSKF----QDLMMIRKVFRFLVRKKKGFPASITELIDSFINV 421          
BLAST of HORMA domain-containing protein vs. Ensembl Yeast
Match: SET3 (Defining member of the SET3 histone deacetylase complex; which is a meiosis-specific repressor of sporulation genes; necessary for efficient transcription by RNAPII; one of two yeast proteins that contains both SET and PHD domains; SET3 has a paralog, SET4, that arose from the whole genome duplication [Source:SGD;Acc:S000001737])

HSP 1 Score: 54.6842 bits (130), Expect = 2.798e-8
Identity = 19/47 (40.43%), Postives = 29/47 (61.70%), Query Frame = 1
Query:  886 FVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDIC 1026
             + C C  N DDG  I C++C  WQH+IC+GI +    P+ ++C+ C
Sbjct:  117 IITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSC 163          
BLAST of HORMA domain-containing protein vs. Ensembl Nematostella
Match: EDO47610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLI6])

HSP 1 Score: 234.572 bits (597), Expect = 1.698e-70
Identity = 154/453 (34.00%), Postives = 225/453 (49.67%), Query Frame = 1
Query:   46 TKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNG-------FRTCDYAGFRHETETINAKLGHVETDFHSFRMI---LKTDKV---SFTNNYVKSSKSSNCNKPEFEKENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNLKATDIKLKEFNE-DRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINVGKGVFHTLLKEGALVNPKRKTKNKGCDLIYCFYNNFFRLSKVVDKVALESLVLNKYF 1362
            +K  +WS +FP    TEQQS++F+KKL AVA+S++ Y+R+IFPE+AF D+ LE + LKIL++DS CPGA +VI W++GCFDALD+ YL+ +VIG Y D  DPDT+IESY+FK  +        LD      S ++  IK +     +K+       T + AG     L        + +  D   P D+  N        F   D             K    ++D  S +++   ++ DKV   S     ++ S      +   +   ETP + E  + T +           V C CG N+DDG+MIMC  CK W+H++C+GI++E++ P+ HVC  C       + TD  L E    + Q   L RRAL+ C     I P  ++  LGVE+ V  G+ + L KEG  V    K K               RL K+V+K  L+   L +Y 
Sbjct:   11 SKTVSWSSIFPPEQVTEQQSVLFVKKLLAVAVSSVSYLRAIFPEHAFGDRRLEDLNLKILKDDSACPGACQVIQWIKGCFDALDKKYLRMIVIGIYADADDPDTIIESYTFKNNH-------HLDTDPDITSRVKLRIKTELHQFELKEDDEEDDTTGVNAGG----LIRNNADVDEGMEEDSQMPLDHTDNTPVTHSREFEAVDDHTPPTTPTETTRKSAKRQSD--SQQVVPDGMECDKVPIESPNTPGLRGSAGGVSTRASSQPSGETPNIEEDMQKTDDT----------VSCACGYNEDDGLMIMCGICKFWEHAVCYGILQEEQAPDFHVCAKCCRKPGQPQCTDALLGELGSVELQAAALWRRALLACSEMSRILPTTMSRRLGVEMTVAHGLVNKLEKEG-FVRSAAKGK---------------RLGKIVNKTMLKEEELKEYI 424          
BLAST of HORMA domain-containing protein vs. Ensembl Nematostella
Match: EDO37170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGK9])

HSP 1 Score: 50.0618 bits (118), Expect = 1.992e-6
Identity = 20/48 (41.67%), Postives = 30/48 (62.50%), Query Frame = 1
Query:  889 VRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICAD 1032
            +RC C  +++ G MI CE C  WQHS C G+ E   VP  ++C +C++
Sbjct:  179 IRCRCNLSEEGGFMIQCEQCLTWQHSECVGLTEL-TVPSKYLCYVCSN 225          
BLAST of HORMA domain-containing protein vs. Ensembl Medaka
Match: hormad1 (HORMA domain-containing protein 1 [Source:NCBI gene;Acc:101155880])

HSP 1 Score: 167.933 bits (424), Expect = 5.376e-47
Identity = 85/237 (35.86%), Postives = 130/237 (54.85%), Query Frame = 1
Query:   28 MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDK 738
            M  A   K    +++ P    TEQQS+V +KKL A+A+S I Y+R IFP  A+  K++E  ++ IL     CPGA ++I+W++GCFDA+ + +L+ V++  Y D ++P  V E Y F+  Y   S    +D  S ++  L      +      KK+++ L+R L        PLPE V + MKL YYD++TP DY+P GFR  +      E E +   +G V T FH  +  + T+K
Sbjct:    1 MAFAQRVKSSQVTQLLPNEVVTEQQSIVVVKKLLAIAVSAITYLRGIFPGKAYGTKYVEDQQVMILTGGRSCPGADQIIDWMQGCFDAIQKKFLRTVIMSIYNDPENPQKVTEYYQFRIQY--TSNGAHMDFESNSNQKLSTTTYGN-----TKKASILLVRKLYTLMQNLGPLPENVCLNMKLTYYDDVTPQDYQPPGFREAEGDVLEFEKEPVKLTMGEVTTPFHCVKFDMATEK 230          
BLAST of HORMA domain-containing protein vs. Ensembl Medaka
Match: zte38 (HORMA domain-containing protein 1-like [Source:NCBI gene;Acc:101175349])

HSP 1 Score: 165.236 bits (417), Expect = 8.762e-47
Identity = 77/205 (37.56%), Postives = 126/205 (61.46%), Query Frame = 1
Query:  124 LFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDK 738
            + AVA+S+I Y+R IFPEYA+  ++L  + +K+L E+   PGASKV+ W+ G FDAL++ YL+ + IG YTD ++P+ +IE+Y F F Y +    + +      +  ++  ++N       K++++ L+R L L     D LP KV++TMKL YYD+ITP DY+P GF+   Y     E   ++ K+G V T +H+ R+ +  ++
Sbjct:    1 MMAVAVSSITYLRGIFPEYAYRSRYLADMCIKVLHENGNTPGASKVVKWLMGSFDALEKQYLQVISIGVYTDPENPNCIIEAYQFNFRYTEKGPEMNILRNKNVE--MQVTLEN------TKQASVLLIRKLFLLMQNLDALPNKVYLTMKLYYYDDITPADYQPPGFKEGVYDHLWFEGMPVHFKVGEVHTSYHALRVQVSVEQ 197          
BLAST of HORMA domain-containing protein vs. Ensembl Medaka
Match: hormad1 (HORMA domain-containing protein 1 [Source:NCBI gene;Acc:101155880])

HSP 1 Score: 152.91 bits (385), Expect = 1.735e-41
Identity = 82/237 (34.60%), Postives = 125/237 (52.74%), Query Frame = 1
Query:   28 MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDK 738
            M  A   K    +++ P    TEQQS+V +KKL A+A+S I Y+R IFP  A+  K++E  ++ IL     CPGA ++I+W++GCFDA+ + +L+ V++           V E Y F+  Y   S    +D  S ++  L      +      KK+++ L+R L        PLPE V + MKL YYD++TP DY+P GFR  +      E E +   +G V T FH  +  + T+K
Sbjct:    1 MAFAQRVKSSQVTQLLPNEVVTEQQSIVVVKKLLAIAVSAITYLRGIFPGKAYGTKYVEDQQVMILTGGRSCPGADQIIDWMQGCFDAIQKKFLRTVIMS---------KVTEYYQFRIQY--TSNGAHMDFESNSNQKLSTTTYGN-----TKKASILLVRKLYTLMQNLGPLPENVCLNMKLTYYDDVTPQDYQPPGFREAEGDVLEFEKEPVKLTMGEVTTPFHCVKFDMATEK 221          
BLAST of HORMA domain-containing protein vs. Ensembl Medaka
Match: kmt2e (lysine methyltransferase 2E [Source:NCBI gene;Acc:101162568])

HSP 1 Score: 53.5286 bits (127), Expect = 4.913e-7
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 1
Query:  886 FVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDIC 1026
              RC CG   DDG MI C+ C  WQH  C GI  ++ +PE ++C+ C
Sbjct:  116 ITRCICGFTHDDGYMICCDKCSAWQHIDCMGIDRQN-IPETYLCERC 161          
BLAST of HORMA domain-containing protein vs. Ensembl Medaka
Match: kmt2e (lysine methyltransferase 2E [Source:NCBI gene;Acc:101162568])

HSP 1 Score: 52.7582 bits (125), Expect = 7.008e-7
Identity = 21/46 (45.65%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  889 VRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDIC 1026
             RC CG   DDG MI C+ C  WQH  C GI  ++ +PE ++C+ C
Sbjct:   53 TRCICGFTHDDGYMICCDKCSAWQHIDCMGIDRQN-IPETYLCERC 97          
BLAST of HORMA domain-containing protein vs. Planmine SMEST
Match: SMESG000066514.1 (SMESG000066514.1)

HSP 1 Score: 988.793 bits (2555), Expect = 0.000e+0
Identity = 489/513 (95.32%), Postives = 489/513 (95.32%), Query Frame = 1
Query:   28 MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTNNYVKSSKSSNCNKPEFEKENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNLKATDIKLKEFNEDRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINVGKGVFHTLLKEGALVNPKRKTKNKGCDLIYCFYNNFFRLSKVVDKVALESLVLNKYFNSVVENNSPAKRKRKIDEVNLSKFTDNMSINENNLNFAIASQDSLIVEKCNKRRKGGIATTPVISSNH 1566
            MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTNNYVKSSKSSNCNKPEFEKENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNLKATDIKLKEFNEDRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINVGKGVFHTLLKEGALVNPKRKTKNKG             LSKVVDKVALESLVLNKYFNSVVENNSPAKRKRKIDEVNLSKFTDNMSIN           DSLIVEKCNKRRKGGIATTPVISSNH
Sbjct:    1 MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPEYAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIGFYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAPETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGFRTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTNNYVKSSKSSNCNKPEFEKENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGIMIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNLKATDIKLKEFNEDRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINVGKGVFHTLLKEGALVNPKRKTKNKG-------------LSKVVDKVALESLVLNKYFNSVVENNSPAKRKRKIDEVNLSKFTDNMSIN-----------DSLIVEKCNKRRKGGIATTPVISSNH 489          
The following BLAST results are available for this feature:
BLAST of HORMA domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HORMAD16.195e-5439.26HORMA domain containing 1 [Source:HGNC Symbol;Acc:... [more]
HORMAD26.852e-5336.26HORMA domain containing 2 [Source:HGNC Symbol;Acc:... [more]
HORMAD26.852e-5336.26HORMA domain containing 2 [Source:HGNC Symbol;Acc:... [more]
HORMAD14.094e-4938.02HORMA domain containing 1 [Source:HGNC Symbol;Acc:... [more]
HORMAD11.313e-3037.13HORMA domain containing 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of HORMA domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
him-31.308e-1025.60High Incidence of Males (Increased X chromosome lo... [more]
him-31.308e-1025.60High Incidence of Males (Increased X chromosome lo... [more]
htp-18.769e-1024.68Him-Three Paralog [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
htp-29.342e-924.02Him-Three Paralog [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
set-265.790e-638.46Histone-lysine N-methyltransferase set-26 [Source... [more]
back to top
BLAST of HORMA domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MBD-R25.423e-840.00gene:FBgn0038016 transcript:FBtr0082611[more]
upSET8.174e-744.44gene:FBgn0036398 transcript:FBtr0333050[more]
upSET8.174e-744.44gene:FBgn0036398 transcript:FBtr0075768[more]
ash12.035e-631.73gene:FBgn0005386 transcript:FBtr0306009[more]
ash12.035e-631.73gene:FBgn0005386 transcript:FBtr0306010[more]
back to top
BLAST of HORMA domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hormad17.137e-5441.96HORMA domain containing 1 [Source:NCBI gene;Acc:43... [more]
zte383.671e-4634.80zebrafish testis-expressed 38 [Source:ZFIN;Acc:ZDB... [more]
phf20l11.577e-948.98PHD finger protein 20 like 1 [Source:ZFIN;Acc:ZDB-... [more]
phf20l11.824e-948.98PHD finger protein 20 like 1 [Source:ZFIN;Acc:ZDB-... [more]
phf20a1.772e-836.36PHD finger protein 20, a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of HORMA domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gstm11.380e-4438.57glutathione S-transferase mu 1 [Source:Xenbase;Acc... [more]
PHF20L15.688e-951.02PHD finger protein 20 like 1 [Source:NCBI gene;Acc... [more]
PHF20L17.250e-951.02PHD finger protein 20 like 1 [Source:NCBI gene;Acc... [more]
PHF203.336e-746.94PHD finger protein 20 [Source:NCBI gene;Acc:100126... [more]
KMT2E1.759e-643.48lysine (K)-specific methyltransferase 2E [Source:N... [more]
back to top
BLAST of HORMA domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hormad24.872e-5340.63HORMA domain containing 2 [Source:MGI Symbol;Acc:M... [more]
Hormad24.872e-5340.63HORMA domain containing 2 [Source:MGI Symbol;Acc:M... [more]
Hormad11.185e-5239.06HORMA domain containing 1 [Source:MGI Symbol;Acc:M... [more]
Hormad11.185e-5239.06HORMA domain containing 1 [Source:MGI Symbol;Acc:M... [more]
Hormad11.185e-5239.06HORMA domain containing 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of HORMA domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KIY6|HORM1_BOVIN2.630e-5440.08HORMA domain-containing protein 1 OS=Bos taurus OX... [more]
sp|A6QQY4|HORM2_BOVIN2.805e-5439.91HORMA domain-containing protein 2 OS=Bos taurus OX... [more]
sp|E2IUK4|HORM1_PIG1.438e-5340.57HORMA domain-containing protein 1 OS=Sus scrofa OX... [more]
sp|E2RSQ2|HORM1_CANLF1.568e-5340.08HORMA domain-containing protein 1 OS=Canis lupus f... [more]
sp|Q86X24|HORM1_HUMAN2.975e-5339.26HORMA domain-containing protein 1 OS=Homo sapiens ... [more]
back to top
BLAST of HORMA domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KSN16.731e-10838.25HORMA domain-containing protein OS=Schistosoma man... [more]
A0A5K4EXM28.962e-10838.01Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A504YP752.094e-10437.75HORMA domain-containing protein 2 OS=Fasciola giga... [more]
A0A4Z2CM868.903e-10338.10HORMA domain-containing protein OS=Schistosoma jap... [more]
A0A2C9KAD69.184e-10342.72HORMA domain-containing protein OS=Biomphalaria gl... [more]
back to top
BLAST of HORMA domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hormad13.353e-5540.89HORMA domain containing 1 [Source:NCBI gene;Acc:10... [more]
hormad18.567e-5540.89HORMA domain containing 1 [Source:NCBI gene;Acc:10... [more]
hormad11.291e-5440.89HORMA domain containing 1 [Source:NCBI gene;Acc:10... [more]
zte384.855e-5038.29zebrafish testis-expressed 38 [Source:ZFIN;Acc:ZDB... [more]
phf20l11.115e-948.98PHD finger protein 20 like 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of HORMA domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000009606.14.055e-1736.96pep scaffold:Pmarinus_7.0:GL481528:14094:14964:-1 ... [more]
ENSPMAT00000004065.11.868e-1048.98pep scaffold:Pmarinus_7.0:GL479372:18838:35317:1 g... [more]
kmt2e3.248e-845.65lysine (K)-specific methyltransferase 2E [Source:Z... [more]
back to top
BLAST of HORMA domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HOP13.537e-1421.33Meiosis-specific protein required for chromosome s... [more]
SET32.798e-840.43Defining member of the SET3 histone deacetylase co... [more]
back to top
BLAST of HORMA domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO476101.698e-7034.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371701.992e-641.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HORMA domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hormad15.376e-4735.86HORMA domain-containing protein 1 [Source:NCBI gen... [more]
zte388.762e-4737.56HORMA domain-containing protein 1-like [Source:NCB... [more]
hormad11.735e-4134.60HORMA domain-containing protein 1 [Source:NCBI gen... [more]
kmt2e4.913e-744.68lysine methyltransferase 2E [Source:NCBI gene;Acc:... [more]
kmt2e7.008e-745.65lysine methyltransferase 2E [Source:NCBI gene;Acc:... [more]
back to top
BLAST of HORMA domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000066514.10.000e+095.32SMESG000066514.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026877 ID=SMED30026877|Name=HORMA domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1619bp
GAAATTTTTCAAATAATCTGAAACAAAATGCCTGTTGCTCTACTAACAAA
AGAAAAGACATGGTCCAAAATGTTTCCTACTATATTTACAACAGAACAGC
AAAGTTTAGTATTTATGAAAAAATTGTTTGCAGTTGCCATTTCTAATATA
GTGTACATCAGATCGATTTTTCCTGAATATGCTTTTTTTGATAAGCATTT
GGAGGGTATAAAGCTAAAAATTCTTAGGGAAGATAGCAAATGTCCTGGAG
CGTCTAAAGTGATAAATTGGGTTAGAGGCTGTTTTGATGCTTTAGATCGA
CATTATTTGAAAGCAGTTGTGATTGGATTTTATACAGACATTAAAGATCC
AGATACAGTAATCGAATCGTATTCATTTAAATTCACTTATGGTCAAGATT
CTGTATCTGTAAAACTTGATAATACTTCCAAGACCGATTCCGGATTAGAA
GCTGTCATTAAAAATGATGATGCGCCAGAGACAATAAAAAAATCTACCTT
AAGTTTGCTCCGAACTTTGATTTTAGCTGGAAATACTCAGGACCCTTTGC
CAGAAAAGGTTTTTGTTACAATGAAATTGCTTTATTATGACGAAATTACT
CCTGACGATTATGAGCCCAATGGGTTTCGAACGTGTGACTATGCCGGTTT
TAGACACGAAACTGAAACTATTAATGCTAAATTAGGTCATGTTGAAACTG
ATTTTCACAGTTTCCGAATGATATTAAAAACGGATAAAGTATCATTTACT
AATAATTACGTAAAAAGTTCTAAAAGTAGTAACTGCAATAAGCCTGAATT
TGAAAAAGAAAATGAAACGCCTGTTTTAAATGAAACAAGAAAAATCACGC
CAAACTGTAGCAGGACTTGCTCTGAAGAGGAGTTTTTTGTCAGATGTCCT
TGTGGGGGAAACAAGGATGATGGAATTATGATAATGTGTGAAAATTGTAA
AAATTGGCAACACTCTATCTGTTTTGGAATTATAGAGGAAGATCGTGTTC
CTGAAGTTCATGTGTGTGATATATGCGCAGACGCCAACCCGAATTTGAAA
GCCACGGATATTAAATTGAAAGAGTTCAATGAAGACCGACAAGAGATTTG
CTTAATACGCAGAGCGTTGATTTATTGCAAGTCATCTGATGTTATCGAAC
CTGGACAATTAGCTGATGTATTAGGTGTTGAAATAAATGTTGGTAAAGGA
GTTTTTCACACATTGCTTAAAGAAGGAGCTTTAGTTAATCCTAAAAGAAA
AACAAAAAATAAAGGGTGTGATCTAATTTACTGTTTTTATAATAATTTTT
TTAGACTTTCAAAAGTTGTTGACAAAGTTGCTTTAGAATCCCTTGTATTA
AATAAATATTTTAATTCTGTCGTTGAAAATAATTCACCAGCAAAAAGAAA
GCGAAAAATTGATGAAGTAAACTTATCAAAATTTACGGATAATATGTCCA
TTAATGAAAACAACCTTAATTTTGCTATTGCATCCCAGGATTCATTAATC
GTTGAAAAATGCAATAAAAGAAGAAAAGGGGGGATTGCTACAACACCTGT
TATATCTTCGAATCATTAATGTGTTGTGTTTAGTTTTTAATAGTTATTAA
AATAAATTCTTTAAAATTA
back to top

protein sequence of SMED30026877-orf-1

>SMED30026877-orf-1 ID=SMED30026877-orf-1|Name=SMED30026877-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=514bp
MPVALLTKEKTWSKMFPTIFTTEQQSLVFMKKLFAVAISNIVYIRSIFPE
YAFFDKHLEGIKLKILREDSKCPGASKVINWVRGCFDALDRHYLKAVVIG
FYTDIKDPDTVIESYSFKFTYGQDSVSVKLDNTSKTDSGLEAVIKNDDAP
ETIKKSTLSLLRTLILAGNTQDPLPEKVFVTMKLLYYDEITPDDYEPNGF
RTCDYAGFRHETETINAKLGHVETDFHSFRMILKTDKVSFTNNYVKSSKS
SNCNKPEFEKENETPVLNETRKITPNCSRTCSEEEFFVRCPCGGNKDDGI
MIMCENCKNWQHSICFGIIEEDRVPEVHVCDICADANPNLKATDIKLKEF
NEDRQEICLIRRALIYCKSSDVIEPGQLADVLGVEINVGKGVFHTLLKEG
ALVNPKRKTKNKGCDLIYCFYNNFFRLSKVVDKVALESLVLNKYFNSVVE
NNSPAKRKRKIDEVNLSKFTDNMSINENNLNFAIASQDSLIVEKCNKRRK
GGIATTPVISSNH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036570HORMA_dom_sf
IPR001965Znf_PHD
IPR013083Znf_RING/FYVE/PHD
IPR003511HORMA_dom
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 289..334
e-value: 9.4E-4
score: 28.5
IPR036570HORMA domain superfamilyGENE3DG3DSA:3.30.900.10coord: 10..279
e-value: 2.4E-74
score: 251.8
IPR036570HORMA domain superfamilySUPERFAMILYSSF56019The spindle assembly checkpoint protein mad2coord: 21..233
IPR003511HORMA domainPFAMPF02301HORMAcoord: 26..227
e-value: 7.5E-55
score: 185.8
IPR003511HORMA domainPROSITEPS50815HORMAcoord: 24..233
score: 33.095
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 286..353
e-value: 1.5E-16
score: 61.6
NoneNo IPR availablePANTHERPTHR46462:SF3UPSET, ISOFORM Acoord: 253..335
NoneNo IPR availablePANTHERPTHR46462FAMILY NOT NAMEDcoord: 253..335
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 281..340