Ribosomal protein S6 kinase

Overview
NameRibosomal protein S6 kinase
Smed IDSMED30026874
Length (bp)1827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosomal protein S6 kinase (SMED30026874) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosomal protein S6 kinase (SMED30026874) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosomal protein S6 kinase (SMED30026874) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosomal protein S6 kinase (SMED30026874) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026874

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30026874h1SMcG0006060 dd_Smed_v4_8439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026874h1SMcG0006060 dd_Smed_v4_6579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026874h1SMcG0006060 dd_Smed_v4_6579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026874h1SMcG0006060 dd_Smed_v4_6579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026874h1SMcG0006060 dd_Smed_v4_8439_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026874h1SMcG0006060 dd_Smed_v4_6579_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 427.557 bits (1098), Expect = 1.737e-144
Identity = 215/357 (60.22%), Postives = 267/357 (74.79%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKVT G +  K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  E+++H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDDST +  +  +F GF+YVAP+V ESV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 428.328 bits (1100), Expect = 1.824e-144
Identity = 215/357 (60.22%), Postives = 267/357 (74.79%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKVT G +  K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  E+++H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDDST +  +  +F GF+YVAP+V ESV
Sbjct:   17 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 369          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 427.943 bits (1099), Expect = 1.641e-143
Identity = 215/357 (60.22%), Postives = 267/357 (74.79%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKVT G +  K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  E+++H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDDST +  +  +F GF+YVAP+V ESV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Match: RPS6KB2 (ribosomal protein S6 kinase B2 [Source:HGNC Symbol;Acc:HGNC:10437])

HSP 1 Score: 418.313 bits (1074), Expect = 2.360e-140
Identity = 205/385 (53.25%), Postives = 272/385 (70.65%), Query Frame = 1
Query:  112 SDKDSMSFGAIRE---EKYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERL-GYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            S  D+     +R    E     EE +L   S+ +  + + PH       FE+L V+G+GGYGKVF VRKV  G +  K+YAMKVL+KA+IVRN KDTAHT++ERNILE ++HPF+V+L YAFQ+   LY++L    GGELFT+LEREG  +E+ ACFY+AEI+LA+GHLHS+GIIYRDLKPEN++L   GH+KLTDFGL KES      T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ T++KI+R  L  P Y + D   L+K  LKRNP +R+ G   D  +++ H FF+   +NWDD+L+ +V+PPF+P L+SE DVS FD+ FT Q P+ SPDD+  +  +   F GF+YVAP+V +S+
Sbjct:   24 SPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHC------FELLRVLGKGGYGKVFQVRKVQ-GTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKK-TMDKIIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRH--MNWDDLLAWRVDPPFRPCLQSEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSI 398          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 389.037 bits (998), Expect = 1.127e-128
Identity = 199/357 (55.74%), Postives = 248/357 (69.47%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGK                        A IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  E+++H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDDST +  +  +F GF+YVAP+V ESV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGK------------------------AMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 399          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Match: rsks-1 (Ribosomal protein S6 kinase beta [Source:UniProtKB/Swiss-Prot;Acc:Q9NAH6])

HSP 1 Score: 395.971 bits (1016), Expect = 3.012e-131
Identity = 196/357 (54.90%), Postives = 259/357 (72.55%), Query Frame = 1
Query:  184 VTQSIEICDQTVNP-HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATS---TNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYK-NDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAE 1239
            + +SI++C   +NP + +V   DF++L V+G+GGYGKVF VRK T G D  +++AMKVL+KA IVRN+KDTAHTK+ERNILE ++ PF+  L YAFQ+   LY++L Y  GGELF +LEREG  MEN A FY++EI +++ HLH +GIIYRDLKPEN+LLD  GHVKLTDFGL KE       T+TFCGTIEYMAPEIL R GH   VDWWSLG L+FDML+GGPPF+ E+ ++ TI+KIL+  L  P Y S +   LIK LLKR+   RLG   +D EEIKSH FF+  D  W+ + +R++E PFKP+++++ D S FD+ FT   P+ SP ++  +   ++ F GF+YVAP+V E
Sbjct:   60 MMESIQLCASAINPPNVRVGPEDFQLLKVLGKGGYGKVFQVRKTT-GSDNGQIFAMKVLQKATIVRNQKDTAHTKAERNILEAVKSPFICDLLYAFQTGGKLYLILEYLSGGELFMHLEREGMFMENVAKFYLSEIVVSLEHLHQQGIIYRDLKPENILLDAYGHVKLTDFGLCKEEIEGDQKTHTFCGTIEYMAPEILMRCGHGKAVDWWSLGALMFDMLTGGPPFTAENRRK-TIDKILKGRLTLPAYLSNEARDLIKKLLKRHVDTRLGAGLSDAEEIKSHAFFKTTD--WNLVYARQLEAPFKPNIENDEDTSLFDARFTKMTPVDSPCETNFSLNGDNPFVGFTYVAPSVLE 412          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 333.569 bits (854), Expect = 5.906e-105
Identity = 179/387 (46.25%), Postives = 245/387 (63.31%), Query Frame = 1
Query:  148 EEKYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATS---TNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKND-VEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNV-------AESVLSEPWIENKP 1275
            EEK D   E ++    +  C +  +P +      FE+L V+G+G +GKVFLVRKV  G D   +YAMKVLKKA +    +D   TK ERNIL  I HPF+VKLHYAFQ++  LY++L +  GG+LFT L +E    E+   FY+AE++LA+ HLHS GI+YRDLKPEN+LLD  GH+K+TDFGLSKE+  S   T +FCGT+EYMAPE++ R GH+   D+WSLG L+F+ML+G  PF Q   +  T+ +IL+A L  P + + +   L++ L KRN + RLG   D VEEIK H FF K  I++  +L+++++PPFKP L +    S FD  FT + P  SP      +   +IF GFS+V+  V       A+SV S P  +  P
Sbjct:   19 EEKTDSSSETEIDIGDVRKCGEKADPRQ------FELLKVLGQGSFGKVFLVRKVR-GRDSGHVYAMKVLKKATL--KVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPF-QGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAK--IDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASAN-GHEIFRGFSFVSNAVMEERKLIAKSVRSVPTAKTNP 392          

HSP 2 Score: 108.227 bits (269), Expect = 2.874e-24
Identity = 86/296 (29.05%), Postives = 148/296 (50.00%), Query Frame = 1
Query:  169 EENQLVTQSIE-ICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTL-MENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLD-KCG---HVKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKIL------RAPLKFPMY--FSLDVMGLIKGLLKRNPKERLGYKNDVE 1005
            EE +L+ +S+  +     NP       D+EIL  IG G +    +V K       +K YA+K++KKA     E+          +L    H F+VKL   ++ ++ +Y++   C GGEL   L  + +L  E +    +A +  A+ +LHS+ + +RDL   N+L   K G    +++ DFG +K+S        T C T +++APE+LR++G+    D WSLG LL  ML+G  PF+   +   T ++IL      +  +  P++   S +   L++ +L  +P  R+  K  ++
Sbjct:  373 EERKLIAKSVRSVPTAKTNPFTD----DYEILEKIGNGAHS---VVHKCQMKATRRK-YAVKIVKKAVFDATEEVDI-------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPND--TPDQILQRVGDGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQ 651          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 328.176 bits (840), Expect = 6.807e-103
Identity = 177/385 (45.97%), Postives = 243/385 (63.12%), Query Frame = 1
Query:  154 KYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATS---TNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKND-VEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNV-------AESVLSEPWIENKP 1275
            K D   E ++    +  C +  +P +      FE+L V+G+G +GKVFLVRKV  G D   +YAMKVLKKA +    +D   TK ERNIL  I HPF+VKLHYAFQ++  LY++L +  GG+LFT L +E    E+   FY+AE++LA+ HLHS GI+YRDLKPEN+LLD  GH+K+TDFGLSKE+  S   T +FCGT+EYMAPE++ R GH+   D+WSLG L+F+ML+G  PF Q   +  T+ +IL+A L  P + + +   L++ L KRN + RLG   D VEEIK H FF K  I++  +L+++++PPFKP L +    S FD  FT + P  SP      +   +IF GFS+V+  V       A+SV S P  +  P
Sbjct:   59 KTDSSSETEIDIGDVRKCGEKADPRQ------FELLKVLGQGSFGKVFLVRKVR-GRDSGHVYAMKVLKKATL--KVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPF-QGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAK--IDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASAN-GHEIFRGFSFVSNAVMEERKLIAKSVRSVPTAKTNP 430          

HSP 2 Score: 107.457 bits (267), Expect = 5.168e-24
Identity = 76/238 (31.93%), Postives = 123/238 (51.68%), Query Frame = 1
Query:  169 EENQLVTQSIE-ICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTL-MENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLD-KCG---HVKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFS 855
            EE +L+ +S+  +     NP       D+EIL  IG G +    +V K       +K YA+K++KKA     E+          +L    H F+VKL   ++ ++ +Y++   C GGEL   L  + +L  E +    +A +  A+ +LHS+ + +RDL   N+L   K G    +++ DFG +K+S        T C T +++APE+LR++G+    D WSLG LL  ML+G  PF+
Sbjct:  411 EERKLIAKSVRSVPTAKTNPFTD----DYEILEKIGNGAHS---VVHKCQMKATRRK-YAVKIVKKAVFDATEEVDI-------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFA 633          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 328.176 bits (840), Expect = 1.034e-102
Identity = 176/383 (45.95%), Postives = 242/383 (63.19%), Query Frame = 1
Query:  160 DEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATS---TNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKND-VEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNV-------AESVLSEPWIENKP 1275
            D   E ++    +  C +  +P +      FE+L V+G+G +GKVFLVRKV  G D   +YAMKVLKKA +    +D   TK ERNIL  I HPF+VKLHYAFQ++  LY++L +  GG+LFT L +E    E+   FY+AE++LA+ HLHS GI+YRDLKPEN+LLD  GH+K+TDFGLSKE+  S   T +FCGT+EYMAPE++ R GH+   D+WSLG L+F+ML+G  PF Q   +  T+ +IL+A L  P + + +   L++ L KRN + RLG   D VEEIK H FF K  I++  +L+++++PPFKP L +    S FD  FT + P  SP      +   +IF GFS+V+  V       A+SV S P  +  P
Sbjct:   41 DSSSETEIDIGDVRKCGEKADPRQ------FELLKVLGQGSFGKVFLVRKVR-GRDSGHVYAMKVLKKATL--KVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPF-QGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAK--IDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASAN-GHEIFRGFSFVSNAVMEERKLIAKSVRSVPTAKTNP 410          

HSP 2 Score: 107.842 bits (268), Expect = 3.211e-24
Identity = 86/296 (29.05%), Postives = 148/296 (50.00%), Query Frame = 1
Query:  169 EENQLVTQSIE-ICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTL-MENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLD-KCG---HVKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKIL------RAPLKFPMY--FSLDVMGLIKGLLKRNPKERLGYKNDVE 1005
            EE +L+ +S+  +     NP       D+EIL  IG G +    +V K       +K YA+K++KKA     E+          +L    H F+VKL   ++ ++ +Y++   C GGEL   L  + +L  E +    +A +  A+ +LHS+ + +RDL   N+L   K G    +++ DFG +K+S        T C T +++APE+LR++G+    D WSLG LL  ML+G  PF+   +   T ++IL      +  +  P++   S +   L++ +L  +P  R+  K  ++
Sbjct:  391 EERKLIAKSVRSVPTAKTNPFTD----DYEILEKIGNGAHS---VVHKCQMKATRRK-YAVKIVKKAVFDATEEVDI-------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPND--TPDQILQRVGDGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQ 669          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 328.561 bits (841), Expect = 1.478e-102
Identity = 177/385 (45.97%), Postives = 243/385 (63.12%), Query Frame = 1
Query:  154 KYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATS---TNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKND-VEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNV-------AESVLSEPWIENKP 1275
            K D   E ++    +  C +  +P +      FE+L V+G+G +GKVFLVRKV  G D   +YAMKVLKKA +    +D   TK ERNIL  I HPF+VKLHYAFQ++  LY++L +  GG+LFT L +E    E+   FY+AE++LA+ HLHS GI+YRDLKPEN+LLD  GH+K+TDFGLSKE+  S   T +FCGT+EYMAPE++ R GH+   D+WSLG L+F+ML+G  PF Q   +  T+ +IL+A L  P + + +   L++ L KRN + RLG   D VEEIK H FF K  I++  +L+++++PPFKP L +    S FD  FT + P  SP      +   +IF GFS+V+  V       A+SV S P  +  P
Sbjct:   78 KTDSSSETEIDIGDVRKCGEKADPRQ------FELLKVLGQGSFGKVFLVRKVR-GRDSGHVYAMKVLKKATL--KVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPF-QGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAK--IDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASAN-GHEIFRGFSFVSNAVMEERKLIAKSVRSVPTAKTNP 449          

HSP 2 Score: 108.612 bits (270), Expect = 2.353e-24
Identity = 86/296 (29.05%), Postives = 148/296 (50.00%), Query Frame = 1
Query:  169 EENQLVTQSIE-ICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTL-MENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLD-KCG---HVKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKIL------RAPLKFPMY--FSLDVMGLIKGLLKRNPKERLGYKNDVE 1005
            EE +L+ +S+  +     NP       D+EIL  IG G +    +V K       +K YA+K++KKA     E+          +L    H F+VKL   ++ ++ +Y++   C GGEL   L  + +L  E +    +A +  A+ +LHS+ + +RDL   N+L   K G    +++ DFG +K+S        T C T +++APE+LR++G+    D WSLG LL  ML+G  PF+   +   T ++IL      +  +  P++   S +   L++ +L  +P  R+  K  ++
Sbjct:  430 EERKLIAKSVRSVPTAKTNPFTD----DYEILEKIGNGAHS---VVHKCQMKATRRK-YAVKIVKKAVFDATEEVDI-------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPND--TPDQILQRVGDGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQ 708          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Match: S6k (gene:FBgn0283472 transcript:FBtr0077114)

HSP 1 Score: 416.387 bits (1069), Expect = 7.768e-140
Identity = 203/357 (56.86%), Postives = 262/357 (73.39%), Query Frame = 1
Query:  190 QSIEICDQTVNPHK-KVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKE---SATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            ++I++C++ VNP K K+   DFE+  V+G+GGYGKVF VRK T G D  K +AMKVLKKA IV N+KDTAHT++ERNILE ++HPF+V+L YAFQ+   LY++L Y  GGELF +LEREG  +E+  CFY++EI LA+GHLH  GIIYRDLKPEN+LLD  GHVKLTDFGL KE       T+TFCGTIEYMAPEIL R GH   VDWWSLG L+FDML+G PPF+ E+ K+ TIE IL+A L  P Y + +   L++ L+KR   +RLG    D   ++ H FF+   +NWDD+L+R++EPP KP L+SE DVS FD+ FT Q P+ SPDD+T +  +  IF GF+YVAP++ E +
Sbjct:   56 ETIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRK-TAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKK-TIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKH--VNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSILEDM 408          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Match: S6k (gene:FBgn0283472 transcript:FBtr0333264)

HSP 1 Score: 416.387 bits (1069), Expect = 7.768e-140
Identity = 203/357 (56.86%), Postives = 262/357 (73.39%), Query Frame = 1
Query:  190 QSIEICDQTVNPHK-KVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKE---SATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            ++I++C++ VNP K K+   DFE+  V+G+GGYGKVF VRK T G D  K +AMKVLKKA IV N+KDTAHT++ERNILE ++HPF+V+L YAFQ+   LY++L Y  GGELF +LEREG  +E+  CFY++EI LA+GHLH  GIIYRDLKPEN+LLD  GHVKLTDFGL KE       T+TFCGTIEYMAPEIL R GH   VDWWSLG L+FDML+G PPF+ E+ K+ TIE IL+A L  P Y + +   L++ L+KR   +RLG    D   ++ H FF+   +NWDD+L+R++EPP KP L+SE DVS FD+ FT Q P+ SPDD+T +  +  IF GF+YVAP++ E +
Sbjct:   56 ETIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRK-TAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKK-TIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKH--VNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSILEDM 408          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0333715)

HSP 1 Score: 311.997 bits (798), Expect = 4.285e-95
Identity = 164/344 (47.67%), Postives = 223/344 (64.83%), Query Frame = 1
Query:  226 HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKE--SATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHIS---EDIFTGFSYVAPNVAE 1239
            H K     FE+L V+G G +GKVFLVRK+  G+D   LYAMKVLKKA +    KD   + +ER IL  + H F+V+LHYAFQ+   LY++L +  GG+LFT L +E    E    FY+AE++LA+ HLH+ GIIYRDLKPEN+LLD+ GH+ LTDFGLSK+    + T +FCGT+EYMAPEI+ R+GH F  DWWS G L+++ML+G  PF  + ++Q T+ +ILR+ L  P   S +   L++ L KRNP+ RLG     + +IK+H FF    I+W  +  ++V PPF P + S  D   FD  +T++    SP DS G  IS    +IF GFS+VAP + E
Sbjct:  191 HDKADPSQFELLRVLGEGSFGKVFLVRKII-GKDAGTLYAMKVLKKATL--KVKDRVRSTNERKILADVGHAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLDEHGHIALTDFGLSKQPLDGSKTYSFCGTVEYMAPEIVNRKGHDFAADWWSFGVLMYEMLTGNLPFHGQ-TRQETMNQILRSKLGMPENLSPEAQSLLRALFKRNPQNRLGAGAQGILDIKAHCFFAT--IDWVRLERKQVRPPFIPAV-SRDDAFYFDVEYTSK----SPRDSPGGPISASAHEIFRGFSFVAPVLLE 523          

HSP 2 Score: 110.153 bits (274), Expect = 1.049e-24
Identity = 68/212 (32.08%), Postives = 111/212 (52.36%), Query Frame = 1
Query:  247 DFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERN--ILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGH----VKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFS 855
            ++ +L  +GRG     F V ++      KK YA+KV++KA +      T+    E    +L    HP +V L+  ++   + Y+V+    GGEL   +   G + E++A   +  I+ A+ +LH  G+++RDLKP N++          +KL D G +K+         T C T  ++APE+L+R+G+    D WSLG LL+ MLSG  PF+
Sbjct:  567 EYNLLQELGRG----TFSVCRLCEHRASKKHYAVKVIEKAAVAAASTSTSADCWEEVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLMTPCYTANFVAPEVLKRQGYDLACDIWSLGVLLYIMLSGRTPFA 774          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0077360)

HSP 1 Score: 311.997 bits (798), Expect = 4.285e-95
Identity = 164/344 (47.67%), Postives = 223/344 (64.83%), Query Frame = 1
Query:  226 HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKE--SATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHIS---EDIFTGFSYVAPNVAE 1239
            H K     FE+L V+G G +GKVFLVRK+  G+D   LYAMKVLKKA +    KD   + +ER IL  + H F+V+LHYAFQ+   LY++L +  GG+LFT L +E    E    FY+AE++LA+ HLH+ GIIYRDLKPEN+LLD+ GH+ LTDFGLSK+    + T +FCGT+EYMAPEI+ R+GH F  DWWS G L+++ML+G  PF  + ++Q T+ +ILR+ L  P   S +   L++ L KRNP+ RLG     + +IK+H FF    I+W  +  ++V PPF P + S  D   FD  +T++    SP DS G  IS    +IF GFS+VAP + E
Sbjct:  191 HDKADPSQFELLRVLGEGSFGKVFLVRKII-GKDAGTLYAMKVLKKATL--KVKDRVRSTNERKILADVGHAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLDEHGHIALTDFGLSKQPLDGSKTYSFCGTVEYMAPEIVNRKGHDFAADWWSFGVLMYEMLTGNLPFHGQ-TRQETMNQILRSKLGMPENLSPEAQSLLRALFKRNPQNRLGAGAQGILDIKAHCFFAT--IDWVRLERKQVRPPFIPAV-SRDDAFYFDVEYTSK----SPRDSPGGPISASAHEIFRGFSFVAPVLLE 523          

HSP 2 Score: 110.153 bits (274), Expect = 1.049e-24
Identity = 68/212 (32.08%), Postives = 111/212 (52.36%), Query Frame = 1
Query:  247 DFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERN--ILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGH----VKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFS 855
            ++ +L  +GRG     F V ++      KK YA+KV++KA +      T+    E    +L    HP +V L+  ++   + Y+V+    GGEL   +   G + E++A   +  I+ A+ +LH  G+++RDLKP N++          +KL D G +K+         T C T  ++APE+L+R+G+    D WSLG LL+ MLSG  PF+
Sbjct:  567 EYNLLQELGRG----TFSVCRLCEHRASKKHYAVKVIEKAAVAAASTSTSADCWEEVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLMTPCYTANFVAPEVLKRQGYDLACDIWSLGVLLYIMLSGRTPFA 774          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Match: JIL-1 (gene:FBgn0020412 transcript:FBtr0076237)

HSP 1 Score: 297.36 bits (760), Expect = 6.734e-88
Identity = 165/349 (47.28%), Postives = 221/349 (63.32%), Query Frame = 1
Query:  235 VSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEII-RHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSK----ESATSTNTFCGTIEYMAPEILRR--EGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLK----FPMYFSLDVMGLIKGLLKRNPKERLGYKN-DVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            VS+ DF+I+ V+G G YG+VFLVRK+T   D  KLYAMKVL K  +V+  K   HTK+ER +LE I R+PFLV LHYAFQS S LY+VL +  GGELFT+L       E++   YIAE+ LA+  LH  GIIYRD+K EN+LLD  GH+ L+DFGLSK    E+    ++FCGT+EYMAPEI+R    GH   VDWWS+G L F++L+G  PF+  S  Q+   +I R   K     P  FS +    +  +L++NPK RLG  + D  EIK H FF  N INW ++ +++ + P+KP L +E DV  F + FT+Q P     D+  + I   +F G++YVAP   E +
Sbjct:  256 VSLNDFKIIRVLGTGAYGRVFLVRKLT-RHDAGKLYAMKVLNKITVVQKRKTAEHTKTERVVLEAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLYHSENFEESRVRVYIAEVVLALEQLHQLGIIYRDIKLENILLDGEGHIVLSDFGLSKILTAENEYRAHSFCGTLEYMAPEIIRTGPPGHDSAVDWWSVGVLTFELLTGASPFAT-SDGQVQQSEISRRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRLGGNHRDASEIKEHPFF--NGINWQELRTKRRKAPYKPTLTAEDDVQNFSNEFTDQVPEDPECDAPPSRIR--LFRGYTYVAPEHLEQM 598          

HSP 2 Score: 74.3294 bits (181), Expect = 2.160e-13
Identity = 63/217 (29.03%), Postives = 100/217 (46.08%), Query Frame = 1
Query:  247 DFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYI-AEISLAIGHLHSKGIIYRDLKPENVLLD--KCGHVKLTDFGLSKESATSTNTFCG-------TIEYMAPEILRREG---HTFVVDWWSLGTLLFDMLSGGPPFSQ 858
            D E+ T    G YG    V  V    D   ++  K++  ++   +E D   + +    L+   H  +V  H  F+ +   +IV+ Y  G EL   +      M+  +C  I  ++ +A+ H+HSK  I+ DLKPEN++ +  +   VKL DFG    SA   N F         T++Y  PE+L       ++  VD + LG  L+ ML G  P+ Q
Sbjct:  622 DLELGTRTSNGAYGTCHFV--VDSSTD--LVFLAKIIPLSKFRPSEVDALISCA----LDTTNHKNIVSYHGTFREKCETWIVMEYLSGPELTASIR-----MDEDSCREIFLQLVMAVRHIHSKHFIHGDLKPENIMFENREDRTVKLIDFG----SACYNNRFKSWKDKPRYTLDYAPPEMLADANLVTYSPAVDIYGLGATLYTMLVGHRPYRQ 821          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Match: rps6kb1b (ribosomal protein S6 kinase b, polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2038])

HSP 1 Score: 423.705 bits (1088), Expect = 1.688e-142
Identity = 215/385 (55.84%), Postives = 276/385 (71.69%), Query Frame = 1
Query:  142 IREEKYDEKEENQLVTQS------------IEICDQTVNP-HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            + +++ +E + N+L+ Q             IEI +  VN   + +    FE+L V+G+GGYGKVF VRKV+ G    K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKR+   RLG    D  E+++H FF+   +NWDD+L+RKVEPPFKP L+S  DVS FDS FT+Q P+ SPDDST +  +  +F GF+YVAP+V E++
Sbjct:   16 VSDDELEEAQINELMDQCSGFEFNMDDCEKIEISEDNVNQGTENIRPECFELLRVLGKGGYGKVFQVRKVS-GAATGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRH--VNWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENI 396          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Match: rps6kb1a (ribosomal protein S6 kinase b, polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-091113-52])

HSP 1 Score: 413.305 bits (1061), Expect = 2.585e-138
Identity = 215/391 (54.99%), Postives = 274/391 (70.08%), Query Frame = 1
Query:  190 QSIEICDQTVNP-HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYK-NDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARFGHTHVSECKKIVED 1347
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKV  G    K++AMKVLKKA IVRN KDTAHTK+ER+ILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  +E+ ACFY+AEISLA+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   R+G    DV +I+ H FF+   INWDD+L+ K++PPFKP L+S  DVS FDS FT+Q P+ SPDD+  +     +F GF+Y+AP+V E++  +   E K    + +      T VS  K  VED
Sbjct:   44 EKFEISEDSVNQGTEKIRPECFELLRVLGKGGYGKVFQVRKVA-GAASGKIFAMKVLKKAMIVRNAKDTAHTKAERSILEEVKHPFIVDLIYAFQTGEKLYLILEYLSGGELFMQLEREGIFLEDTACFYLAEISLALGHLHQKGIIYRDLKPENIMLNYNGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILTRSGHNRAVDWWSLGALMYDMLTGAPPFTAENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNASVRIGASPRDVLDIQRHSFFRH--INWDDLLAFKIDPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDTKLSESDNQVFLGFTYIAPSVLENIKEKFTFEPKSRSPRKVLGS-PRTPVSPLKAEVED 429          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Match: BX000486.1 (ribosomal protein S6 kinase b, polypeptide 1a [Source:NCBI gene;Acc:562242])

HSP 1 Score: 413.305 bits (1061), Expect = 2.848e-138
Identity = 215/391 (54.99%), Postives = 274/391 (70.08%), Query Frame = 1
Query:  190 QSIEICDQTVNP-HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYK-NDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARFGHTHVSECKKIVED 1347
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKV  G    K++AMKVLKKA IVRN KDTAHTK+ER+ILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  +E+ ACFY+AEISLA+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   R+G    DV +I+ H FF+   INWDD+L+ K++PPFKP L+S  DVS FDS FT+Q P+ SPDD+  +     +F GF+Y+AP+V E++  +   E K    + +      T VS  K  VED
Sbjct:   45 EKFEISEDSVNQGTEKIRPECFELLRVLGKGGYGKVFQVRKVA-GAASGKIFAMKVLKKAMIVRNAKDTAHTKAERSILEEVKHPFIVDLIYAFQTGEKLYLILEYLSGGELFMQLEREGIFLEDTACFYLAEISLALGHLHQKGIIYRDLKPENIMLNYNGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILTRSGHNRAVDWWSLGALMYDMLTGAPPFTAENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNASVRIGASPRDVLDIQRHSFFRH--INWDDLLAFKIDPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDTKLSESDNQVFLGFTYIAPSVLENIKEKFTFEPKSRSPRKVLGS-PRTPVSPLKAEVED 430          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Match: rps6kb1b (ribosomal protein S6 kinase b, polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2038])

HSP 1 Score: 382.874 bits (982), Expect = 2.965e-126
Identity = 206/407 (50.61%), Postives = 271/407 (66.58%), Query Frame = 1
Query:  142 IREEKYDEKEENQLVTQS------------IEICDQTVNP-HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGEL-------FTYLER--------EGTLMENQAC-------FYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            + +++ +E + N+L+ Q             IEI +  VN   + +    FE+L V+G+GGYGKVF VRKV+ G    K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  G  L       F++           +G +   + C       FY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKR+   RLG    D  E+++H FF+   +NWDD+L+RKVEPPFKP L+S  DVS FDS FT+Q P+ SPDDST +  +  +F GF+YVAP+V E++
Sbjct:   16 VSDDELEEAQINELMDQCSGFEFNMDDCEKIEISEDNVNQGTENIRPECFELLRVLGKGGYGKVFQVRKVS-GAATGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGLNLCFLEIDNFSFFPHSFCCCGVAKGLIQPLKCCSGLLTCSFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRH--VNWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENI 418          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Match: rps6ka2 (ribosomal protein S6 kinase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-090827-1])

HSP 1 Score: 339.347 bits (869), Expect = 6.629e-107
Identity = 189/438 (43.15%), Postives = 265/438 (60.50%), Query Frame = 1
Query:  166 KEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESA---TSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKND-VEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARF--GHTHVSECKKIVEDDVPGAQQISSNNQTKCV-PISNHSNAINGVSKSYKSPS 1458
            K E+  + +  +I        +K     FE+L V+G+G YGKVFLVRK+  G D  +LYAMKVLKKA +    +D   +K ER+IL  + HPF+VKLHYAFQ++  LY++L +  GG+LFT L +E    E    FY+AE++LA+ HLHS GIIYRDLKPEN+LLD+ GH+K+TDFGLSKE+        +FCGTIEYMAPE++ R GHT   DWWS G L+F+ML+G  PF  +  K+ T+  IL+A L  P + S +V  L++ L KRNP  RLG   D VEEIK HIFF    I+W+ +  R+++PPFKP +    D   FD  FT++ P  SP      + +  +F GFS+VA N+ +    +P  E K N    +  +    + H ++  ++ ED   GA  +      +CV  I++   A+  + +S K PS
Sbjct:   31 KLEDDSILKEFDISHHVKEGFEKADPSQFELLKVLGQGSYGKVFLVRKIK-GSDTGQLYAMKVLKKATL--KVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKE-TMALILKAKLGMPQFLSPEVQSLLRALFKRNPSNRLGAGPDGVEEIKRHIFFAT--IDWNKLYRREIKPPFKPAVGRPEDTFHFDPEFTSRTPTDSPGVPASAN-AHQLFRGFSFVATNLGQ---EQPLTEIKQNSVNPIVQQLHGNNIHFTDGYELKEDIGIGAYSVCK----RCVHRITSVEYAVKIIDRSKKDPS 454          

HSP 2 Score: 102.834 bits (255), Expect = 2.331e-22
Identity = 66/210 (31.43%), Postives = 113/210 (53.81%), Query Frame = 1
Query:  250 FEILTVIGRGGYGKV-FLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVL-LDKCG---HVKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFS 855
            +E+   IG G Y      V ++T  E     YA+K+     I R++KD   ++    +L   +HP ++ L   +     +Y+V+    GGEL   + R+    E +A   +  I+  + +LHS+G+++RDLKP N+L +D+ G    +++ DFG +K+         T C T  ++APE+L+++G+    D WSLG LL+ ML+G  PF+
Sbjct:  415 YELKEDIGIGAYSVCKRCVHRITSVE-----YAVKI-----IDRSKKDP--SEEIEILLRYGQHPNIITLKDVYDDGKFVYLVMELMRGGELLDRILRQKCFSEREASAVLCTITKTVEYLHSQGVVHRDLKPSNILYVDETGDPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGILLYTMLAGFTPFA 612          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 423.705 bits (1088), Expect = 1.304e-142
Identity = 212/357 (59.38%), Postives = 264/357 (73.95%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKV  G    K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  +++ H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDD+T +  +  +F GF+YVAP+V ESV
Sbjct:   23 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVI-GAHTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESV 375          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 423.32 bits (1087), Expect = 1.666e-142
Identity = 212/357 (59.38%), Postives = 264/357 (73.95%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKV  G    K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  +++ H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDD+T +  +  +F GF+YVAP+V ESV
Sbjct:   15 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVI-GAHTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESV 367          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 423.32 bits (1087), Expect = 4.313e-142
Identity = 212/357 (59.38%), Postives = 264/357 (73.95%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKV  G    K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  +++ H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDD+T +  +  +F GF+YVAP+V ESV
Sbjct:   44 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVI-GAHTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESV 396          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 423.705 bits (1088), Expect = 5.885e-142
Identity = 212/357 (59.38%), Postives = 264/357 (73.95%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKV  G    K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  +++ H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDD+T +  +  +F GF+YVAP+V ESV
Sbjct:   68 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVI-GAHTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESV 420          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 422.55 bits (1085), Expect = 6.092e-142
Identity = 212/357 (59.38%), Postives = 264/357 (73.95%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKV  G    K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  +++ H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDD+T +  +  +F GF+YVAP+V ESV
Sbjct:   37 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVI-GAHTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESV 389          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Match: Rps6kb1 (ribosomal protein S6 kinase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1270849])

HSP 1 Score: 427.557 bits (1098), Expect = 1.383e-143
Identity = 215/357 (60.22%), Postives = 267/357 (74.79%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKVT G +  K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  E+++H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDDST +  +  +F GF+YVAP+V ESV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 414.461 bits (1064), Expect = 4.302e-139
Identity = 205/385 (53.25%), Postives = 271/385 (70.39%), Query Frame = 1
Query:  112 SDKDSMSFGAIRE---EKYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYK-NDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            S  D    G +R    E     EE +L   S+ +  + + PH       FE+L+V+G+GGYGKVF VRKV  G +  K+YAMKVL+KA+IV + KDTAHT++ERNILE ++HPF+V+L YAFQ+   LY++L    GGELFT+LEREG  +E+ ACFY+AEI+LA+GHLHS GIIYRDLKPEN++L   GH+KLTDFGL KES      T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ T++KI++  L  P Y + D   L K  LKRNP +R+G    D  +++ H FF+   INWDD+L+R+V+PPF+P L+SE DVS FD+ FT Q P+ SPDD+  +  +   F GF+YVAP+V +S+
Sbjct:   24 SPADVCPLGELRAAGLETVGHYEEVELTESSVNLGPERIGPHC------FELLSVLGKGGYGKVFQVRKVQ-GTNLGKIYAMKVLRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKK-TMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRH--INWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSI 398          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 414.461 bits (1064), Expect = 4.302e-139
Identity = 205/385 (53.25%), Postives = 271/385 (70.39%), Query Frame = 1
Query:  112 SDKDSMSFGAIRE---EKYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYK-NDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            S  D    G +R    E     EE +L   S+ +  + + PH       FE+L+V+G+GGYGKVF VRKV  G +  K+YAMKVL+KA+IV + KDTAHT++ERNILE ++HPF+V+L YAFQ+   LY++L    GGELFT+LEREG  +E+ ACFY+AEI+LA+GHLHS GIIYRDLKPEN++L   GH+KLTDFGL KES      T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ T++KI++  L  P Y + D   L K  LKRNP +R+G    D  +++ H FF+   INWDD+L+R+V+PPF+P L+SE DVS FD+ FT Q P+ SPDD+  +  +   F GF+YVAP+V +S+
Sbjct:   24 SPADVCPLGELRAAGLETVGHYEEVELTESSVNLGPERIGPHC------FELLSVLGKGGYGKVFQVRKVQ-GTNLGKIYAMKVLRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKK-TMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRH--INWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSI 398          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 395.201 bits (1014), Expect = 7.514e-133
Identity = 196/362 (54.14%), Postives = 256/362 (70.72%), Query Frame = 1
Query:  112 SDKDSMSFGAIRE---EKYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYK-NDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDST 1176
            S  D    G +R    E     EE +L   S+ +  + + PH       FE+L+V+G+GGYGKVF VRKV  G +  K+YAMKVL+KA+IV + KDTAHT++ERNILE ++HPF+V+L YAFQ+   LY++L    GGELFT+LEREG  +E+ ACFY+AEI+LA+GHLHS GIIYRDLKPEN++L   GH+KLTDFGL KES      T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ T++KI++  L  P Y + D   L K  LKRNP +R+G    D  +++ H FF+   INWDD+L+R+V+PPF+P L+SE DVS FD+ FT Q P+ SPDD+ 
Sbjct:   24 SPADVCPLGELRAAGLETVGHYEEVELTESSVNLGPERIGPHC------FELLSVLGKGGYGKVFQVRKVQ-GTNLGKIYAMKVLRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKK-TMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRH--INWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDDTA 375          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 395.201 bits (1014), Expect = 7.514e-133
Identity = 196/362 (54.14%), Postives = 256/362 (70.72%), Query Frame = 1
Query:  112 SDKDSMSFGAIRE---EKYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYK-NDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDST 1176
            S  D    G +R    E     EE +L   S+ +  + + PH       FE+L+V+G+GGYGKVF VRKV  G +  K+YAMKVL+KA+IV + KDTAHT++ERNILE ++HPF+V+L YAFQ+   LY++L    GGELFT+LEREG  +E+ ACFY+AEI+LA+GHLHS GIIYRDLKPEN++L   GH+KLTDFGL KES      T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ T++KI++  L  P Y + D   L K  LKRNP +R+G    D  +++ H FF+   INWDD+L+R+V+PPF+P L+SE DVS FD+ FT Q P+ SPDD+ 
Sbjct:   24 SPADVCPLGELRAAGLETVGHYEEVELTESSVNLGPERIGPHC------FELLSVLGKGGYGKVFQVRKVQ-GTNLGKIYAMKVLRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKK-TMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRH--INWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDDTA 375          
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Match: sp|P23443|KS6B1_HUMAN (Ribosomal protein S6 kinase beta-1 OS=Homo sapiens OX=9606 GN=RPS6KB1 PE=1 SV=2)

HSP 1 Score: 427.943 bits (1099), Expect = 7.878e-143
Identity = 215/357 (60.22%), Postives = 267/357 (74.79%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKVT G +  K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  E+++H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDDST +  +  +F GF+YVAP+V ESV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Match: sp|P67998|KS6B1_RABIT (Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus OX=9986 GN=RPS6KB1 PE=2 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 9.068e-143
Identity = 215/357 (60.22%), Postives = 267/357 (74.79%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKVT G +  K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  E+++H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDDST +  +  +F GF+YVAP+V ESV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Match: sp|P67999|KS6B1_RAT (Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus OX=10116 GN=Rps6kb1 PE=1 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 9.676e-143
Identity = 215/357 (60.22%), Postives = 267/357 (74.79%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKVT G +  K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  E+++H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDDST +  +  +F GF+YVAP+V ESV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Match: sp|Q8BSK8|KS6B1_MOUSE (Ribosomal protein S6 kinase beta-1 OS=Mus musculus OX=10090 GN=Rps6kb1 PE=1 SV=2)

HSP 1 Score: 427.557 bits (1098), Expect = 9.676e-143
Identity = 215/357 (60.22%), Postives = 267/357 (74.79%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKVT G +  K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  E+++H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDDST +  +  +F GF+YVAP+V ESV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Match: sp|Q6TJY3|KS6B1_BOVIN (Ribosomal protein S6 kinase beta-1 OS=Bos taurus OX=9913 GN=RPS6KB1 PE=2 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 2.946e-142
Identity = 214/357 (59.94%), Postives = 266/357 (74.51%), Query Frame = 1
Query:  190 QSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            +  EI + +VN   +K+    FE+L V+G+GGYGKVF VRKVT G +  K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKRN   RLG    D  E+++H FF+   INW+++L+RKVEPPFKP L+SE DVS FDS FT Q P+ SPDDS  +  +  +F GF+YVAP+V ESV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRH--INWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSALSESANQVFLGFTYVAPSVLESV 422          
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Match: A0A4S2MBY0 (Non-specific serine/threonine protein kinase OS=Opisthorchis felineus OX=147828 GN=CRM22_001136 PE=4 SV=1)

HSP 1 Score: 533.102 bits (1372), Expect = 9.774e-179
Identity = 274/501 (54.69%), Postives = 347/501 (69.26%), Query Frame = 1
Query:   82 SLTTDNDEKESDKDS----MSFGAIREEK-YDEKEENQLVTQ------SIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLF-------------ARFGHTHVSECKKIVEDDVPGAQQISSNNQTKCVPISNHSNAINGVSKSYKSPSVIEKHNGVIKPSSSDLAL 1512
            S+  DND +  D++S       G+ R E+   +K +N+  ++      ++EIC QTVNP+ +V   +F I  VIG+GGYGKVFLV+KV  G+D+ KLYAMKVLKKAR+V NEKD AHT SERNIL+++RHPFLV+LHYAFQ+ SNLYIVL YCPGGELF YLEREG L+EN ACFY AEI LAIGHLHS GIIYRDLK ENVLLD+ GHVKLTDFGLSKE   +TNTFCGTIEYMAPEI+R EGH   VDWWSLGTLL+DMLSG PPFSQE SK+ T  KIL APLKFP  FS +V+ LI+GLL+R+PKERLG K DVEE+K H FF++++INW D+  R++ PPF+P L ++ DVS FD TFT  QP++SP +++   I  D+F GFSYV P+V E V+ EPW++     R+  +                  +H +E  +    DV  AQ + S  +   +P + HS A  G+   Y        H G ++P+S+  A+
Sbjct:    8 SVEVDNDAEAVDEESECSDAKSGSQRTERNCQQKLQNEPFSEENGRKETVEICQQTVNPNNRVGSENFMIQRVIGKGGYGKVFLVQKVD-GKDKGKLYAMKVLKKARLVCNEKDKAHTVSERNILQMLRHPFLVRLHYAFQNHSNLYIVLEYCPGGELFNYLEREGALLENAACFYTAEIILAIGHLHSLGIIYRDLKSENVLLDRQGHVKLTDFGLSKEGVGTTNTFCGTIEYMAPEIIRCEGHGKAVDWWSLGTLLYDMLSGAPPFSQEESKEATTHKILTAPLKFPPAFSPEVVSLIRGLLRRDPKERLGSKEDVEEVKRHKFFRRHEINWSDVFHRRLRPPFRPKLAADNDVSMFDPTFTRLQPVVSPAENSRP-IPPDMFQGFSYVGPSVCEEVVREPWVDADAGTRRRQYRNQAALSAGRLRRMELAPSHWNEKPQNRLGDVRPAQPVHS--ELTSLPEARHSKA-TGMYNHY------HHHRGQVRPNSTTPAV 497          
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Match: A0A419PD32 (Non-specific serine/threonine protein kinase OS=Clonorchis sinensis OX=79923 GN=Rps6kb2 PE=4 SV=1)

HSP 1 Score: 524.242 bits (1349), Expect = 1.180e-175
Identity = 262/455 (57.58%), Postives = 324/455 (71.21%), Query Frame = 1
Query:  190 QSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIR-HPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLF-------------ARFGHTHVSECKKIVEDDVPGAQQISSNNQTKCVPISNHSNAINGVSKSYKSPSVIEKHNGVIKPSSSDLAL 1512
            +++EIC QTVNP+ +V   +F I  VIG+GGYGKVFLV+KV  G+D+ KLYAMKVLKKAR+V NEKD AHT SERNIL+++R HPFLV+LHYAFQ+ SNLYIVL YCPGGELF YLEREG L+EN ACFY AEI LAIGHLHS GIIYRDLK ENVLLD+ GHVKLTDFGLSKE   +TNTFCGTIEYMAPEI+R EGH   VDWWSLGTLL+DMLSG PPFSQE SK+ T  KIL APLKFP  FS +V+ LI+GLL+R+PKERLG K DVEE+K H FF++++INW D+  R++ PPF+P L ++ DVS FD TFT  QP++SP +++   I  D+F GFSYV P+V E V+ EPW++     R+  +                  +H +E  +    D   AQ + S  +   +P + HS A  G+   Y        H G  +P+S+  A+
Sbjct:   33 ETVEICQQTVNPNNRVGSENFMIQRVIGKGGYGKVFLVQKVD-GKDKGKLYAMKVLKKARLVCNEKDKAHTVSERNILQMLRQHPFLVRLHYAFQNHSNLYIVLEYCPGGELFNYLEREGALLENAACFYTAEIILAIGHLHSLGIIYRDLKSENVLLDRQGHVKLTDFGLSKEGVGTTNTFCGTIEYMAPEIIRCEGHGKAVDWWSLGTLLYDMLSGAPPFSQEESKEATTHKILTAPLKFPPAFSPEVVSLIRGLLRRDPKERLGSKEDVEEVKRHKFFRRHEINWSDVFHRRLRPPFRPKLAADNDVSMFDPTFTRLQPVVSPAENSRP-IPPDMFQGFSYVGPSVCEEVMREPWVDGDAGTRRRQYRNQAALSAGRLRRMELAPSHWNERPQSRLGDARPAQPVHS--ELTSLPEARHSKA-TGMYNHY------HHHRGQARPNSTTPAV 476          
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Match: A0A4E0QV28 (Non-specific serine/threonine protein kinase OS=Fasciola hepatica OX=6192 GN=D915_009964 PE=4 SV=1)

HSP 1 Score: 526.554 bits (1355), Expect = 2.247e-175
Identity = 253/379 (66.75%), Postives = 301/379 (79.42%), Query Frame = 1
Query:  154 KYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIE-NKPNRRK 1287
            KY    +N    +++EIC +TVNPH +VS  +F I  VIG+GGYGKVFLV+KV  G D+ KLYAMKVLKKAR+V NEKD AHT SERNIL+++RHPFLV+LHYAFQ+ SNLYIVL YCPGGELF YLEREG L+EN ACFY+AEI LAIGHLHS GIIYRDLK ENVLLD+ GHVKLTDFGLSKE   +TNTFCGTIEYMAPEI++ EGH   VDWWSLGTLLFDMLSGGPPFSQE S++ T  KIL APLKFP  FS +V  LIKGLLKR+P+ERLG K+DVEE+K H FF++++INW D+ +R+++PPFKP L ++ D S FD TFT  QPI+SP D+ G  I  D+F GFSYVA +V E  + + W E N  +RR+
Sbjct:   48 KYGLGYDNIDGRETVEICQKTVNPHNRVSSENFNIQRVIGKGGYGKVFLVQKVD-GVDKGKLYAMKVLKKARLVCNEKDKAHTVSERNILQMLRHPFLVRLHYAFQNHSNLYIVLEYCPGGELFNYLEREGALLENAACFYVAEIVLAIGHLHSLGIIYRDLKSENVLLDRQGHVKLTDFGLSKEGVCTTNTFCGTIEYMAPEIIKYEGHGKAVDWWSLGTLLFDMLSGGPPFSQEESREATTHKILTAPLKFPPSFSPEVTSLIKGLLKRDPRERLGSKDDVEEVKRHKFFRRHEINWSDVFNRRLKPPFKPHLLADNDTSMFDPTFTRLQPIVSPSDA-GRSIPTDMFQGFSYVAQSVCEDSVRDTWAEPNSSSRRR 424          
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Match: A0A5K3FAY0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 515.383 bits (1326), Expect = 5.119e-173
Identity = 244/385 (63.38%), Postives = 305/385 (79.22%), Query Frame = 1
Query:   91 TDNDEKESDKDSMSFGAIREE--KYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAE 1239
            + N+  ++D+       I E    Y E  +N+  T+ +EIC +TVNPHKKV+  DF++L VIG+GGYG V+LV+K T   D+ K YAMKVLKKA+++RNEK+T HT SERNIL++++HPFLV+LHYAFQ++SNLYIVL YCPGGELF YLE E  LME+ ACFYI+EI+LAIGHLHS GIIYRDLKPEN+LLDK GHVKLTDFGLSKE   +TNTFCGTIEYMAPEI+R  GH   VDWWSLGTLLFDMLSGGPPFSQE +K+ T EKIL++ +KFP  FS + + LI+GLLK++PKERLG KNDVE+IK H FF +  +NWDD+ +RK+EPPFKP+L S++DVS FD +FT  +PI+SP ++  T I  D+F GFS+VA +V E
Sbjct:   26 SSNESAQADEHIPKMKEIEEHINNYSEALQNRPGTEVLEICGETVNPHKKVNAEDFQVLKVIGKGGYGTVYLVQKATKSPDKDKFYAMKVLKKAKLIRNEKNTMHTLSERNILQMLKHPFLVRLHYAFQNRSNLYIVLEYCPGGELFRYLETECFLMEDAACFYISEIALAIGHLHSLGIIYRDLKPENILLDKDGHVKLTDFGLSKEGVCTTNTFCGTIEYMAPEIIRCAGHGRAVDWWSLGTLLFDMLSGGPPFSQEGNKKATAEKILKSQVKFPPSFSTEAIHLIRGLLKKDPKERLGTKNDVEDIKQHSFFVQRGVNWDDVYNRKMEPPFKPELASDSDVSMFDPSFTGMKPIVSPGNTDDT-IPVDLFQGFSFVASSVVE 409          
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Match: A0A3Q0KTP5 (Non-specific serine/threonine protein kinase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 9.490e-173
Identity = 258/429 (60.14%), Postives = 316/429 (73.66%), Query Frame = 1
Query:   97 NDEKESDKDSMSFGAIREEKYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKT----------LFARFGHTHVSECKKIVEDDV 1353
            N+ K SD+ S      +E    E +E     +++EIC +TVNP+ +V+  +F+I  VIG+GGYGKVFLV+KV  G D+ KLYAMKVLKKAR+V NEKD AHT SERNILE+++HPFLVKLHYAFQ+ SNLYIVL YC GGELF YLEREG L+EN ACFY +EI LAIGHLHS GIIYRDLK ENVLLD+ GHVKLTDFGLSKE   +TNTFCGTIEYMAPEI+R EGH   VDWWSLGTL++DMLSG PPFSQE S++ T  KIL APLKFP  FS +V+ LI+GLLKR+P ERLG K D+EEIK   FF++++INW D+ +R+++PPF+P L +E DVS FD +FT  QP++SP D  G  I  D+F GFSYVAP+V E  L + W +N P+R +              R G  H++   +I ED V
Sbjct:   33 NNTKSSDQLS------KELICSENKEEITTQETVEICQKTVNPNNRVNAENFKIQRVIGKGGYGKVFLVQKVD-GIDQGKLYAMKVLKKARLVCNEKDKAHTVSERNILEMLQHPFLVKLHYAFQNHSNLYIVLEYCHGGELFNYLEREGALLENAACFYASEIVLAIGHLHSLGIIYRDLKSENVLLDRQGHVKLTDFGLSKEGVCTTNTFCGTIEYMAPEIIRCEGHGKAVDWWSLGTLIYDMLSGTPPFSQEESREATTRKILTAPLKFPPSFSSEVISLIRGLLKRDPNERLGSKEDMEEIKRQKFFKRHEINWSDVYNRRLKPPFRPKLTAENDVSMFDPSFTRLQPVVSPVDG-GASIPPDMFQGFSYVAPSVCEDSLRDNWTDNLPSRHRRHGLRGAMSAGRLRRIGFGHLNAPNRIPEDIV 453          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Match: rps6kb1b (ribosomal protein S6 kinase B1 [Source:NCBI gene;Acc:103035647])

HSP 1 Score: 426.017 bits (1094), Expect = 1.829e-143
Identity = 213/357 (59.66%), Postives = 266/357 (74.51%), Query Frame = 1
Query:  190 QSIEICDQTVNP-HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            + IEI + +VN   + +    FE+L V+G+GGYGKVF VRKVT G    K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKR+   RLG    D  E+++H FF+   INWDD+L+RKVEPPFKP L+S  DVS FDS FT+Q P+ SPDDST +  +  +F GF+YVAP+V E++
Sbjct:   41 EKIEISEDSVNQGTESIRPECFELLRVLGKGGYGKVFQVRKVT-GGGSGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRH--INWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENI 393          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Match: ENSAMXT00000004157.2 (ribosomal protein S6 kinase B2 [Source:NCBI gene;Acc:103031203])

HSP 1 Score: 424.091 bits (1089), Expect = 3.201e-143
Identity = 212/380 (55.79%), Postives = 275/380 (72.37%), Query Frame = 1
Query:  169 EENQLVTQSIEICDQTVN-PHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTL 1293
            E   L T+ +E+  + VN   ++V    FE+LTV+G+GGYGKVF VRKV  G    K++AMKVL+KA+IVRN KDTAHT++ER ILE +RHPF+V L YAFQ+   LY++L    GGELF  LE+EG  ME+ ACFY+AEI+LA+GHLHS GIIYRDLKPEN++L+  GH+KLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L+FDM++G PPF+ E+ K+ TI+KIL+  +  P Y + D   LIK LLK+NP +RLG  K D  +I+ H FF+   INWDD+L ++VEPP++P L+S+ DVS FDS FT Q P+ SPDD+T +  ++  F GF+YVAP+V ES+     +E +P   + L
Sbjct:   28 ESEPLETEEVELTSEVVNRDSERVGPDCFELLTVLGKGGYGKVFQVRKVQ-GSQMGKIFAMKVLRKAKIVRNAKDTAHTRAEREILETVRHPFIVDLWYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLAEITLALGHLHSNGIIYRDLKPENIMLNHEGHIKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILNRSGHNRAVDWWSLGALMFDMMTGSPPFTGENRKK-TIDKILKCKICLPPYLTPDARDLIKKLLKKNPSQRLGSGKGDCADIQKHPFFRH--INWDDLLHKRVEPPYRPSLQSDEDVSQFDSRFTRQTPVDSPDDTTLSGSADHAFAGFTYVAPSVLESLKEGFSVEPRPRPVRRL 403          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Match: rps6kb1b (ribosomal protein S6 kinase B1 [Source:NCBI gene;Acc:103035647])

HSP 1 Score: 425.246 bits (1092), Expect = 3.697e-143
Identity = 213/357 (59.66%), Postives = 266/357 (74.51%), Query Frame = 1
Query:  190 QSIEICDQTVNP-HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            + IEI + +VN   + +    FE+L V+G+GGYGKVF VRKVT G    K++AMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKR+   RLG    D  E+++H FF+   INWDD+L+RKVEPPFKP L+S  DVS FDS FT+Q P+ SPDDST +  +  +F GF+YVAP+V E++
Sbjct:   44 EKIEISEDSVNQGTESIRPECFELLRVLGKGGYGKVFQVRKVT-GGGSGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRH--INWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENI 396          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Match: rps6kal (ribosomal protein S6 kinase a, like [Source:NCBI gene;Acc:337670])

HSP 1 Score: 333.183 bits (853), Expect = 3.256e-105
Identity = 182/408 (44.61%), Postives = 250/408 (61.27%), Query Frame = 1
Query:  250 FEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKND-VEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARFGHTHVSECKKIVEDDVPGAQQISSNNQTKCV-PISNHSNAINGVSKSYKSPS 1458
            FE+L V+G+G +GKVFLVRK+  G D  +LYAMKVLKKA +    +D   TK ER+IL  + HPF+VKLHYAFQ++  LY++L +  GG++FT L +E    E    FY+AE++LA+ HLH+ GI+YRDLKPEN+LLD+ GH+KLTDFGLSKES        +FCGT+EYMAPE++ R GHT   DWWSLG L+F+ML+G  PF Q   +  T+  IL+A L  P + SL+   L++ L KRNP  RLG   D VEEIK H FF  + I+W+ +  ++++PPFKP      D  CFD  FT + P  SP      + +  +F GFS+VAP   E   S P+     N    +    G    S+  ++ ED   G+  I      +C+  ++    A+  + KS + PS
Sbjct:   69 FELLKVLGQGSFGKVFLVRKIM-GPDAGQLYAMKVLKKASL--KVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVMFTEEDVKFYLAELALALDHLHNLGIVYRDLKPENILLDEAGHIKLTDFGLSKESVDQDRKAYSFCGTVEYMAPEVVNRRGHTQSADWWSLGVLMFEMLTGTLPF-QGKDRNETMNMILKAKLGMPQFLSLEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHAFF--STIDWNKLYRQELQPPFKPAAGKPDDTFCFDPEFTAKTPKDSPGIPPSAN-AHQLFKGFSFVAPASLEESKSSPF-----NILPIVQMHSGAAQFSDVYELKEDIGVGSYSICK----RCIHRVTAMEFAVKIIDKSKRDPS 460          

HSP 2 Score: 97.0561 bits (240), Expect = 1.132e-20
Identity = 62/210 (29.52%), Postives = 109/210 (51.90%), Query Frame = 1
Query:  250 FEILTVIGRGGYGKV-FLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVL-LDKCGH---VKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFS 855
            +E+   IG G Y      + +VT  E     +A+K++ K++  R+  +         ++   +HP ++ L   +     +Y+V     GGEL   + R+    E +A   +  I+  + +LH +G+++RDLKP N+L +D  G+   +++ DFG +K+         T C T  ++APE+L R+G+    D WSLG LL+ ML+G  PF+
Sbjct:  421 YELKEDIGVGSYSICKRCIHRVTAME-----FAVKIIDKSK--RDPSEEIEI-----LMRYGQHPNIITLKDVYDEGRFVYLVTELMKGGELLDKILRQKFFSEREASAVLYTITKTVDYLHCQGVVHRDLKPSNILYMDDSGNPDSIRICDFGFAKQLRGDNGLLLTPCYTANFVAPEVLMRQGYDAACDIWSLGVLLYTMLAGYTPFA 618          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Match: rps6kal (ribosomal protein S6 kinase a, like [Source:NCBI gene;Acc:337670])

HSP 1 Score: 333.954 bits (855), Expect = 4.698e-105
Identity = 182/408 (44.61%), Postives = 250/408 (61.27%), Query Frame = 1
Query:  250 FEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKND-VEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARFGHTHVSECKKIVEDDVPGAQQISSNNQTKCV-PISNHSNAINGVSKSYKSPS 1458
            FE+L V+G+G +GKVFLVRK+  G D  +LYAMKVLKKA +    +D   TK ER+IL  + HPF+VKLHYAFQ++  LY++L +  GG++FT L +E    E    FY+AE++LA+ HLH+ GI+YRDLKPEN+LLD+ GH+KLTDFGLSKES        +FCGT+EYMAPE++ R GHT   DWWSLG L+F+ML+G  PF Q   +  T+  IL+A L  P + SL+   L++ L KRNP  RLG   D VEEIK H FF  + I+W+ +  ++++PPFKP      D  CFD  FT + P  SP      + +  +F GFS+VAP   E   S P+     N    +    G    S+  ++ ED   G+  I      +C+  ++    A+  + KS + PS
Sbjct:   60 FELLKVLGQGSFGKVFLVRKIM-GPDAGQLYAMKVLKKASL--KVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVMFTEEDVKFYLAELALALDHLHNLGIVYRDLKPENILLDEAGHIKLTDFGLSKESVDQDRKAYSFCGTVEYMAPEVVNRRGHTQSADWWSLGVLMFEMLTGTLPF-QGKDRNETMNMILKAKLGMPQFLSLEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHAFF--STIDWNKLYRQELQPPFKPAAGKPDDTFCFDPEFTAKTPKDSPGIPPSAN-AHQLFKGFSFVAPASLEESKSSPF-----NILPIVQMHSGAAQFSDVYELKEDIGVGSYSICK----RCIHRVTAMEFAVKIIDKSKRDPS 451          

HSP 2 Score: 97.0561 bits (240), Expect = 1.347e-20
Identity = 62/210 (29.52%), Postives = 109/210 (51.90%), Query Frame = 1
Query:  250 FEILTVIGRGGYGKV-FLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVL-LDKCGH---VKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFS 855
            +E+   IG G Y      + +VT  E     +A+K++ K++  R+  +         ++   +HP ++ L   +     +Y+V     GGEL   + R+    E +A   +  I+  + +LH +G+++RDLKP N+L +D  G+   +++ DFG +K+         T C T  ++APE+L R+G+    D WSLG LL+ ML+G  PF+
Sbjct:  412 YELKEDIGVGSYSICKRCIHRVTAME-----FAVKIIDKSK--RDPSEEIEI-----LMRYGQHPNIITLKDVYDEGRFVYLVTELMKGGELLDKILRQKFFSEREASAVLYTITKTVDYLHCQGVVHRDLKPSNILYMDDSGNPDSIRICDFGFAKQLRGDNGLLLTPCYTANFVAPEVLMRQGYDAACDIWSLGVLLYTMLAGYTPFA 609          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 288.886 bits (738), Expect = 7.545e-92
Identity = 149/336 (44.35%), Postives = 219/336 (65.18%), Query Frame = 1
Query:  247 DFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNIL-EIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESA---TSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHI-------SEDIFTGFSYV 1221
            DF+ LTV+G+G +GKV L +  + G      YA+KV+KK+ I+  +K+  H  +ERN+L + +RHPFLV LHY+FQS   LY V+ Y  GGELF +L+R+G+  E++A FY AEI  AIG+LHS  I+YRDLKPEN+LLD  GH+ LTDFGL KE     ++T TFCGT EY+APE+L++  +   VDWW LG +L++ML G PPF  ++ KQ+  E IL  PL+     +   + +++GLL ++P +RLG  +D+ EIK+H+FF  + INW+D+ ++++  P+ P +    D+  FD  FT +   +S   S+ T         + D F GF+Y+
Sbjct:   91 DFDFLTVLGKGSFGKVLLAKHKSDG----IFYAVKVMKKS-IILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQM-YESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLGATSDILEIKNHVFF--STINWNDLDAKRIPSPYNPGVSGPCDLHNFDPAFTAEPLSMSMAQSSDTSSVCANVDEAADAFVGFTYM 418          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.092 bits (697), Expect = 3.171e-85
Identity = 150/344 (43.60%), Postives = 207/344 (60.17%), Query Frame = 1
Query:  223 PHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHS-KGIIYRDLKPENVLLDKCGHVKLTDFGLSKESAT---STNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYK-NDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISED-----IFTGFSYVA 1224
            P  KV+M +F+ L ++G+G +GKV LVR+   G+     YAMK+LKK  IV  + + AHT +E  +L+  +HPFL  L Y+FQ+   L  V+ Y  GGELF +L RE    E++  FY AEI  A+ +LH+ K ++YRDLK EN++LDK GH+K+ DFGL KE  T   +  TFCGT EY+APE+L    +   VDWW LG ++++M+ G  PF  +  ++L  E IL   ++FP   S D   L+ GLLK++PK+RLG   +D +EI  H FF    I W D+  RK+ PPFKP + SE D   FD  FT Q   ++P D   +  S D      F  FSY A
Sbjct:  141 PKSKVTMNNFDYLKLLGKGTFGKVILVREKATGQ----YYAMKILKKEVIVAKD-EVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKL-FELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFA--GIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITITPPDRFDSMESLDNERRPHFPQFSYCA 476          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.498 bits (602), Expect = 1.173e-73
Identity = 119/263 (45.25%), Postives = 171/263 (65.02%), Query Frame = 1
Query:  343 AMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLG-YKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFD 1128
            ++K  K+ ++V+  K   HT +E+ IL+ I  PFLV+L Y+F+  SNLY+VL Y PGGE+F++L R G   E  + FY A+I LA  +LHS  +IYRDLKPEN+L+D+ G++++TDFG +K     T T CGT EY+APEI+  +G+   VDWW+LG L+++M +G PPF  +   Q+  EKI+   ++FP +FS D+  L++ LL+ +  +R G  KN V +IK+H +F   D  W  I  RKVE PF P  K   D S FD
Sbjct:    8 SLKATKRTKVVK-LKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQI-YEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTD--WIAIYQRKVEAPFIPKCKGPGDASNFD 266          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004683.1 (pep scaffold:Pmarinus_7.0:GL488517:199:5283:1 gene:ENSPMAG00000004265.1 transcript:ENSPMAT00000004683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.823 bits (499), Expect = 4.177e-60
Identity = 93/178 (52.25%), Postives = 123/178 (69.10%), Query Frame = 1
Query:  463 AFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESA---TSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLG 987
            AFQ++  LY++L +  GG+LFT L +E    E    FY+AE++LA+ HLHS GIIYRDLKPEN+LLD+ GH+ LTDFGLSKES        +FCGT+EYMAPE++ R+GHT   DWWS G L+F+ML+G  PF  +  K+ T+  IL+A L  P + S +   L++ L KRNP  RLG
Sbjct:    1 AFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDESGHIGLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRKGHTHSADWWSFGVLMFEMLTGTLPFQGKDRKE-TMTMILKAKLGMPQFLSGEAQSLLRMLFKRNPGNRLG 177          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Match: mast2 (microtubule associated serine/threonine kinase 2 [Source:ZFIN;Acc:ZDB-GENE-050309-150])

HSP 1 Score: 210.305 bits (534), Expect = 3.149e-58
Identity = 128/339 (37.76%), Postives = 191/339 (56.34%), Query Frame = 1
Query:  223 PHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKAR-IVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNT------------------FCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPM---YFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDS 1173
            P KK    DFE + +I  G YG V+LVR     ++ ++ +AMK + K   I+RN+   A    ER+IL    +PF+V +  +F+++ +L +V+ Y  GG+  T L+  G L  + A  Y AE  LA+ +LH+ GI++RDLKP+N+L+   GHVKLTDFGLSK    S  T                   CGT EY+APE++ R+G+   VDWW++G +L++ L G  PF  ++ ++L   +++   + +P        DV  LI GLL+RNP ERLG      E+K H FF  + ++WD +L +K E  F P L+SE D S FD+       + S DD+
Sbjct:  205 PKKKPCEEDFETIKLISNGAYGAVYLVRH----KETRQRFAMKKINKQNLILRNQIQQAFV--ERDILTFAENPFVVGMFCSFETKRHLCMVMEYVEGGDCATLLKNLGALPVDMAQLYFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHVKLTDFGLSKIGLMSLTTNLYEEHIEKDTREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGVILYEFLVGCVPFFGDTPEEL-FGQVISDEIVWPEGEDALPSDVQDLITGLLERNPLERLGTGGAF-EVKQHQFF--HSLDWDGLLRQKAE--FVPQLESEEDTSYFDTRSDRYHHLDSEDDT 531          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 282.722 bits (722), Expect = 6.171e-87
Identity = 152/343 (44.31%), Postives = 219/343 (63.85%), Query Frame = 1
Query:  205 CDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSK---ESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVA 1224
             D   + +K +S+ DF++L VIG+G +GKV  VRK    +D +K+YA+K L+KA IV ++ +  HT +ER +L  +  PF+V L ++FQS   LY+VL +  GGELF +L+ EG     ++ FYIAE+  A+  LH   +IYRDLKPEN+LLD  GH+ L DFGL K   +    T+TFCGT EY+APEIL  +G+T  VDWW+LG LL++M++G PP+  E+   +  +KIL+ PL FP  F      L+ GLL R+P  RLG  N  +EI++H FF+  DI+W  +L +   PP+KP +KSE D + FD  FT ++PI S  D   +   +  F G++Y+ 
Sbjct:  329 VDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRK----KDTQKIYALKALRKAYIV-SKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVP-VMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGV-NGTDEIRNHPFFK--DISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASIQKQFGGWTYIG 662          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 281.952 bits (720), Expect = 1.573e-86
Identity = 147/336 (43.75%), Postives = 216/336 (64.29%), Query Frame = 1
Query:  226 HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSK---ESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVA 1224
            +K +S+ DF++L VIG+G +GKV  VRK    +D +K+YA+K ++K+ IV ++ +  HT +ER +L  +  PF+V L ++FQS   LY VL +  GGELF +L++EG    ++A FY AE+  A+ +LH   ++YRDLKPEN+LLD  GH+ L DFGL K   +    T+TFCGT EY+APE+L   G+T  VDWW+LG LL++ML+G PP+  E   ++  +KIL+ PL FP  F  D   L+ GLL R+P  RLGY N  +EI++H FF +  ++W  +L +   PP+KP + +  D S FD  FT ++PI S  D   +   +  F G++YV 
Sbjct:  339 NKPLSIDDFDLLKVIGKGSFGKVMQVRK----KDTQKVYALKAIRKSYIV-SKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKM-YKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLGY-NGADEIRNHPFFSQ--LSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVVDEYLSESVQKQFGGWTYVG 665          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 283.493 bits (724), Expect = 6.816e-86
Identity = 156/342 (45.61%), Postives = 220/342 (64.33%), Query Frame = 1
Query:  247 DFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEII---RHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATS-TNTFCGTIEYMAPEILRRE-GHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPM-YFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTN--------QQPILSPDDSTGTHISEDI---FTGFSYV 1221
            DFE+L ++G+G +G+V+ V+K    +D +++YAMKVL K  IV+ + + AHT  ERNIL        PF+V L ++FQ+ ++LY+V  Y  GGELF +L++EG   E++A FYIAE+ LA+ HLH   I+YRDLKPEN+LLD  G++ L DFGLSK      TNTFCGT EY+APE+L  E G+T +VD+WSLG L+F+M  G  PF  E+++++  +KI    +KFP    S +    +KGLL RNPK RLG  +D  E+++H FF   DI+W+ +  +K+ PPFKP L SE D S FD  FT          QP++     T T +S  +   F GF++V
Sbjct:  411 DFEVLRLLGKGTFGQVYQVKK----KDTQRIYAMKVLSKKVIVK-KNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAENNQKM-YQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFA--DIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSYMNKHQPMM-----TATPLSPAMQAKFAGFTFV 739          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 256.914 bits (655), Expect = 3.480e-80
Identity = 134/326 (41.10%), Postives = 203/326 (62.27%), Query Frame = 1
Query:  157 YDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLG-YKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKS-EADVSCFD 1128
            Y+E++  Q + Q+            K S+ DF+IL  +G G +G+V L+R    G    + YAMKVLKK  +VR  K   HT  ER +L I+ HPF++++   FQ    +++++ Y  GGELF+ L +        A FY AE+ LA+ +LHSK IIYRDLKPEN+LLDK GH+K+TDFG +K     T T CGT +Y+APE++  + +   +DWWS G L+++ML+G  PF  +S+   T EKIL A L+FP +F+ DV  L+  L+ R+  +RLG  +N  E++K+H +F+  ++ W+ +LSR +E P++P ++  + D S FD
Sbjct:   63 YNEEQYKQFIAQARVTSG-------KYSLQDFQILRTLGTGSFGRVHLIRSRHNG----RYYAMKVLKKEIVVRL-KQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFY-DSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFK--EVVWEKLLSRNIETPYEPPIQQGQGDTSQFD 373          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 254.218 bits (648), Expect = 4.010e-79
Identity = 130/301 (43.19%), Postives = 191/301 (63.46%), Query Frame = 1
Query:  232 KVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLG-YKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKS-EADVSCFD 1128
            K S+ DF+IL  +G G +G+V L+R    G    + YA+K LKK  IV+  K   HT  ER +L I+ HPF++++   FQ    +++V+ Y  GGELF+ L +        A FY AE+ LA+ +LHSK IIYRDLKPEN+LLDK GH+K+TDFG +K     T T CGT +Y+APE++  + +   VDWWS G L+++ML+G  PF   ++ + T E IL A LKFP +F  D   L+K L+ R+  ERLG  +N  E++K+H +F  N++ W+ +L+R +E P++P ++  + D S FD
Sbjct:   82 KYSLSDFQILRTLGTGSFGRVHLIRSNHNG----RFYALKTLKKHTIVK-LKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMK-TYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWF--NEVIWEKLLARYIETPYEPPIQQGQGDTSQFD 374          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 420.239 bits (1079), Expect = 9.236e-143
Identity = 215/409 (52.57%), Postives = 284/409 (69.44%), Query Frame = 1
Query:   82 SLTTDNDEKESDKDSMSFGAIREEKYDEKEENQLVTQSIEICDQTVNPH-KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESA---TSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERL-GYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLS----EPWIENKPNR 1281
            +L    DE  SD D    G +    YDE  +     +++++ ++TVNP  +KV    FE+L V+G+GGYGKVFLV+K   G  ++K++AMKVLKKA I+R++KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  +E+ ACFY++EIS+A+ HLH +GI+YRDLKPEN+LLD  GHVKLTDFGL KES    + T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF  ++ K+ TI+KIL+  L  P Y + +    I+ LLKR+P+ RL G   D   IK+H FF+   I W+D+L++KVEPPF+P +  E DVS FDS FT Q P+ SPDDS  +  + +IF GF+YVAP+V ES+       PW    P +
Sbjct:   13 ALAAGEDELSSD-DEFDEGQV----YDEPMDGDERMETLQLSEETVNPKDEKVGPESFELLKVLGKGGYGKVFLVKK-NHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKK-TIDKILKGKLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRH--ICWEDLLAKKVEPPFRPSISGEEDVSQFDSKFTRQTPVDSPDDSMLSESASNIFQGFTYVAPSVLESLCRSDNFSPWKVRSPRK 412          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Match: EDO31895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM6])

HSP 1 Score: 319.316 bits (817), Expect = 2.117e-101
Identity = 173/382 (45.29%), Postives = 233/382 (60.99%), Query Frame = 1
Query:  229 KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESA--TSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKN-DVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPD--DSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARF------GHTHVSECKKIV 1341
            KK     FE+L V+G+G +GKVFLVRKV  G D   LYAMKVLKKA +    +D   T  ER+IL  ++HPF+V+L+YAFQ++  +Y++L +  GG+LFT L +E    E    FY+AE++LA+ HLH  GIIYRDLKPEN+LLD  GHV LTDFGLSKES     T +FCGT+EYMAPE++ R GH+   DWWS G L+F+ML+G  PF Q   ++ T+  IL+A L  P + + +   L++ L KRNP  RLG  +  +E+IK H FF  + INW+ +  R+++PPFKP      D   FD  FT++ P  SP    S   H    +F GFSYVAP++ E     P     P R   +   +      G    S C++ V
Sbjct:    2 KKADPSQFELLKVLGQGSFGKVFLVRKVI-GADAGTLYAMKVLKKATL--KVRDRMRTMKERDILVDVQHPFIVRLNYAFQTEGKVYLILDFLRGGDLFTRLSKEIMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDASGHVALTDFGLSKESEHDQKTYSFCGTVEYMAPEVVNRRGHSQAADWWSYGVLMFEMLTGSLPF-QGKDRKDTMNMILKAKLGMPQFLTPEAQSLLRQLFKRNPLNRLGAGDLGIEDIKKHPFF--STINWELLYKREIKPPFKPAAGRADDAFYFDPEFTSKTPQDSPAVPPSATCH---QLFRGFSYVAPDIVEVETRGPAARAFPIRTTCILDEYEIKEEIGKGAYSSCRRCV 374          

HSP 2 Score: 107.842 bits (268), Expect = 1.342e-24
Identity = 70/219 (31.96%), Postives = 117/219 (53.42%), Query Frame = 1
Query:  223 PHKKVSMID-FEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLL-DKCG---HVKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFS 855
            P +   ++D +EI   IG+G Y      R+     D K+ YA+K+ +K +     KD   ++    +L    HP +V L  A+++   +YIV+    GGEL   + +   L E +A   +  ++  I  LH +G+++RDLKP N++  D  G    +++ DFG +K+   +     T C T  ++APE+L+++G+    D WSLG LL+ MLSG  PF+
Sbjct:  346 PIRTTCILDEYEIKEEIGKGAYSSC---RRCVNKADGKE-YAVKIFEKPK-----KDP--SEEMEILLRFGHHPNIVHLRDAYEAGKQVYIVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAKQMRATNGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGVLLYTMLSGLTPFA 553          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Match: EDO39163 (Ribosomal protein S6 kinase [Source:UniProtKB/TrEMBL;Acc:A7SAZ2])

HSP 1 Score: 305.449 bits (781), Expect = 2.679e-94
Identity = 162/364 (44.51%), Postives = 231/364 (63.46%), Query Frame = 1
Query:  229 KKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRH-PFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTN-----TFCGTIEYMAPEILR--REGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIE---KILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRK 1287
            +KV + +FE+L V+G G YGKVFL RK   G  + +L+AMKVLKKA IV+  K   HT++ER +LE +R  PFLV LH+AFQ+++ L++++ Y  GGELFT+L +     E++   YI EI +A+ HLH  GIIYRD+K EN+LLDK GHV LTDFGLSKE A   +     +FCGTIEYMAPE+++    GH   VDWWSLG L++++L+G  PF+ +  K    E   +IL      P   S + + L+  LL+++PK+RLG K    E+K+H FF+  D  W D+  +++  PFKP ++ E DVS F   FT+  P  SP     T  ++ +F G+S+VAP++   +  E     +P +RK
Sbjct:    9 EKVGIENFELLRVLGTGAYGKVFLARK-RGGHHDGRLFAMKVLKKATIVQKAKTAEHTRTERQVLEAVRRCPFLVTLHWAFQTEAKLHLIMDYVNGGELFTHLYQREKFTEDEVRLYIGEIVVALDHLHQLGIIYRDIKLENILLDKDGHVVLTDFGLSKEFAAPNSGERAYSFCGTIEYMAPEVVKGGSRGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQSEISKRILHNNPPMPHDLSAEAIDLLHKLLQKDPKKRLGAKG-AHELKAHPFFKAFD--WADLAEKRIPAPFKPRIRDELDVSNFSEEFTDMAPTYSPAAVPKT--ADRVFRGYSFVAPSI---IFGENEFNQQPVQRK 363          

HSP 2 Score: 112.464 bits (280), Expect = 6.216e-26
Identity = 77/274 (28.10%), Postives = 134/274 (48.91%), Query Frame = 1
Query:  265 VIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLL---DKCGHVKLTDFGLS--KESATSTNTFCGTIEYMAPEILRR----EGHTFVVDWWSLGTLLFDMLSGGPPFSQ-----ESSKQLTIEKILRAPLKFP----MYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQ 1032
            V+G G +        +  G++    YA+K++ +           HT+  +++     HP +V L+  +Q + + Y+V+    GGEL   + ++    E+ A   + +I  A+  +H +G+++RDLKPEN+L     +   +K+ DFG +  K  A    T C T+ Y APE+L +     G+    D WSLG +L+ MLSG  PF       +SS    +++I +  ++F        S     LI+GLL  +P +RL     V+E+  H + +
Sbjct:  401 VLGDGSFSTCRRCVHLRSGQE----YAVKIISRR--------CDHTREVQSLKMCHGHPNIVTLYDVYQDEFHTYLVMELLAGGELLERIRKKKMFTESAASVIMRKIVSAVEFMHQRGVVHRDLKPENLLFVDNSEDAEIKIVDFGFACVKPEAQQLQTPCFTLSYAAPEVLDQTVSNSGYDESCDLWSLGVILYTMLSGQVPFQSSGSWYKSSTGFVMQRITQGDVRFDGQQWQSISPQAKDLIQGLLTVDPSQRL----TVQEVLRHDWLR 658          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 285.804 bits (730), Expect = 1.224e-90
Identity = 170/424 (40.09%), Postives = 249/424 (58.73%), Query Frame = 1
Query:    4 ESLNIFTK*FLLLQMHGSLEYINTYDSLTTDNDEKESDKDSMSFGAIREEKYDEKEENQLVTQSIEICD--QTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNIL-EIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPI-----LSPDD---STGTHISEDIFTGFSYVAPN 1230
            E LN F     +L   G+L++ +  + L+ DN +               +  DE E+       +E  D  ++ NP  K S  DF  L VIG+G +GKVFL +     + E K YA+KVL K+ I R   +  H  +ERN+L + + HPFLV LHY+FQ++  LY VL Y  GGELF +L+RE    E++A FY AEI+ AIG+LH   IIYRDLKPEN+LLD  GH+ LTDFGL KE    + +T+TFCGT EY+APE+LR++ +   VDWW LG +L++M+ G PPF    + ++  + IL  PL+     S     +++GLL+++  +RLG  + D E+I++H FF+   INW  +++R +EPP+ P++  + D+  FD  F  ++P+      S D    S      +D F GF+YVAP+
Sbjct:    7 EGLNDFI--VKILTHPGALDHPDVREFLSLDNPKNA-------------QANDEDEQPGSDDADVEKIDLGESNNPKAKPS--DFLFLKVIGKGSFGKVFLSKN----KQEDKFYAIKVLNKSAI-RKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEM-YDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRS--INWQQLVARGIEPPYNPNVSGQLDLKHFDPEFV-REPVPGSVGKSADSNFVSASVDDPDDAFVGFTYVAPS 404          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Match: EDO44938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU22])

HSP 1 Score: 268.085 bits (684), Expect = 4.400e-82
Identity = 144/346 (41.62%), Postives = 209/346 (60.40%), Query Frame = 1
Query:  235 VSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILE-IIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFS--------QESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY--KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTH-ISEDIFTGFSYVAP 1227
            +S+ DF ++ VIGRG Y KV LV      +  K++YAMKV+KK  +V +++D    ++E+++ E    HPFLV LH  FQ+ S L+ V+ Y  GG+L  +++R+  L E+ A FY AEI  A+  LH KG+IYRDLK +NVLLD  GH+KLTD+G+ KE       T+TFCGT  Y+APEILR E + F VDWW+LG LL++ML+G  PF          ++++    + IL  P++ P   S+    ++KG L +NP ERLG   +    +I SH FF+   ++W+ + +R+V PPFKP  +    +  FD  FTN+    +PDD      I +  F GF Y+ P
Sbjct:  217 ISVNDFNLIRVIGRGSYAKVMLVEL----KKTKRIYAMKVVKK-ELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVLLDSDGHIKLTDYGMCKEGIRPGDVTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDIVGSADNPDQNTEDYLFQVILEKPIRIPRSLSVKAASILKGYLNKNPTERLGCHPQTGFADITSHAFFRT--VSWEQLEARQVTPPFKPRQEDPYGLENFDPQFTNEDVQFTPDDPKMLETIDQTEFEGFEYINP 555          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Match: rps6kb1a (ribosomal protein S6 kinase beta-1 [Source:NCBI gene;Acc:101174287])

HSP 1 Score: 426.017 bits (1094), Expect = 1.198e-143
Identity = 224/401 (55.86%), Postives = 275/401 (68.58%), Query Frame = 1
Query:  250 FEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERL-GYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARFGHTHVSECKKIVEDDVPGAQQISSNNQTKCVPISNHSNAINGVSK 1440
            FE+L V+G+GGYGKVF VRKV+ G    K+YAMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKR+   RL G   D  E++ H FF+   INWDD+L+RKVEPPFKP L+S  DVS FDS FT+Q P+ SPDDST +  +  +F GF+YVAP+V E+V  +   E K  R    F     T +S  K    D        S N  T C     H   ++GV +
Sbjct:   39 FELLKVLGKGGYGKVFQVRKVS-GASSGKIYAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLSLPPYLTQEARDLLKKLLKRSASSRLGGGPGDAAEVQVHPFFRH--INWDDLLARKVEPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENVKEKFSFEPK-LRSPRKFPGSPRTLLSPLKFSGGDSWLRGPLPSGNPSTVCPGSGEHPMEVSGVEQ 434          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Match: rps6kb1a (ribosomal protein S6 kinase beta-1 [Source:NCBI gene;Acc:101174287])

HSP 1 Score: 426.017 bits (1094), Expect = 1.738e-143
Identity = 224/401 (55.86%), Postives = 275/401 (68.58%), Query Frame = 1
Query:  250 FEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERL-GYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARFGHTHVSECKKIVEDDVPGAQQISSNNQTKCVPISNHSNAINGVSK 1440
            FE+L V+G+GGYGKVF VRKV+ G    K+YAMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKR+   RL G   D  E++ H FF+   INWDD+L+RKVEPPFKP L+S  DVS FDS FT+Q P+ SPDDST +  +  +F GF+YVAP+V E+V  +   E K  R    F     T +S  K    D        S N  T C     H   ++GV +
Sbjct:   49 FELLKVLGKGGYGKVFQVRKVS-GASSGKIYAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLSLPPYLTQEARDLLKKLLKRSASSRLGGGPGDAAEVQVHPFFRH--INWDDLLARKVEPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENVKEKFSFEPK-LRSPRKFPGSPRTLLSPLKFSGGDSWLRGPLPSGNPSTVCPGSGEHPMEVSGVEQ 444          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Match: RPS6KB2 (ribosomal protein S6 kinase beta-2 [Source:NCBI gene;Acc:101163545])

HSP 1 Score: 424.091 bits (1089), Expect = 3.672e-143
Identity = 209/364 (57.42%), Postives = 269/364 (73.90%), Query Frame = 1
Query:  169 EENQLVTQSIEICDQTVN-PHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            E   + T+ +E+  + VN   ++V    FE+LTV+G+G YGKVF VRKV  G    K++AMKVLKKA+IVRN KDTAHT++ER ILE +RHPF+V L YAFQ+   LY++L    GGELF  LE+EG  ME+ ACFY+ EI+LA+GHLHS GIIYRDLKPEN++L+  GH+KLTDFGL KES    + T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DM++G PPF+ E+ K+ TI+KIL+  L  P Y ++D   LIK LLK+NP +RLG  K D  +I+ H FF++  INWDD+L+++VEPP+KP L SE DVS FD+ FT Q P+ SPDDS  +H +E  F GF+YVAP+V ES+
Sbjct:   28 EPENVQTEEVELTSEIVNRDSERVGPDCFELLTVLGKGAYGKVFQVRKVQ-GLQIGKIFAMKVLKKAKIVRNAKDTAHTRAEREILETVRHPFIVDLLYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLGEITLALGHLHSNGIIYRDLKPENIMLNHQGHIKLTDFGLCKESIHDGSVTHTFCGTIEYMAPEILTRSGHNRAVDWWSLGALMYDMMTGSPPFTAENRKK-TIDKILKCKLNLPPYLTIDARELIKKLLKKNPAQRLGSGKADAADIQKHSFFKQ--INWDDLLNKRVEPPYKPQLHSEEDVSQFDTRFTRQTPVDSPDDSRLSHSAELAFAGFTYVAPSVLESL 387          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Match: RPS6KB2 (ribosomal protein S6 kinase beta-2 [Source:NCBI gene;Acc:101163545])

HSP 1 Score: 423.705 bits (1088), Expect = 4.707e-143
Identity = 208/358 (58.10%), Postives = 267/358 (74.58%), Query Frame = 1
Query:  187 TQSIEICDQTVN-PHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV 1245
            T+ +E+  + VN   ++V    FE+LTV+G+G YGKVF VRKV  G    K++AMKVLKKA+IVRN KDTAHT++ER ILE +RHPF+V L YAFQ+   LY++L    GGELF  LE+EG  ME+ ACFY+ EI+LA+GHLHS GIIYRDLKPEN++L+  GH+KLTDFGL KES    + T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DM++G PPF+ E+ K+ TI+KIL+  L  P Y ++D   LIK LLK+NP +RLG  K D  +I+ H FF++  INWDD+L+++VEPP+KP L SE DVS FD+ FT Q P+ SPDDS  +H +E  F GF+YVAP+V ES+
Sbjct:   33 TEEVELTSEIVNRDSERVGPDCFELLTVLGKGAYGKVFQVRKVQ-GLQIGKIFAMKVLKKAKIVRNAKDTAHTRAEREILETVRHPFIVDLLYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLGEITLALGHLHSNGIIYRDLKPENIMLNHQGHIKLTDFGLCKESIHDGSVTHTFCGTIEYMAPEILTRSGHNRAVDWWSLGALMYDMMTGSPPFTAENRKK-TIDKILKCKLNLPPYLTIDARELIKKLLKKNPAQRLGSGKADAADIQKHSFFKQ--INWDDLLNKRVEPPYKPQLHSEEDVSQFDTRFTRQTPVDSPDDSRLSHSAELAFAGFTYVAPSVLESL 386          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Match: rps6kb1a (ribosomal protein S6 kinase beta-1 [Source:NCBI gene;Acc:101174287])

HSP 1 Score: 425.246 bits (1092), Expect = 5.030e-143
Identity = 224/401 (55.86%), Postives = 275/401 (68.58%), Query Frame = 1
Query:  250 FEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES---ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERL-GYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARFGHTHVSECKKIVEDDVPGAQQISSNNQTKCVPISNHSNAINGVSK 1440
            FE+L V+G+GGYGKVF VRKV+ G    K+YAMKVLKKA IVRN KDTAHTK+ERNILE ++HPF+V L YAFQ+   LY++L Y  GGELF  LEREG  ME+ ACFY+AEIS+A+GHLH KGIIYRDLKPEN++L+  GHVKLTDFGL KES    T T+TFCGTIEYMAPEIL R GH   VDWWSLG L++DML+G PPF+ E+ K+ TI+KIL+  L  P Y + +   L+K LLKR+   RL G   D  E++ H FF+   INWDD+L+RKVEPPFKP L+S  DVS FDS FT+Q P+ SPDDST +  +  +F GF+YVAP+V E+V  +   E K  R    F     T +S  K    D        S N  T C     H   ++GV +
Sbjct:   66 FELLKVLGKGGYGKVFQVRKVS-GASSGKIYAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK-TIDKILKCKLSLPPYLTQEARDLLKKLLKRSASSRLGGGPGDAAEVQVHPFFRH--INWDDLLARKVEPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENVKEKFSFEPK-LRSPRKFPGSPRTLLSPLKFSGGDSWLRGPLPSGNPSTVCPGSGEHPMEVSGVEQ 461          
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Match: SMESG000046977.1 (SMESG000046977.1)

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 378/378 (100.00%), Postives = 378/378 (100.00%), Query Frame = 1
Query:  553 MENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARFGHTHVSECKKIVEDDVPGAQQISSNNQTKCVPISNHSNAINGVSKSYKSPSVIEKHNGVIKPSSSDLALASLVPANGKGSVKTEPIGNLKYNKKKSFDFGQPKINGTLNGAGNIFTNDTSKNKCSIM 1686
            MENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARFGHTHVSECKKIVEDDVPGAQQISSNNQTKCVPISNHSNAINGVSKSYKSPSVIEKHNGVIKPSSSDLALASLVPANGKGSVKTEPIGNLKYNKKKSFDFGQPKINGTLNGAGNIFTNDTSKNKCSIM
Sbjct:    1 MENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEPWIENKPNRRKTLFARFGHTHVSECKKIVEDDVPGAQQISSNNQTKCVPISNHSNAINGVSKSYKSPSVIEKHNGVIKPSSSDLALASLVPANGKGSVKTEPIGNLKYNKKKSFDFGQPKINGTLNGAGNIFTNDTSKNKCSIM 378          
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Match: SMESG000004478.1 (SMESG000004478.1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 293/406 (72.17%), Postives = 337/406 (83.00%), Query Frame = 1
Query:   46 MHGSLEYINTYDSLTT-DNDE-KESDKDSMSFGAIREEKYDEKEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEP 1257
            M  SL+YI T D + + DND  + S++D +S     +    ++EE+  + +S+EIC   VNP  K+SM DF++L VIGRGGYGKVFLV+K + G DE KLYAMKVLKKARI+RNEKDTAHTKSERNILE+IRHPFLVKLHYAFQ+QSNLYIVLTYC GGELFTYLEREGTLMENQACFY+AEISLAIGHLH  GIIYRDLKPENVLLDK GHVKLTDFGLSKES + TNTFCGTIEYMAPEIL+R GH   VDWWSLGTLLFDMLSGGPPFSQE  KQ TI KIL + + +P YFS +V+ LI+GLLKRNPKERLG KNDVE+IK+H FF+ +DINW D+  R+++PPFKP+LKSE DVSCFDSTFT QQPI++PDD  G HI  D+F GFSYVAPNVA SVL+EP
Sbjct:    1 MESSLDYIVTEDDIVSKDNDFIRLSERDELSIQQFIQNGPLKREEDDDI-ESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEP 405          
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Match: SMESG000068122.1 (SMESG000068122.1)

HSP 1 Score: 360.918 bits (925), Expect = 4.760e-119
Identity = 187/361 (51.80%), Postives = 254/361 (70.36%), Query Frame = 1
Query:  166 KEENQLVTQSIEICDQTVNP-HKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEK-DTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATS--TNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERL-GYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNV 1233
            K+E    ++S++IC++TVNP   KV+  DF++L  +G+GGYG+VFL +KV  G    + +AMKV+KKAR++ N+K DT +  +ERNILE + HPFLVKL++AFQ+  +L++VL Y  GGELF  LER+ TL E++A FY+AE +LA+GHLHS G+IYRDLK ENV+LD+ GHVKLTDFGLSKE      T++FCGT+EYMAPEIL+R GH   VDWWS+G LL+DML G  PF   +  Q+ I+K+  A LK P + +     L+K LL +NPK RL G + DVEEIK H FF+   INWD  L+R+++PPF P+L S  DVS FD    ++  ++SP  +  ++     F  FSYV+P V
Sbjct:   40 KDEYDSTSKSVDICEETVNPPGVKVTSHDFDLLKKLGKGGYGQVFLAKKVN-GAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQV-IQKVTNAKLKIPRFLTDSGKHLLKNLLNKNPKARLGGGEKDVEEIKRHFFFRS--INWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY--WFENFSYVSPQV 394          
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Match: SMESG000059433.1 (SMESG000059433.1)

HSP 1 Score: 348.977 bits (894), Expect = 8.164e-111
Identity = 186/387 (48.06%), Postives = 250/387 (64.60%), Query Frame = 1
Query:  121 DSMSFGAIREEKYDE--------KEENQLVTQSIEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKES-----ATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGY-KNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAE 1239
            DS     + E + DE        +EE      ++++ D+      K+    FE+L V+G+G +GKVFLVRKV+  + +  LYAMKVLKKA +    +D   TK ER+IL  IRHPF+V LHYAFQ++  +Y++L +  GG+LF+ L +E    E+   FY+AE++LA+ HLHS GI+YRDLKPEN+LLD+ GH+KLTDFGLSKES     A  T +FCGT+EYMAPE++ R+GH    DWWS G L+F+ML+G  PF Q SS++ T+  IL+A L  P + S +   L++ L KRNP  R+G+    +EEIKS  FFQ   INW D+L+RKV PPFKP      D SCFDS FT++ P  SP        +E IF GFSYVAP+V +
Sbjct:    8 DSFHISNLNEVEVDEEFSDNAFSQEEEATEVNAVDLVDE------KLDSSHFELLRVLGQGSFGKVFLVRKVSEPQ-QGILYAMKVLKKASL--KVQDRKRTKMERDILAAIRHPFIVTLHYAFQNEGKVYLILEFLKGGDLFSRLSKEFMFTEDDVKFYLAELALALDHLHSLGIVYRDLKPENILLDEDGHIKLTDFGLSKESIYNDDANRTFSFCGTVEYMAPEVVNRKGHGTAADWWSFGVLMFEMLTGQLPF-QGSSRKETMTMILKAKLSMPQFLSSEAQTLLRVLFKRNPSNRIGFGPKGIEEIKSQPFFQL--INWKDLLNRKVTPPFKPKATCLDDTSCFDSQFTSKTPKESPCQPASATANE-IFRGFSYVAPDVLQ 381          

HSP 2 Score: 100.523 bits (249), Expect = 7.222e-22
Identity = 62/211 (29.38%), Postives = 106/211 (50.24%), Query Frame = 1
Query:  268 IGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNILEIIR-------HPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCG----HVKLTDFGLSKESATSTN---TFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQ 858
            IG+G +   +     T G +    YA+KV+   +              R+++E +        HP +VKL   +  Q+ + +++ Y  GGEL T +  +    E +A   +  ++  + +LH+  +++RDLKP N+L  K      ++ + DFG +K+         T C T  ++APE+L+++G+    D WSLG LLF MLSG  PF+Q
Sbjct:  417 IGKGSFSVCYRAVHKTTGVN----YAIKVIDGTK--------------RDVIEEVEILFRFGAHPHIVKLKEVYVQQNTVSLIMEYLEGGELLTNILSQKYFSEKEASKILYVLTETVHYLHTNLVVHRDLKPSNILYSKKDTNPENLVICDFGFAKQQRAENGLLMTPCYTANFVAPEVLKKQGYDKASDVWSLGVLLFIMLSGKTPFTQ 609          
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Match: SMESG000022857.1 (SMESG000022857.1)

HSP 1 Score: 286.96 bits (733), Expect = 6.303e-90
Identity = 162/406 (39.90%), Postives = 246/406 (60.59%), Query Frame = 1
Query:   61 EYINTYDSLTTDNDEKESDKDSMSFGAIREEKYDEKEE--NQLVTQSIEICDQT---VNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYAMKVLKKARIVRNEKDTAHTKSERNIL-EIIRHPFLVKLHYAFQSQSNLYIVLTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESAT---STNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPI--------LSPDDSTGTHISEDIFTGFSYVAP 1227
            E +N + +   D+ +    K+   F  I  + YD +EE   + V ++    D     V+ +K     DF+ +  IG+G +GKVFL R+ + G     ++A+KVL K  I +   +  H  SERNIL + +RHPFL +L+++FQ++  LY  L Y  GGELF +L++E +  + +A FY AEI  ++G+LHSK IIYRDLKPEN+LLD  GH+ LTDFGL KE      +T+TFCGT EY+APE++++E +   VDWWS G+++++ML G PPF  + + Q+  ++IL +PL         +  ++  L+++NPKERLGYKND +EIK H FF +  I+W  +++++V+PPF P + S AD+   D  F +++PI        L+          +D F GFSYV P
Sbjct:   75 EGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDG----AVFAVKVLYKENI-KKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQGHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQM-YQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQ--IDWVALVNKQVKPPFVPQVSSNADIRNIDPEF-HKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPP 471          
The following BLAST results are available for this feature:
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS6KB11.737e-14460.22ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB11.824e-14460.22ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB11.641e-14360.22ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB22.360e-14053.25ribosomal protein S6 kinase B2 [Source:HGNC Symbol... [more]
RPS6KB11.127e-12855.74ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsks-13.012e-13154.90Ribosomal protein S6 kinase beta [Source:UniProtK... [more]
rskn-15.906e-10546.25Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-16.807e-10345.97Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-11.034e-10245.95Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-11.478e-10245.97Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
S6k7.768e-14056.86gene:FBgn0283472 transcript:FBtr0077114[more]
S6k7.768e-14056.86gene:FBgn0283472 transcript:FBtr0333264[more]
S6kII4.285e-9547.67gene:FBgn0262866 transcript:FBtr0333715[more]
S6kII4.285e-9547.67gene:FBgn0262866 transcript:FBtr0077360[more]
JIL-16.734e-8847.28gene:FBgn0020412 transcript:FBtr0076237[more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1b1.688e-14255.84ribosomal protein S6 kinase b, polypeptide 1b [Sou... [more]
rps6kb1a2.585e-13854.99ribosomal protein S6 kinase b, polypeptide 1a [Sou... [more]
BX000486.12.848e-13854.99ribosomal protein S6 kinase b, polypeptide 1a [Sou... [more]
rps6kb1b2.965e-12650.61ribosomal protein S6 kinase b, polypeptide 1b [Sou... [more]
rps6ka26.629e-10743.15ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l3hypdh1.304e-14259.38L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh1.666e-14259.38L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh4.313e-14259.38L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh5.885e-14259.38L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh6.092e-14259.38L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rps6kb11.383e-14360.22ribosomal protein S6 kinase, polypeptide 1 [Source... [more]
Rps6kb24.302e-13953.25ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb24.302e-13953.25ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb27.514e-13354.14ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb27.514e-13354.14ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23443|KS6B1_HUMAN7.878e-14360.22Ribosomal protein S6 kinase beta-1 OS=Homo sapiens... [more]
sp|P67998|KS6B1_RABIT9.068e-14360.22Ribosomal protein S6 kinase beta-1 OS=Oryctolagus ... [more]
sp|P67999|KS6B1_RAT9.676e-14360.22Ribosomal protein S6 kinase beta-1 OS=Rattus norve... [more]
sp|Q8BSK8|KS6B1_MOUSE9.676e-14360.22Ribosomal protein S6 kinase beta-1 OS=Mus musculus... [more]
sp|Q6TJY3|KS6B1_BOVIN2.946e-14259.94Ribosomal protein S6 kinase beta-1 OS=Bos taurus O... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MBY09.774e-17954.69Non-specific serine/threonine protein kinase OS=Op... [more]
A0A419PD321.180e-17557.58Non-specific serine/threonine protein kinase OS=Cl... [more]
A0A4E0QV282.247e-17566.75Non-specific serine/threonine protein kinase OS=Fa... [more]
A0A5K3FAY05.119e-17363.38Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3Q0KTP59.490e-17360.14Non-specific serine/threonine protein kinase OS=Sc... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1b1.829e-14359.66ribosomal protein S6 kinase B1 [Source:NCBI gene;A... [more]
ENSAMXT00000004157.23.201e-14355.79ribosomal protein S6 kinase B2 [Source:NCBI gene;A... [more]
rps6kb1b3.697e-14359.66ribosomal protein S6 kinase B1 [Source:NCBI gene;A... [more]
rps6kal3.256e-10544.61ribosomal protein S6 kinase a, like [Source:NCBI g... [more]
rps6kal4.698e-10544.61ribosomal protein S6 kinase a, like [Source:NCBI g... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006766.17.545e-9244.35pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000008480.13.171e-8543.60pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000001814.11.173e-7345.25pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
ENSPMAT00000004683.14.177e-6052.25pep scaffold:Pmarinus_7.0:GL488517:199:5283:1 gene... [more]
mast23.149e-5837.76microtubule associated serine/threonine kinase 2 [... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPK26.171e-8744.31Protein kinase similar to S/T protein kinase Ypk1p... [more]
YPK11.573e-8643.75S/T protein kinase; phosphorylates, downregulates ... [more]
SCH96.816e-8645.61AGC family protein kinase; functional ortholog of ... [more]
TPK13.480e-8041.10cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK34.010e-7943.19cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411669.236e-14352.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318952.117e-10145.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391632.679e-9444.51Ribosomal protein S6 kinase [Source:UniProtKB/TrE... [more]
EDO378001.224e-9040.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449384.400e-8241.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1a1.198e-14355.86ribosomal protein S6 kinase beta-1 [Source:NCBI ge... [more]
rps6kb1a1.738e-14355.86ribosomal protein S6 kinase beta-1 [Source:NCBI ge... [more]
RPS6KB23.672e-14357.42ribosomal protein S6 kinase beta-2 [Source:NCBI ge... [more]
RPS6KB24.707e-14358.10ribosomal protein S6 kinase beta-2 [Source:NCBI ge... [more]
rps6kb1a5.030e-14355.86ribosomal protein S6 kinase beta-1 [Source:NCBI ge... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046977.10.000e+0100.00SMESG000046977.1[more]
SMESG000004478.10.000e+072.17SMESG000004478.1[more]
SMESG000068122.14.760e-11951.80SMESG000068122.1[more]
SMESG000059433.18.164e-11148.06SMESG000059433.1[more]
SMESG000022857.16.303e-9039.90SMESG000022857.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026874 ID=SMED30026874|Name=Ribosomal protein S6 kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1827bp
ATCGAATCTTTGAATATTTTTACTAAATAATTTTTATTGTTACAAATGCA
CGGTAGTTTAGAGTATATCAATACTTACGATTCTTTGACTACAGATAATG
ATGAAAAGGAATCTGATAAGGATAGTATGAGTTTCGGTGCTATACGGGAA
GAAAAATATGATGAGAAAGAAGAAAATCAATTAGTTACACAATCTATTGA
AATTTGTGATCAAACAGTTAACCCACACAAGAAAGTCAGTATGATTGATT
TTGAAATTCTGACAGTTATAGGAAGAGGGGGATATGGAAAGGTATTTCTC
GTTCGAAAAGTGACTCCTGGCGAAGACGAAAAAAAGTTATATGCAATGAA
AGTCTTAAAAAAAGCTCGAATAGTTAGAAATGAAAAGGACACAGCACACA
CTAAATCAGAGAGAAATATTTTAGAAATAATTCGCCATCCATTTTTGGTA
AAATTACATTATGCATTTCAAAGTCAATCGAATTTATACATTGTGCTAAC
ATATTGCCCTGGTGGAGAATTATTTACGTATTTAGAAAGAGAAGGAACTC
TAATGGAAAATCAAGCTTGCTTCTATATCGCTGAAATCAGTCTTGCAATT
GGACATTTGCATTCTAAAGGAATAATTTACAGAGATTTAAAACCAGAAAA
TGTTTTATTAGACAAATGCGGTCATGTTAAACTAACAGATTTTGGATTAT
CTAAAGAGAGCGCAACTTCCACTAATACATTTTGTGGTACAATCGAATAT
ATGGCTCCGGAAATATTGAGACGAGAAGGTCATACTTTTGTGGTGGATTG
GTGGAGCTTGGGTACTCTGTTGTTTGATATGCTGTCCGGAGGACCGCCTT
TTAGTCAAGAATCTAGCAAGCAGTTGACTATTGAAAAGATTTTACGAGCG
CCTTTAAAATTCCCCATGTATTTCTCGTTAGATGTTATGGGTCTTATAAA
AGGTCTGCTTAAAAGAAATCCCAAAGAACGTTTGGGTTACAAAAACGATG
TCGAAGAAATAAAAAGTCACATATTTTTCCAGAAAAATGACATTAATTGG
GATGATATACTATCCAGAAAAGTTGAACCACCATTTAAACCAGATCTCAA
ATCAGAAGCCGATGTTAGCTGCTTTGATTCCACATTCACAAATCAGCAAC
CAATTTTAAGTCCAGACGATTCCACTGGAACACATATTTCTGAAGATATA
TTCACAGGTTTCTCTTATGTAGCTCCGAACGTAGCTGAAAGTGTTCTTTC
TGAGCCTTGGATAGAAAACAAACCAAATCGTAGGAAAACTCTTTTCGCAC
GATTTGGTCACACTCATGTATCTGAATGCAAAAAAATCGTCGAAGATGAT
GTTCCTGGAGCTCAACAAATCAGCTCCAATAACCAGACAAAATGCGTTCC
CATTTCTAATCATAGCAACGCCATTAATGGTGTCAGTAAATCCTACAAAT
CTCCAAGTGTCATAGAGAAGCATAATGGTGTCATAAAGCCGTCATCGAGT
GATCTGGCACTGGCTAGCCTTGTGCCAGCTAATGGGAAAGGATCAGTTAA
AACTGAACCGATTGGAAATCTAAAATACAATAAAAAGAAATCATTTGATT
TCGGTCAGCCCAAGATAAATGGAACATTGAACGGTGCTGGCAACATATTC
ACCAATGATACATCGAAAAACAAATGCTCAATAATGTAATTAATCGTGTT
ATGAAGTTTATTTATTATCAGTGTATTTATTGATTTCTTATTGTTTTACA
ATGTGAATGTATGTTTGGACATTAATTTTAAATGTATGTATCGCCAGAGA
ATCTTTCTACTTTTCATATAGTGAAAT
back to top

protein sequence of SMED30026874-orf-1

>SMED30026874-orf-1 ID=SMED30026874-orf-1|Name=SMED30026874-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MHGSLEYINTYDSLTTDNDEKESDKDSMSFGAIREEKYDEKEENQLVTQS
IEICDQTVNPHKKVSMIDFEILTVIGRGGYGKVFLVRKVTPGEDEKKLYA
MKVLKKARIVRNEKDTAHTKSERNILEIIRHPFLVKLHYAFQSQSNLYIV
LTYCPGGELFTYLEREGTLMENQACFYIAEISLAIGHLHSKGIIYRDLKP
ENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVV
DWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGL
IKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPD
LKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESV
LSEPWIENKPNRRKTLFARFGHTHVSECKKIVEDDVPGAQQISSNNQTKC
VPISNHSNAINGVSKSYKSPSVIEKHNGVIKPSSSDLALASLVPANGKGS
VKTEPIGNLKYNKKKSFDFGQPKINGTLNGAGNIFTNDTSKNKCSIM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008271Ser/Thr_kinase_AS
IPR000961AGC-kinase_C
IPR000719Prot_kinase_dom
IPR017892Pkinase_C
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 331..393
e-value: 2.0E-19
score: 80.6
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 331..401
score: 17.165
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 69..328
e-value: 4.6E-101
score: 351.7
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 70..328
e-value: 1.4E-66
score: 224.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 69..328
score: 51.594
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 69..365
e-value: 1.2E-121
score: 407.2
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 158..352
e-value: 1.2E-121
score: 407.2
NoneNo IPR availablePANTHERPTHR24351RIBOSOMAL PROTEIN S6 KINASEcoord: 29..427
NoneNo IPR availablePANTHERPTHR24351:SF171RIBOSOMAL PROTEIN S6 KINASE BETA-2coord: 29..427
IPR017892Protein kinase, C-terminalPFAMPF00433Pkinase_Ccoord: 351..391
e-value: 1.4E-6
score: 28.9
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 75..102
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 193..205
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 63..378