SWIM-type domain-containing protein

Overview
NameSWIM-type domain-containing protein
Smed IDSMED30026870
Length (bp)5032
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SWIM-type domain-containing protein (SMED30026870) t-SNE clustered cells

Violin plots show distribution of expression levels for SWIM-type domain-containing protein (SMED30026870) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SWIM-type domain-containing protein (SMED30026870) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SWIM-type domain-containing protein (SMED30026870) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026870

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30026870SMESG000052710.1 Contig3125GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026870SMESG000060198.1 Contig3125GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30026870SMESG000060198.1 dd_Smed_v4_5330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026870SMESG000060198.1 dd_Smed_v4_5330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026870SMESG000060198.1 dd_Smed_v4_5330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30026870SMESG000060198.1 dd_Smed_v4_5330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026870SMESG000060198.1 dd_Smed_v4_5330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026870SMESG000060198.1 dd_Smed_v4_5330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026870SMESG000060198.1 dd_Smed_v4_5330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30026870SMESG000060198.1 dd_Smed_v4_5330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026870SMESG000060198.1 dd_Smed_v4_5330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026870SMESG000081921.1 Contig4116GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026870SMESG000060198.1 Contig4116GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30026870SMESG000060198.1 dd_Smed_v4_5330_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SWIM-type domain-containing protein vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 123.635 bits (309), Expect = 5.027e-28
Identity = 110/417 (26.38%), Postives = 171/417 (41.01%), Query Frame = 1
Query: 3241 ELVLYLTKDCSKDVEKVRAIFRWIT---TYDIKSV---NFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGV---------LGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIY 4446
            ELV  L ++   D+E+VRAI+ WI     YDI +    +     P D    +LR  K        LF RMCR AG+ C  + GYSKG GY+ G +      F + W AVY+ G W  V+  WG             SG + + TS+  +L N     EFYFLT     I +HFPD K WQLL  P +L QF      KS F+N  +        +++T  GK TV I           L  + +  +L        L    + +   P   G   L I+   +    D       + + C+           + D+GV         +G +  S+ +GI+     DP ++        ++ ++  G+ V   +   D  G  +       + Q   + +++  ++ P  G + L I+
Sbjct:  149 ELVSDLLQEAHTDLERVRAIWIWICHHIEYDIAAAQEKDRQAFKPTD----ILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSGE--FDHAWNAVYLEGRWHLVDSTWG-------------SGLVDTITSKFTFLYN-----EFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIESCAPTLFMFMLNGKQEHGLLS-------LRKNGMKLEVYPPTMGTHKLQIFAKGN---SDIYSSVLEYTLKCN-----------YVDMGVQLPAELHQPVGPSWFSEQMGIMKPSHPDP-IIHTSDGRCSISFSVEEGINVLASLHGDD--GPITEETQRRYIFQLHREKQTELKVQLPHAGKFALKIF 517          
BLAST of SWIM-type domain-containing protein vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 123.635 bits (309), Expect = 5.200e-28
Identity = 81/227 (35.68%), Postives = 109/227 (48.02%), Query Frame = 1
Query: 3241 ELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDT------LVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKI 3903
            ELV  L ++   D+E+VRAI+ WI  +    + +D AA  +          +LR  K        LF RMCR AG+ C  + GYSKG GY+ G +      F + W AVY+ G W  V+  WG             SG + + TS+  +L N     EFYFLT     I +HFPD K WQLL  P +L QF      KS F+N  +        +++T  GK TV I
Sbjct:  170 ELVSDLLQEAHTDLERVRAIWIWICHH----IEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSGE--FDHAWNAVYLEGRWHLVDSTWG-------------SGLVDTITSKFTFLYN-----EFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTI 372          
BLAST of SWIM-type domain-containing protein vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 82.4185 bits (202), Expect = 4.858e-16
Identity = 47/124 (37.90%), Postives = 63/124 (50.81%), Query Frame = 1
Query: 3241 ELVLYLTKDCSKDVEKVRAIFRWIT---TYDIKSV---NFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGA 3594
            ELV  L ++   D+E+VRAI+ WI     YDI +    +     P D    +LR  K        LF RMCR AG+ C  + GYSKG GY+ G +      F + W AVY+ G W  V+  WG+
Sbjct:  170 ELVSDLLQEAHTDLERVRAIWIWICHHIEYDIAAAQEKDRQAFKPTD----ILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSGE--FDHAWNAVYLEGRWHLVDSTWGS 287          
BLAST of SWIM-type domain-containing protein vs. Ensembl Celegans
Match: ltd-1 (Lim and Transglutaminase Domain [Source:UniProtKB/TrEMBL;Acc:A0A131MD24])

HSP 1 Score: 203.371 bits (516), Expect = 7.347e-56
Identity = 143/449 (31.85%), Postives = 213/449 (47.44%), Query Frame = 1
Query: 3190 VDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRH---QELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAE--VLQTKKGKVTVKINMPQA-----VGVSVKLENRTDGTILRGLTLARIL------DGQMIVVTASPSQPGKFYLSIYVNEDWKSE------DNMEMACSFQVHCSEHNYDRLVTGRFPDV--GVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQY-HLRFPIEGFYCLTIYAGVDD 4461
            +D + I     E  +FT+L+  L+     DV+  RAI+RWIT  ++ ++ FD +  NDT +G+LR IK G  S + LF R+C YAG+HC  I G+SK AGY+PG +  D+R FRN W AV++ G+WRFV CNWGAR+L +      E  + G L            +   D+ YF+TD+++ I+E FP    WQLL RP++L QF  +P V+S FF  NLSF  N  E  V   K G  ++ I +P          ++K  +  + TI  G++L R +      D     V A  ++P    L I+ N               +  C F+V C      +++    P+   G  G   A++  G++     D  +       ++  +  RP       +       +    C   AL     +G   Y  + FP EG Y L IY   DD
Sbjct:   44 IDEVAIHCARNEVASFTDLIRTLSSGARSDVDVARAIYRWITIKNLNTMIFDDSIQNDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHR-FRNTWNAVFLDGSWRFVQCNWGARHLVNAKDGSHEAKTDGNL------------RYEYDDHYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLPPKGDSLIFHYNLKFFDSEENTI-SGMSLKRFVMQSVTEDVVTFRVHAPSTRP--LLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCESL---QVIMVPLPECASGEWGPAKATRLFGLLPISHPDAIINTGRYVEIRFRMT-RPLSEFVASLHRNRTDDRALQACTRSAL-----KGDMVYIQIEFPGEGQYGLDIYTRQDD 467          
BLAST of SWIM-type domain-containing protein vs. Ensembl Celegans
Match: ltd-1 (Lim and Transglutaminase Domain [Source:UniProtKB/TrEMBL;Acc:A0A131MD24])

HSP 1 Score: 203.756 bits (517), Expect = 3.711e-54
Identity = 144/447 (32.21%), Postives = 220/447 (49.22%), Query Frame = 1
Query: 3190 VDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAE--VLQTKKGKVTVKINMPQA-----VGVSVKLENRTDGTILRGLTLARIL------DGQMIVVTASPSQPGKFYLSIYVNEDWKSE------DNMEMACSFQVHCSEHNYDRLVTGRFPDV--GVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNS-APCDSYALLQYQSQGRSQY-HLRFPIEGFYCLTIYAGVDD 4461
            +D + I     E  +FT+L+  L+     DV+  RAI+RWIT  ++ ++ FD +  NDT +G+LR IK G  S + LF R+C YAG+HC  I G+SK AGY+PG +  D+R FRN W AV++ G+WRFV CNWGAR+L +        G+  ++T  +   E     D+ YF+TD+++ I+E FP    WQLL RP++L QF  +P V+S FF  NLSF  N  E  V   K G  ++ I +P          ++K  +  + TI  G++L R +      D     V A  ++P    L I+ N               +  C F+V C      +++    P+   G  G   A++  G++  P   P  + +    +++   +   L      +  +R+   +   C   AL     +G   Y  + FP EG Y L IY   DD
Sbjct:  278 IDEVAIHCARNEVASFTDLIRTLSSGARSDVDVARAIYRWITIKNLNTMIFDDSIQNDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHR-FRNTWNAVFLDGSWRFVQCNWGARHLVN-----AKDGSHEAKTDGNLRYE----YDDHYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLPPKGDSLIFHYNLKFFDSEENTI-SGMSLKRFVMQSVTEDVVTFRVHAPSTRP--LLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCESL---QVIMVPLPECASGEWGPAKATRLFGLL--PISHPDAIINTGRYVEIRFRMTRPLSEFVASLHRNRTDDRALQACTRSAL-----KGDMVYIQIEFPGEGQYGLDIYTRQDD 701          
BLAST of SWIM-type domain-containing protein vs. Ensembl Fly
Match: Hil (gene:FBgn0050147 transcript:FBtr0086255)

HSP 1 Score: 236.498 bits (602), Expect = 2.665e-64
Identity = 155/447 (34.68%), Postives = 224/447 (50.11%), Query Frame = 1
Query: 3172 PESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFK-RNYAEVLQT-KKGKVTVKINMPQAVGVSVKL-----------ENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVN----EDWKSEDNMEM--ACSFQVHCSEHNYDRLVTGRFPDV--GVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYA 4449
            P     VD + I V   +  TFT+LV  L   C+ D+EK R IFRWIT  ++ +++FD     DT +G+LR IK G  S + LF R+C YAG+HC  I GYSK AGY+PG+  +D+R FRN W AVYVAGAWRFV CNWGAR+L +  +E P  G   + + + +Y       D+ YFLTD ++ I+E +P ++ WQLL RPITL +F  LP V+S FF   L F    Y  V+ T   G  TV+I MP  +   +             E   DG  L+   +  ++ G ++         G F L I+ N    +++ + + M+    C F++ C E    + V    PD   G  G T A++  G+I     DP +     +   L++  R    +   M +  ++G        Y +          + + FP EG Y L IY 
Sbjct:  349 PIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCTTDIEKARTIFRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSR-FRNSWNAVYVAGAWRFVQCNWGARHLVNA-KEAPKQGRGKNDSLRYEY-------DDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVI-GNIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCEEL---QTVMVPLPDCASGEWGPTKATRLFGLIPITHQDPLIF----AGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKY-VTHSTLDDIVTFIINFPEEGQYGLDIYT 777          
BLAST of SWIM-type domain-containing protein vs. Ensembl Fly
Match: Hil (gene:FBgn0050147 transcript:FBtr0086256)

HSP 1 Score: 236.498 bits (602), Expect = 2.665e-64
Identity = 155/447 (34.68%), Postives = 224/447 (50.11%), Query Frame = 1
Query: 3172 PESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFK-RNYAEVLQT-KKGKVTVKINMPQAVGVSVKL-----------ENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVN----EDWKSEDNMEM--ACSFQVHCSEHNYDRLVTGRFPDV--GVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYA 4449
            P     VD + I V   +  TFT+LV  L   C+ D+EK R IFRWIT  ++ +++FD     DT +G+LR IK G  S + LF R+C YAG+HC  I GYSK AGY+PG+  +D+R FRN W AVYVAGAWRFV CNWGAR+L +  +E P  G   + + + +Y       D+ YFLTD ++ I+E +P ++ WQLL RPITL +F  LP V+S FF   L F    Y  V+ T   G  TV+I MP  +   +             E   DG  L+   +  ++ G ++         G F L I+ N    +++ + + M+    C F++ C E    + V    PD   G  G T A++  G+I     DP +     +   L++  R    +   M +  ++G        Y +          + + FP EG Y L IY 
Sbjct:  349 PIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCTTDIEKARTIFRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSR-FRNSWNAVYVAGAWRFVQCNWGARHLVNA-KEAPKQGRGKNDSLRYEY-------DDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVI-GNIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCEEL---QTVMVPLPDCASGEWGPTKATRLFGLIPITHQDPLIF----AGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKY-VTHSTLDDIVTFIINFPEEGQYGLDIYT 777          
BLAST of SWIM-type domain-containing protein vs. Ensembl Zebrafish
Match: ky (kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE-090313-64])

HSP 1 Score: 106.686 bits (265), Expect = 2.639e-23
Identity = 81/303 (26.73%), Postives = 138/303 (45.54%), Query Frame = 1
Query: 3256 LTKDCSKDVEKVRAIFRWIT---TYDIKSVNFDPAAPNDTLVGVLRAIK--CGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTAS---------PSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHC 4122
            +T+    +VEK+RAI+ W+     YDI+      +    +L  V+R  K  C   SN  L   MCR  GI C  +SGYSKG GY+   ++ +     + W AV++ G W  ++  WGA  +  +           S+T   +Y       D+FYFLT+  + I  HFPD + WQLLT PI++ +F   P+  S F+   L+          T+ G+  V ++  + +  S ++      T   G      +D    +++ +         PS+PG + + ++   + +    +   CS ++ C
Sbjct:   54 VTEVARNEVEKLRAIWIWLCHNIEYDIEGY-LGLSQKICSLDEVIRNGKGVCSGYSN--LCVEMCREVGIECVEVSGYSKGIGYQARHSLAEE-CSDHEWNAVFIDGQWWLLDACWGAGTVDMK-----------SKTFVKRY-------DDFYFLTEPSEFINSHFPDDQTWQLLTTPISIQEFEMRPLRTSAFYQLGLTLIHPKQYKTITEDGEAIVSVSSSRLLTFSYEMRQHDPQT---GALKQEEVDSSCGLLSVTHQGMKLRLLPSEPGTYEVKLFARREGEP-GALRWVCSLELEC 330          
BLAST of SWIM-type domain-containing protein vs. Ensembl Zebrafish
Match: ky (kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE-090313-64])

HSP 1 Score: 97.4413 bits (241), Expect = 4.905e-20
Identity = 66/252 (26.19%), Postives = 113/252 (44.84%), Query Frame = 1
Query: 3394 CGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTAS---------PSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHC 4122
            C   SN  L   MCR  GI C  +SGYSKG GY+   ++ +     + W AV++ G W  ++  WGA  +  +           S+T   +Y       D+FYFLT+  + I  HFPD + WQLLT PI++ +F   P+  S F+   L+          T+ G+  V ++  + +  S ++      T   G      +D    +++ +         PS+PG + + ++   + +    +   CS ++ C
Sbjct:   43 CSGYSN--LCVEMCREVGIECVEVSGYSKGIGYQARHSLAE-ECSDHEWNAVFIDGQWWLLDACWGAGTVDMK-----------SKTFVKRY-------DDFYFLTEPSEFINSHFPDDQTWQLLTTPISIQEFEMRPLRTSAFYQLGLTLIHPKQYKTITEDGEAIVSVSSSRLLTFSYEMRQHDPQT---GALKQEEVDSSCGLLSVTHQGMKLRLLPSEPGTYEVKLFARREGEP-GALRWVCSLELEC 269          
BLAST of SWIM-type domain-containing protein vs. Ensembl Xenopus
Match: cnpy1 (canopy FGF signaling regulator 1 [Source:Xenbase;Acc:XB-GENE-981809])

HSP 1 Score: 134.035 bits (336), Expect = 1.701e-31
Identity = 138/514 (26.85%), Postives = 216/514 (42.02%), Query Frame = 1
Query: 3223 EPTTFTELVLYLTKDCSKDVEKVRAIFRWIT---TYDIKSV---NFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQ--TKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTG-RFPDV--GVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPC-DSYALLQYQSQGRSQYHLRFPIE-GFYCLTIYAGVDDPDLPDTEPMECIYRLLIDCKRAQERIPPFPRQTSRW-VGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLW 4722
            + +T  +LV  L +    D+EKVRAI+ WI     YD+  +   +     PN TL+    A +        LF  MC +AGI C  I G+SKG  Y  G          + W AV++   W  ++  WGA +  S                       K R +EFYFLT     I EHFPD + WQLL  P+++ QF       S F+NA L+   +Y E LQ  T  GK T  I        S  L N+T+   +  LT     +G  + V   P+  G+  L +Y       +++ +    + +HC       + TG R P     ++G +  ++  G + +   DP +++ +     +   +     V   + S      N  P  ++  +LQ     R ++ +  P + G Y L I       D  +     C Y  L+ C     R P FP + + W   + L+EPL   L  N+P RF+I A   +  +V++       L ++S+G W
Sbjct:   99 KASTVGQLVSSLIRMARTDLEKVRAIWTWICHHIEYDLDGMEDKSKRSGDPNQTLLSGKGACE----GYAGLFENMCSHAGIQCLKIGGFSKGFCYTTGQTFSGET--NHAWNAVFLNKRWHLLDTTWGAGFANSSTNSF------------------KFRYNEFYFLTHPALFIEEHFPDNQNWQLLQVPLSMKQFEGNLCRNSSFYNAGLT--ASYPETLQVETVNGKATFSIEGHSPALFSFTL-NKTEKPGIMTLT----KNGMQLDVY--PTVTGRHKLELYTKPFNTVKESYDKVVEYILHCGS-----VDTGFRIPKELDPIVGPSWLTEMKGFLQHLCSDP-IIYTQDGCCSVGFTLAKKAIVLATLHS-----DNIKPGYENRYVLQTLRGNRVEFKIHLPQQAGTYVLKI-CTKKKSDPGNMYDYACNY--LLCCSNPSVRWPFFPMRYNAWDSTYELIEPLNGILPANSPVRFKIKARGLA--AVLVKALNICPLTLNSDGFW 563          
BLAST of SWIM-type domain-containing protein vs. Ensembl Xenopus
Match: lmbr1 (limb development membrane protein 1 [Source:Xenbase;Acc:XB-GENE-981846])

HSP 1 Score: 129.798 bits (325), Expect = 2.478e-30
Identity = 144/548 (26.28%), Postives = 234/548 (42.70%), Query Frame = 1
Query: 3151 LKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWIT------TYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTEPMECIYRLLIDCKRAQERIPPFPRQTSRWVG-FRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVNTG--QELENLSV 4767
            LKS  I  ++   +D    +V     TT   LV  L ++   D+EK RAI+ WI       T  +K ++     PND    VLR  K      + LF  MC  AG+ C+ +SGYSKG  Y+ G     +      W  VY+ G+W  ++  WG            S  T+ +    + Y       +EFYFLT     I +HFP++ + QLL   ++L QF  L   K  F+   L         ++T KGKVT  +     +     L N+T+   L  LT         + +   P + G+  L I+   +  SE   +    ++V C   + +  +      +  +G +  S+  G+      DP V++ E     ++ A++  L +   + S +   Q ++      + Q Q +   ++ +R P  G Y L +   V DP+  DT   +C Y  +I C       P FP     W   + L+ PL   L  N+   F++     + VSV    + +  L+++  G W+G  +TG  QEL N++V
Sbjct:   25 LKSLQIDLKAFEKLDAYAAKV-----TTVDLLVKELIRNTHSDLEKTRAIWIWICHHIEYDTEGLKDLSQVSCDPND----VLRTRKGVCAGYSSLFESMCSIAGVKCKSMSGYSKGGRYKTGQTFSGDSTHE--WNMVYLEGSWHLLDSTWG------------SVATVSTFCFLNLY-------NEFYFLTHPALFIEDHFPEENKHQLLEPCVSLKQFEKLN-RKCYFYKMGLLSSWPDTVTVETVKGKVTFTLEGRHHLLFLFHL-NKTETPGLMQLT------EHGMKLDVYPQKTGEQILQIFAKRE-DSEGVYDWILDYKVICKSVDTNMKIPKCL--MNPVGPSWLSEKAGLFQPSHQDP-VIYTEDGCCTVSFALKGKLSIFATLDSSEI--QMTSDMKHRHIFQTQRENDVEFKVRLPTSGTYVLCV--NVKDPN-GDTYTSQCKY--VIFCTNHTVHWPQFPLVYGTWAKHYELLGPLDGILPENSNISFKLRVPDVTEVSVRGGKSSF-PLSLTPQGYWEGMCSTGGNQEL-NVTV 521          
BLAST of SWIM-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000026106.1 (kyphoscoliosis peptidase-like [Source:NCBI gene;Acc:100486532])

HSP 1 Score: 59.3066 bits (142), Expect = 4.207e-9
Identity = 47/156 (30.13%), Postives = 71/156 (45.51%), Query Frame = 1
Query: 3163 IISPESLIHVDNMVIEVML---LEPTTFTELVLYLTKDCSKDVEKVRAIFRWIT---TYDIKS-VNFDPAA--PNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAI---KDNRMFRNVWTAVYVAGAWRFVNCNWGA 3594
            + S  +  H+DN VI        +  +  E V  +T +    +EK+RAI+ W+     YD++  + F      P D L  + + +  G      LF  MCR  GI C+ ISGYS+   Y  G++    K N M    W AV +   W  ++  WGA
Sbjct:   26 LFSSVTFTHIDNHVINWSGQNNCQALSIQETVRGITAEARNHLEKIRAIWIWLCHNIRYDVEGYLGFSQKVYRPEDVLA-LGKGVCSGYAG---LFKEMCREIGIGCKEISGYSRTTEYSDGLSFHRTKSNHM----WNAVQLDTDWHLLDACWGA 173          
BLAST of SWIM-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000026111.1 (kyphoscoliosis peptidase-like [Source:NCBI gene;Acc:100486532])

HSP 1 Score: 56.225 bits (134), Expect = 5.101e-7
Identity = 38/129 (29.46%), Postives = 61/129 (47.29%), Query Frame = 1
Query: 3232 TFTELVLYLTKDCSKDVEKVRAIFRWITT-----YDIKS-VNFDPAA--PNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGA 3594
            +  E V  +T +    +EK+RAI+ W+       YD++  + F      P D L  + + +  G      LF  MCR  GI C+ ISGYS+   Y  G++    +   ++W AV +   W  ++  WGA
Sbjct:  129 SIQETVRGITAEARNHLEKIRAIWIWLCHNISEWYDVEGYLGFSQKVYRPEDVLA-LGKGVCSGYAG---LFKEMCREIGIGCKEISGYSRTTEYSDGLSFHRTKS-NHMWNAVQLDTDWHLLDACWGA 252          
BLAST of SWIM-type domain-containing protein vs. Ensembl Mouse
Match: Ky (kyphoscoliosis peptidase [Source:MGI Symbol;Acc:MGI:96709])

HSP 1 Score: 124.02 bits (310), Expect = 3.102e-28
Identity = 81/231 (35.06%), Postives = 111/231 (48.05%), Query Frame = 1
Query: 3229 TTFTELVLYLTKDCSKDVEKVRAIFRWIT---TYDIKSV---NFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKI 3903
            +   ELV  L ++   D+E+VRAI+ WI     YD+++    +     P D    +LR  K        LF RMCR AG+ C  + GYSKG GY+ G +      F + W AVY+ G W  V+  WG             SG + + TS+  +L N     EFYFLT     I +HFPD K WQLL  P +L QF      KS F+N  +        +++T  GK T+ I
Sbjct:  166 SGLNELVSDLLQEAHSDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTD----ILRTQKTNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSGE--FDHAWNAVYLEGRWHLVDSTWG-------------SGLVDTTTSKFTFLYN-----EFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATITI 372          
BLAST of SWIM-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0E908|HIL_DROME (Hillarin OS=Drosophila melanogaster OX=7227 GN=Hil PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 2.671e-63
Identity = 155/447 (34.68%), Postives = 224/447 (50.11%), Query Frame = 1
Query: 3172 PESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFK-RNYAEVLQT-KKGKVTVKINMPQAVGVSVKL-----------ENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVN----EDWKSEDNMEM--ACSFQVHCSEHNYDRLVTGRFPDV--GVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYA 4449
            P     VD + I V   +  TFT+LV  L   C+ D+EK R IFRWIT  ++ +++FD     DT +G+LR IK G  S + LF R+C YAG+HC  I GYSK AGY+PG+  +D+R FRN W AVYVAGAWRFV CNWGAR+L +  +E P  G   + + + +Y       D+ YFLTD ++ I+E +P ++ WQLL RPITL +F  LP V+S FF   L F    Y  V+ T   G  TV+I MP  +   +             E   DG  L+   +  ++ G ++         G F L I+ N    +++ + + M+    C F++ C E    + V    PD   G  G T A++  G+I     DP +     +   L++  R    +   M +  ++G        Y +          + + FP EG Y L IY 
Sbjct:  349 PIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCTTDIEKARTIFRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSR-FRNSWNAVYVAGAWRFVQCNWGARHLVNA-KEAPKQGRGKNDSLRYEY-------DDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVI-GNIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCEEL---QTVMVPLPDCASGEWGPTKATRLFGLIPITHQDPLIF----AGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKY-VTHSTLDDIVTFIINFPEEGQYGLDIYT 777          
BLAST of SWIM-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NBH2|KY_HUMAN (Kyphoscoliosis peptidase OS=Homo sapiens OX=9606 GN=KY PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 1.515e-28
Identity = 110/420 (26.19%), Postives = 172/420 (40.95%), Query Frame = 1
Query: 3241 ELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDT------LVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGV---------LGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGV 4455
            ELV  L ++   D+E+VRAI+ WI  +    + +D AA  +          +LR  K        LF RMCR AG+ C  + GYSKG GY+ G +      F + W AVY+ G W  V+  WG             SG + + TS+  +L N     EFYFLT     I +HFPD K WQLL  P +L QF      KS F+N  +        +++T  GK TV I           L  + +  +L        L    + +   P   G   L I+   +    D       + + C+           + D+GV         +G +  S+ +GI+     DP ++        ++ ++  G+ V   +   D  G  +       + Q   + +++  ++ P  G + L IY  V
Sbjct:  170 ELVSDLLQEAHTDLERVRAIWIWICHH----IEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSGE--FDHAWNAVYLEGRWHLVDSTWG-------------SGLVDTITSKFTFLYN-----EFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIESCAPTLFMFMLNGKQEHGLLS-------LRKNGMKLEVYPPTMGTHKLQIFAKGN---SDIYSSVLEYTLKCN-----------YVDMGVQLPAELHQPVGPSWFSEQMGIMKPSHPDP-IIHTSDGRCSISFSVEEGINVLASLHGDD--GPITEETQRRYIFQLHREKQTELKVQLPHAGKFALKIYVMV 541          
BLAST of SWIM-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C8H8|KY_MOUSE (Kyphoscoliosis peptidase OS=Mus musculus OX=10090 GN=Ky PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.287e-27
Identity = 81/231 (35.06%), Postives = 111/231 (48.05%), Query Frame = 1
Query: 3229 TTFTELVLYLTKDCSKDVEKVRAIFRWIT---TYDIKSV---NFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKI 3903
            +   ELV  L ++   D+E+VRAI+ WI     YD+++    +     P D    +LR  K        LF RMCR AG+ C  + GYSKG GY+ G +      F + W AVY+ G W  V+  WG             SG + + TS+  +L N     EFYFLT     I +HFPD K WQLL  P +L QF      KS F+N  +        +++T  GK T+ I
Sbjct:  166 SGLNELVSDLLQEAHSDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTD----ILRTQKTNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSGE--FDHAWNAVYLEGRWHLVDSTWG-------------SGLVDTTTSKFTFLYN-----EFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATITI 372          
BLAST of SWIM-type domain-containing protein vs. TrEMBL
Match: A0A267DV76 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019680g3 PE=4 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 3.057e-161
Identity = 286/657 (43.53%), Postives = 415/657 (63.17%), Query Frame = 1
Query: 2977 SRTDLHNHLRPGLS------MSSLSD-----AYYQHTLDNDRMVYWRADIEELLXXXXXXXXXXXXTNLLKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRN-YAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGVLGSTPASQNLGII------ANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYA-----------------GVDDPDLPDTEPMECIYRLLIDCKRAQERIPPFPRQTSRWVGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDL--AVSSNGLWKGKVNTGQELENLSVYGKFGINEDDEFIKLLDYVLIAK 4836
            S + L N+L PG++        +L D     A  Q  L+  R V+W   + E  PP M+PPPKPMP  L K+  + P+    +D+ V+E++ ++  TF E V  L      DVEK RAIFR++T    + +++DP AP  TL+G LRA++ G++S +ELF RMC YAGIHC+ + GYSKGAGYRPGM +KDNRMFRN WTAVYV G WRFVN  WG R L  +  E     TL            ++  D FYFLT+  +HIFEH+PD+KRWQLL  PI L  FM LP++KSPFFNA +  K+  Y + L T+ G+V++KI + + VGVS +L+NR+D + +RG TL R++ G+++ V ASP+QPG ++L+++V  DW S ++ E+A SFQV C+E+N+DRL  GR+P+VG LG+TPA+Q  G+       A   +DP+ + + +  L++ +   PGL++  +M  Y R+G+++  CD YALLQ + + +S+Y +  P +G+Y  T+YA                  VDD +    E +EC+YRLLIDC+R   ++PP+P QTS + G  L +P+ +HL++   Y FR+ A  C +V+VV+N   W+DL    S NG+W  K+N G+EL  LSVYG+F  +ED +F KLLDY ++ +
Sbjct:  871 STSTLLNNLDPGVTNVYLGPEGTLRDGTAGYATLQRPLEPVRSVFWNPGVPETPPPAMRPPPKPMPPGLSKT--VPPDGWKSIDDHVMELLDVDCNTFAEQVNSLCGRYQSDVEKCRAIFRFLTARANQPLSYDPQAPVTTLIGCLRAVQMGEVSPHELFKRMCAYAGIHCEILHGYSKGAGYRPGMNVKDNRMFRNTWTAVYVEGCWRFVNVAWGGRRLRQQGGET----TL------------RLGCDNFYFLTEPDEHIFEHYPDEKRWQLLRSPIALSHFMKLPLLKSPFFNAGMRLKKGKYDDTLVTQNGRVSLKIGLTKFVGVSCQLQNRSDMSAMRGKTLVRLI-GEVLHVLASPAQPGTYFLNVFVTPDWTSNEH-ELAASFQVKCAENNFDRLALGRYPEVGFLGATPAAQKYGVSFLTSHGAKTPMDPYYVHNSKEVLRVPLVFSPGLKIAHQMKCYQRAGKSTEQCDDYALLQCRGKQQSEYWIACPADGYYFFTVYAAEIAAAAGADGDASTAESVDD-EAGGGEELECVYRLLIDCRRGMGKVPPYPNQTSLFSGCLLHDPMQKHLDVGRKYTFRLEAKHCRAVAVVLNGQTWIDLQQGRSGNGIWSKKLNVGEELGELSVYGQFDTDEDGKFNKLLDYDIVQR 1506          
BLAST of SWIM-type domain-containing protein vs. TrEMBL
Match: A0A267E954 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031434g1 PE=4 SV=1)

HSP 1 Score: 543.888 bits (1400), Expect = 1.285e-157
Identity = 288/652 (44.17%), Postives = 412/652 (63.19%), Query Frame = 1
Query: 2968 MTMSRTDLHNHLRPGLS------MSSLSDAYYQHTL----DNDRMVYWRADIEELLXXXXXXXXXXXXTNLLKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKR-NYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGVLGSTPASQNLGII------ANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTEP------------MECIYRLLIDCKRAQERIPPFPRQTSRWVGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVNTGQELENLSVYGKFGINEDDEFIKLLDYVLIAK 4836
            +  S   L N+L PG++        +L +A   HT+    +  R V W     E+ PP M+PPPKPMP  L K+  + P+    VD+ V+E++ ++  TF E V  L      DVEK RAIFR++T   ++ + +DP AP  TL+G LR ++ G++S +ELF RMC +AGIHC+ + GYSKGAGYRPGM +KDNRMFRN WTAVYV G WRFVN  WG R L  R                S   E +++ D+FYFLT+ ++HI+EH+PD +RWQLL   +TL  FM LP++KSPFFNA L  K+  Y + L T+ G+V++KI + + VGVS +L+NR D + LRG TLAR++ G+ + V ASP+QPG ++L+I+V+ DW S ++ E+A SFQV C+E+N+DRL  GR+P+VG LG+TPA+Q LGI       A   +DP+V+   +  L+L +A  PGL+V  +M  Y RSG N+  CDSYALLQ + + +++Y L  P +G+Y  T+YAG       D+EP            ++C+YR+LIDC+R   ++P FP QTS + G  L EP+ +HL++   Y FR+ A    +V+VV+N   W+DL  S  G+W  K++ G+EL  LSVYG+   +E  +F KLLDY ++ +
Sbjct: 1687 LAASTATLLNNLEPGVTNVMLGPEGTLREAASMHTMLHPTEPARTVVWDPSQPEVPPPAMRPPPKPMPPGLSKT--VPPDGWKAVDDHVMEILDVDCNTFAEQVNSLCGRYQSDVEKCRAIFRFLTARLVQPLVYDPQAPPTTLIGCLRMVQAGEVSPHELFKRMCAHAGIHCEILHGYSKGAGYRPGMNLKDNRMFRNTWTAVYVEGCWRFVNVAWGGRRLAKR----------------SGATELRLKCDDFYFLTEPEEHIYEHWPDDRRWQLLRTSVTLSHFMRLPMLKSPFFNAGLRLKKGKYDDTLMTQNGRVSLKIGVTKFVGVSCQLQNRADMSSLRGKTLARLI-GEALHVLASPAQPGTYFLNIFVSPDWTSNEH-ELAASFQVKCAENNFDRLALGRYPEVGFLGATPAAQQLGISFLTSHGAKTPMDPYVVHTAKELLRLPVAAAPGLKVAHQMKCYQRSGVNTEQCDSYALLQCRGKQQAEYWLACPADGYYFFTVYAGE---AAKDSEPAGSAQDSEEGGDLDCVYRVLIDCRRGLGKVPAFPAQTSLFNGCYLHEPMHRHLDVGRKYNFRLEARHFKAVAVVLNGNTWLDLDSSRGGIWSKKLSVGEELGELSVYGQLQTDETGQFHKLLDYEIVQR 2315          
BLAST of SWIM-type domain-containing protein vs. TrEMBL
Match: A0A267G4V6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001514g4 PE=4 SV=1)

HSP 1 Score: 542.347 bits (1396), Expect = 5.219e-157
Identity = 287/652 (44.02%), Postives = 412/652 (63.19%), Query Frame = 1
Query: 2968 MTMSRTDLHNHLRPGLS------MSSLSDAYYQHTL----DNDRMVYWRADIEELLXXXXXXXXXXXXTNLLKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKR-NYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGVLGSTPASQNLGII------ANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTEP------------MECIYRLLIDCKRAQERIPPFPRQTSRWVGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVNTGQELENLSVYGKFGINEDDEFIKLLDYVLIAK 4836
            +  S   L N+L PG++        +L +A   HT+    +  R V W     E+ PP M+PPPKPMP  L K+  + P+    VD+ V+E++ ++  TF E V  L      DVEK RAIFR++T   ++ + +DP AP  TL+G LR ++ G++S +ELF RMC +AGIHC+ + GYSKGAGYRPGM +KDNRMFRN WTAVYV G WRFVN  WG R L  R                S   E +++ D+FYFLT+ ++HI+EH+PD +RWQLL   +TL  FM LP++KSPFFNA L  K+  Y + L T+ G+V++KI + + VGVS +L+NR D + LRG TLAR++ G+++ V ASP+QPG ++L+I+V+ DW S ++ E+A SFQV C+E+N+DRL  GR+P+VG LG+TPA+Q LGI       A   +DP+V+   +  L+L +A  PGL+V  +M  Y RSG N+  CD YALLQ + + +++Y L  P +G+Y  T+YAG       D+EP            ++C+YR+LIDC+R   ++P FP QTS + G  L EP+ +HL++   Y FR+ A    +V+VV+N   W+DL  S  G+W  K++ G+EL  LSVYG+   +E  +F KLLDY ++ +
Sbjct: 1696 LAASTATLLNNLEPGVTNVMLGPEGTLREAASMHTMLHPTEPARTVVWDPSQPEVPPPAMRPPPKPMPPGLSKT--VPPDGWKAVDDHVMEILDIDCNTFAEQVNSLCGRYQSDVEKCRAIFRFLTARLVQPLVYDPQAPPTTLIGCLRMVQAGEVSPHELFKRMCAHAGIHCEILHGYSKGAGYRPGMNLKDNRMFRNTWTAVYVEGCWRFVNVAWGGRRLAKR----------------SGATELRLKCDDFYFLTEPEEHIYEHWPDDRRWQLLRTSVTLSHFMRLPMLKSPFFNAGLRLKKGKYDDTLMTQNGRVSLKIGVTKFVGVSCQLQNRADMSSLRGKTLARLI-GEVLHVLASPAQPGTYFLNIFVSPDWTSNEH-ELAASFQVKCAENNFDRLALGRYPEVGFLGATPAAQQLGISFLTSHGAKTPMDPYVVHTAKELLRLPVAAAPGLKVAHQMKCYQRSGVNTEQCDPYALLQCRGKQQAEYWLACPADGYYFFTVYAGE---AAKDSEPAGSAQDSEEGGDLDCVYRVLIDCRRGLGKVPAFPAQTSLFNGCYLHEPMQRHLDVGRKYNFRLEARHFKAVAVVLNGNTWLDLDSSRGGIWSKKLSVGEELGELSVYGQLQTDETGQFHKLLDYEIVQR 2324          
BLAST of SWIM-type domain-containing protein vs. TrEMBL
Match: A0A267EBZ4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001514g2 PE=4 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 5.366e-157
Identity = 287/652 (44.02%), Postives = 412/652 (63.19%), Query Frame = 1
Query: 2968 MTMSRTDLHNHLRPGLS------MSSLSDAYYQHTL----DNDRMVYWRADIEELLXXXXXXXXXXXXTNLLKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKR-NYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGVLGSTPASQNLGII------ANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTEP------------MECIYRLLIDCKRAQERIPPFPRQTSRWVGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVNTGQELENLSVYGKFGINEDDEFIKLLDYVLIAK 4836
            +  S   L N+L PG++        +L +A   HT+    +  R V W     E+ PP M+PPPKPMP  L K+  + P+    VD+ V+E++ ++  TF E V  L      DVEK RAIFR++T   ++ + +DP AP  TL+G LR ++ G++S +ELF RMC +AGIHC+ + GYSKGAGYRPGM +KDNRMFRN WTAVYV G WRFVN  WG R L  R                S   E +++ D+FYFLT+ ++HI+EH+PD +RWQLL   +TL  FM LP++KSPFFNA L  K+  Y + L T+ G+V++KI + + VGVS +L+NR D + LRG TLAR++ G+++ V ASP+QPG ++L+I+V+ DW S ++ E+A SFQV C+E+N+DRL  GR+P+VG LG+TPA+Q LGI       A   +DP+V+   +  L+L +A  PGL+V  +M  Y RSG N+  CD YALLQ + + +++Y L  P +G+Y  T+YAG       D+EP            ++C+YR+LIDC+R   ++P FP QTS + G  L EP+ +HL++   Y FR+ A    +V+VV+N   W+DL  S  G+W  K++ G+EL  LSVYG+   +E  +F KLLDY ++ +
Sbjct: 1728 LAASTATLLNNLEPGVTNVMLGPEGTLREAASMHTMLHPTEPARTVVWDPSQPEVPPPAMRPPPKPMPPGLSKT--VPPDGWKAVDDHVMEILDIDCNTFAEQVNSLCGRYQSDVEKCRAIFRFLTARLVQPLVYDPQAPPTTLIGCLRMVQAGEVSPHELFKRMCAHAGIHCEILHGYSKGAGYRPGMNLKDNRMFRNTWTAVYVEGCWRFVNVAWGGRRLAKR----------------SGATELRLKCDDFYFLTEPEEHIYEHWPDDRRWQLLRTSVTLSHFMRLPMLKSPFFNAGLRLKKGKYDDTLMTQNGRVSLKIGVTKFVGVSCQLQNRADMSSLRGKTLARLI-GEVLHVLASPAQPGTYFLNIFVSPDWTSNEH-ELAASFQVKCAENNFDRLALGRYPEVGFLGATPAAQQLGISFLTSHGAKTPMDPYVVHTAKELLRLPVAAAPGLKVAHQMKCYQRSGVNTEQCDPYALLQCRGKQQAEYWLACPADGYYFFTVYAGE---AAKDSEPAGSAQDSEEGGDLDCVYRVLIDCRRGLGKVPAFPAQTSLFNGCYLHEPMQRHLDVGRKYNFRLEARHFKAVAVVLNGNTWLDLDSSRGGIWSKKLSVGEELGELSVYGQLQTDETGQFHKLLDYEIVQR 2356          
BLAST of SWIM-type domain-containing protein vs. TrEMBL
Match: A0A430QMV6 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0000731 PE=4 SV=1)

HSP 1 Score: 531.561 bits (1368), Expect = 2.620e-156
Identity = 274/581 (47.16%), Postives = 377/581 (64.89%), Query Frame = 1
Query: 3157 SAIISPESLIHVDNM-VIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARIL--DGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRL-VTGRFPDVGVLGSTPASQNLGIIANPGVD-----PFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQ--------------YQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTEPMECIYRLLIDCK--RAQERIPPFPRQTSRWVGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSS---------------NGLWKGKVNTGQELENLSVYGKF 4779
            + I+ P+  I V +M  IEV      TF+EL+  LT     +VE +R+++RW T  D +  ++DP AP D+L+G+LR +K  Q+S NELF+ +CRYAG+ CQ+I+GYSKGAGYRPGM IKDN++FRN W AVY+   WRFVNCNWGARYL+   + LP       R+S S+        DEFYFLTD +QH+FE+ PD K WQLL +P+++D+F  LP++KSPFFNANL  K+NY++ L TK G+V+VKI M + VG+S  LEN  D +IL GL L  IL      + + A+PSQPGK+YL++YV+ DW+ ED  E+ACSFQ+HCSE+NY RL VTGR P+VG LG TPAS+  G++  P  D     P+++ ++   LK+  AI PGL++  ++ S+DR G   A CDSYALLQ              ++SQ  + Y++R P++ FY LTIYA  ++  + D   ++C+YR+LID +  R+ E I  +PRQT  WV  RL+EP  QHL +N  Y+F + A QC SV+VVIN ++W  L  SS               +G W GKV TG+ L  LSV+G+ 
Sbjct: 1044 TTILPPDDRIRVIDMHAIEVTNRVHMTFSELISDLTTGIDNEVEVIRSLYRWTTGKDTRYEDYDPEAPCDSLIGMLRQMKYNQLSRNELFYELCRYAGLQCQYITGYSKGAGYRPGMPIKDNQLFRNTWLAVYICDGWRFVNCNWGARYLS---ENLPD-----GRSSSSE-------CDEFYFLTDPEQHVFENLPDLKVWQLLRKPLSMDRFCHLPLLKSPFFNANLFLKKNYSDCLVTKNGQVSVKIKMSRFVGISCSLENCADHSILLGLCLVEILLRPPGTVRIEAAPSQPGKYYLNVYVSPDWRREDIRELACSFQIHCSEYNYSRLVVTGRLPEVGFLGRTPASEVHGVLMVPEGDASDGRPYIIHNDPRPLKIPFAIAPGLKLCHQLKSFDRPGHQMADCDSYALLQMKPNHHSSITHSKPFKSQANAYYNVRLPVQAFYYLTIYAFNENDIVKDH--LDCVYRILIDARNCRSSELIQAYPRQTFWWVQCRLIEPKYQHLFINRNYKFCLDAPQCDSVAVVINGSEWHFLTPSSPISPSKLHSPSGSNHHGRWSGKVYTGKCLGQLSVFGRI 1607          
BLAST of SWIM-type domain-containing protein vs. Ensembl Cavefish
Match: ky (uncharacterized LOC103044048 [Source:NCBI gene;Acc:103044048])

HSP 1 Score: 119.013 bits (297), Expect = 1.708e-26
Identity = 87/332 (26.20%), Postives = 152/332 (45.78%), Query Frame = 1
Query: 3190 VDNMVIEV--MLLEPTTFT--ELVLYLTKDCSKDVEKVRAIFRWIT---TYDIKS-VNFDPA-APNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKI---RSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTAS---------PSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHC 4122
            VD + I     L E   F+   +   +T+    ++EK+RAI+ W+     YD++  +   P     + ++   R + C   S+  +   MCR  G+ C+ +SGYSKG G+ PG  +  +R   + W  V+V   W  ++  WGA             GT+         +E K    R D+FYFLTD  + I  HFPD++ WQLL  PI+L++F   P+  S F+   L+ ++     + T+ G+ TV +   + +  + +L  R    +  G+   R +D    +++ +         P  PG + L ++   +  S   +   CS ++ C
Sbjct:  195 VDTLAISAGRELKEQGVFSAQSIARAITQGAINELEKLRAIWVWLCHNIEYDLEGYLGLSPKLCTPEEVIKQGRGV-CSGFSS--ICLEMCREVGVQCEEVSGYSKGIGHSPGRKLAQDRS-DHSWNVVWVKDRWGLLDACWGA-------------GTV--------NMETKTFVKRFDDFYFLTDPSEFINSHFPDEQHWQLLDTPISLEKFELGPLKTSAFYTLGLTLQQPTQYKITTEDGEATVSVTSSRPLTFAYELRQR---DVQTGVPGQREVDSSCGLLSVTRQGMSLRLLPPDPGDYELKLFARAEGDS-GALRWVCSLELEC 497          
BLAST of SWIM-type domain-containing protein vs. Ensembl Cavefish
Match: ky (uncharacterized LOC103044048 [Source:NCBI gene;Acc:103044048])

HSP 1 Score: 119.013 bits (297), Expect = 1.708e-26
Identity = 87/332 (26.20%), Postives = 152/332 (45.78%), Query Frame = 1
Query: 3190 VDNMVIEV--MLLEPTTFT--ELVLYLTKDCSKDVEKVRAIFRWIT---TYDIKS-VNFDPA-APNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKI---RSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTAS---------PSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHC 4122
            VD + I     L E   F+   +   +T+    ++EK+RAI+ W+     YD++  +   P     + ++   R + C   S+  +   MCR  G+ C+ +SGYSKG G+ PG  +  +R   + W  V+V   W  ++  WGA             GT+         +E K    R D+FYFLTD  + I  HFPD++ WQLL  PI+L++F   P+  S F+   L+ ++     + T+ G+ TV +   + +  + +L  R    +  G+   R +D    +++ +         P  PG + L ++   +  S   +   CS ++ C
Sbjct:  195 VDTLAISAGRELKEQGVFSAQSIARAITQGAINELEKLRAIWVWLCHNIEYDLEGYLGLSPKLCTPEEVIKQGRGV-CSGFSS--ICLEMCREVGVQCEEVSGYSKGIGHSPGRKLAQDRS-DHSWNVVWVKDRWGLLDACWGA-------------GTV--------NMETKTFVKRFDDFYFLTDPSEFINSHFPDEQHWQLLDTPISLEKFELGPLKTSAFYTLGLTLQQPTQYKITTEDGEATVSVTSSRPLTFAYELRQR---DVQTGVPGQREVDSSCGLLSVTRQGMSLRLLPPDPGDYELKLFARAEGDS-GALRWVCSLELEC 497          
BLAST of SWIM-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000032424.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:316716:330052:1 gene:ENSAMXG00000039459.1 transcript:ENSAMXT00000032424.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 5.393e-22
Identity = 73/297 (24.58%), Postives = 132/297 (44.44%), Query Frame = 1
Query: 3271 SKDVEKVRAIFRWIT---TYDIKS---VNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLEN-----RTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSE 4128
            + D+E++RA++ W+     YD++    V     +P+D    V+R  K        +  ++C   GI C+ ++GY KG GY PG   +      + W AV + G W  ++  WGA                      SQ + NK   +EFYFLTD ++ I +H+P +++WQLL RP+ L +F       + F+   L+        L T+ G+ T+ + + +    +  +       +T+ +  RGL        ++ V+   P   G F + ++      +     + CSF + C++
Sbjct:   59 TNDLERLRAVWIWLCDNIEYDVEGFLGVTKKLYSPDD----VIRTGKAVCSGYAGVCLQLCNVVGIECREVNGYGKGVGYEPGQKCQGTN---HAWNAVNLEGHWHLLDSCWGA-----------------GNCDMSQRVFNKCY-NEFYFLTDPEEFINDHYPAEEKWQLLERPVNLKEFEKKVTKSAQFYRLGLTLIHPKQCSLDTENGEATISMGLSEPANFTYTISQCNGSKKTELSKSRGLLTITKSSMKLRVI---PPTAGSFEVELFARAAGVTGSYSHL-CSFLLKCAK 326          
BLAST of SWIM-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040397.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:312137:330052:1 gene:ENSAMXG00000039459.1 transcript:ENSAMXT00000040397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 7.038e-22
Identity = 73/298 (24.50%), Postives = 135/298 (45.30%), Query Frame = 1
Query: 3271 SKDVEKVRAIFRWIT---TYDIKS---VNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTAS------PSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSE 4128
            + D+E++RA++ W+     YD++    V     +P+D    V+R  K        +  ++C   GI C+ ++GY KG GY PG   +      + W AV + G W  ++  WGA                      SQ + NK   +EFYFLTD ++ I +H+P +++WQLL RP+ L +F       + F+   L+        L T+ G+ T+ + + +    +  + ++ +G+    L+ +R   G + +  +S      P   G F + ++      +     + CSF + C++
Sbjct:  220 TNDLERLRAVWIWLCDNIEYDVEGFLGVTKKLYSPDD----VIRTGKAVCSGYAGVCLQLCNVVGIECREVNGYGKGVGYEPGQKCQGTN---HAWNAVNLEGHWHLLDSCWGA-----------------GNCDMSQRVFNKCY-NEFYFLTDPEEFINDHYPAEEKWQLLERPVNLKEFEKKVTKSAQFYRLGLTLIHPKQCSLDTENGEATISMGLSEPANFTYTI-SQCNGSKKTELSKSR---GLLTITKSSMKLRVIPPTAGSFEVELFARAAGVTGSYSHL-CSFLLKCAK 487          
BLAST of SWIM-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009155.1 (pep scaffold:Pmarinus_7.0:GL483885:156116:165500:-1 gene:ENSPMAG00000008280.1 transcript:ENSPMAT00000009155.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 1.058e-16
Identity = 56/202 (27.72%), Postives = 91/202 (45.05%), Query Frame = 1
Query: 3241 ELVLYLTKDCSKDVEKVRAIFRWIT---TYDIKSVNFDPAAPNDTLVGVL--RAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFN 3831
            ++V  +T+D   ++EK+R+I+ W+     YD+K   F     N     VL  R   C   +   L   MCR+ G+ C+ + GY K  G+ P   I+D     + W AV + G W  ++  WGA  +++  Q                      R +EFYFL D K+ +  H+P   +WQL+   ++ + F    +    FFN
Sbjct:    1 KIVEMITQDTQTELEKLRSIWIWVCHNIEYDVKYW-FGKDKSNYKKEDVLSSRTAICAGYAG--LVNEMCRHVGVECEEVVGYGKTLGHVP-FQIEDPN---HAWNAVRIGGRWYLLDACWGAGAVSNETQSFNR------------------RYNEFYFLADPKKFVESHWPKISKWQLMEHLVSREDFEYRVLKDFRFFN 177          
BLAST of SWIM-type domain-containing protein vs. Ensembl Nematostella
Match: EDO40037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B7])

HSP 1 Score: 66.6254 bits (161), Expect = 8.285e-11
Identity = 66/307 (21.50%), Postives = 127/307 (41.37%), Query Frame = 1
Query: 3295 AIFRWIT---TYDIKSVNFDPAAPNDTL---VGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTI----LRGLTLARILDGQMIV---VTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGV 4176
            A++RWIT   ++D +   F  A   +     V V R+      +N  LF  +C  A I  + + G++KG GY  G  I+ ++ F + W  +     W   +  WG+ +L            +  R   + Y           F+   +  I +HFP   +WQLL   I+ ++F  L +     F++ L  + +     Q +   + + +  P+   +   L++ +  TI    +  +T  ++ +   ++   VT    +PG++ + I +     +E  +     ++V CS        TG FP +G 
Sbjct:  217 ALYRWITLNVSFDSEGY-FGRAEKKECRAESVLVTRSAVSQGFAN--LFQALCMEADIQARSVDGFAKGYGYCAGDEIQGSK-FAHTWNILRTRVGWTICDVTWGSGFL--------GDDLMFHRQPNAHY-----------FMVTPELAISDHFPLDTKWQLLDAVISKEEFENLIVPSPAIFSSGLRLESHKNCFYQEESDSIVITLRAPKRNMIRGVLKDSSGQTIGPRNMIDVTSGKLKEADFLIPVKVTTHFPEPGEYRVQICL---VSAEGQLVPGVEYRVRCSRGVGQN--TGGFPHLGT 495          
BLAST of SWIM-type domain-containing protein vs. Ensembl Nematostella
Match: EDO32609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUI9])

HSP 1 Score: 64.3142 bits (155), Expect = 4.251e-10
Identity = 69/321 (21.50%), Postives = 121/321 (37.69%), Query Frame = 1
Query: 3187 HVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWIT---TYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQF--MALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARI-LDG-QMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSE 4128
             +D  V         +  +L  YLT+  S D EK  AI+RW+T    YD+          + +   VL +          L+  +   AG+    +SGY+KG G++ G   +      + W  + V   W   +  WGA ++            L ++   +           + FL    + IF+H P++++WQ L   I    F   A P  +       L   ++YA   +T    + +    P    + +     + G  L G    R+   G   I + A     G + + +YV    K E++     S++V  S+
Sbjct:  197 EIDKHVQNTPASATASINQLSDYLTECFSTDREKAFAIYRWLTFNVAYDVDGFFGRSEKKSTSAEDVLSSRTSVCAGYASLYTALGEAAGLEIHNVSGYAKGYGHKLGQRFEG---VNHAWNVLKVDNTWYVSDATWGAGFV--------GDDMLFTKNPNT-----------YRFLQVPDEAIFDHLPEEEKWQFLDPTIDKASFERSAKPSCEMLEMGIELESHKDYA--YETPTDTIDMTFYCPGRKMLLMGKVKTSSGQALEGRERVRLRFKGLHQIEMRAQFPNAGTYKVEVYV---VKGENSWNHGVSYEVTASQ 490          
BLAST of SWIM-type domain-containing protein vs. Ensembl Medaka
Match: ky (kyphoscoliosis peptidase [Source:NCBI gene;Acc:101165522])

HSP 1 Score: 112.079 bits (279), Expect = 1.945e-24
Identity = 92/378 (24.34%), Postives = 152/378 (40.21%), Query Frame = 1
Query: 3244 LVLYLTKDCSKDVEKVRAIFRWIT---TYDIKSV--NFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTAS---------PSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHC---------SEHNYDRLVTGRFPDVGVLGSTPASQNLGII-ANPGVDPFVLWDERSTLKLNIAIRPGLRVG 4305
            +V  +T++   +++++RAI+ W+     YD+       +  +  + ++   R + C   S + L   MCR  GI CQ + G+SKG GYR G +++      ++W AV + G W  ++  WGA  +   H+                      R D+FYFLTD ++ I  HFP++++WQLL  PI L+ F       S FF   L     +   + T  G+  V I        + ++    D      L           ++T S         P   G +   ++   + K+   +   CSF V C          E+ Y  L  G  P    LG    SQ+  +   + GV   VL   R  + L   + P +   
Sbjct:  200 IVHSITRESRNELDRLRAIWVWLCHNIEYDVSGYLGRSEKLSSLEEVIAAGRGVCC---SYSSLCLEMCREVGIECQEVPGHSKGVGYRQGQSLRHVNS-DHLWNAVLLGGQWFLLDACWGAGRVDMEHESFVR------------------RFDDFYFLTDPEEFIESHFPEEEKWQLLDTPIILEDFEKRVFKTSAFFTLGLRLINPHHFHIVTDDGEANVSIGFSSPTTFTYEITQHRDLLHCGALEQKESSSSSFGILTVSHRSMNLQLLPPATGSYDCKVFARHE-KASTPLVWVCSFTVECLAPRAMEVIPENPY--LSWGMQPVAASLGVADCSQSREVAEVDKGVFDLVLKTSRPLMVLCELVHPQMEAA 552          

HSP 2 Score: 56.225 bits (134), Expect = 3.434e-7
Identity = 84/342 (24.56%), Postives = 136/342 (39.77%), Query Frame = 1
Query: 3832 ANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNY--DRL-------VTGRFPDVGVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTE--PMECIYRLLIDCKRAQERIPPFPRQTSRW-VGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVNTGQELENLSVYGKFGINEDDEFIKLLDY 4821
            A+ S  R  AEV    KG   + +   + + V  +L +      L    LA  +   +++       PG + LS++V +  KSE   + A +F +HC    +  D L         G        G +  S N  +++       + +  +  L+L+             +S D S   + P   + L  Y +  +    +  P  G Y L +YA V     P  E  PM C + L   C       PPFP   S W  G  L EP    L+  +   FR+       VSVV  +T+  DL ++ + +W+G+V TG  L+ L +   F   E D+   L+ +
Sbjct:  512 ADCSQSREVAEV---DKGVFDLVLKTSRPLMVLCELVHPQMEAALAKRCLATQIQPDILLCHVLCPFPGFYRLSVFVRDYEKSELKFQNAANFLLHCKGKVFHVDELFPPNLGSACGPGTRTAQAGLSKFSHNASVVSTQQGKCNITFHNQRDLELHCT-----------LSRDESKAPAVPLSRHLLCTY-TDTKVTVSISLPEVGVYRLGLYARVG----PGGEFSPM-CDFVLRNSCALPG---PPFPCLYSAWRKGCVLFEPRAGLLDPLSRVHFRVRVPGALRVSVV-GETR-TDLTLNKSRVWEGEVFTGDALQQLKLAACF--RESDDMAVLMTF 826          
BLAST of SWIM-type domain-containing protein vs. Ensembl Medaka
Match: ky (kyphoscoliosis peptidase [Source:NCBI gene;Acc:101165522])

HSP 1 Score: 110.153 bits (274), Expect = 7.697e-24
Identity = 76/307 (24.76%), Postives = 129/307 (42.02%), Query Frame = 1
Query: 3244 LVLYLTKDCSKDVEKVRAIFRWIT---TYDIKSV--NFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTAS---------PSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHC 4122
            +V  +T++   +++++RAI+ W+     YD+       +  +  + ++   R + C   S + L   MCR  GI CQ + G+SKG GYR G +++      ++W AV + G W  ++  WGA  +   H+                      R D+FYFLTD ++ I  HFP++++WQLL  PI L+ F       S FF   L     +   + T  G+  V I        + ++    D      L           ++T S         P   G +   ++   + K+   +   CSF V C
Sbjct:  200 IVHSITRESRNELDRLRAIWVWLCHNIEYDVSGYLGRSEKLSSLEEVIAAGRGVCC---SYSSLCLEMCREVGIECQEVPGHSKGVGYRQGQSLRHVNS-DHLWNAVLLGGQWFLLDACWGAGRVDMEHESFVR------------------RFDDFYFLTDPEEFIESHFPEEEKWQLLDTPIILEDFEKRVFKTSAFFTLGLRLINPHHFHIVTDDGEANVSIGFSSPTTFTYEITQHRDLLHCGALEQKESSSSSFGILTVSHRSMNLQLLPPATGSYDCKVFARHE-KASTPLVWVCSFTVEC 483          

HSP 2 Score: 55.0694 bits (131), Expect = 6.805e-7
Identity = 71/275 (25.82%), Postives = 112/275 (40.73%), Query Frame = 1
Query: 4033 PGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNY--DRL-------VTGRFPDVGVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTE--PMECIYRLLIDCKRAQERIPPFPRQTSRW-VGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVNTGQELENLSVYGKFGINEDDEFIKLLDY 4821
            PG + LS++V +  KSE   + A +F +HC    +  D L         G        G +  S N  +++       + +  +  L+L+             +S D S   + P   + L  Y +  +    +  P  G Y L +YA V     P  E  PM C + L   C       PPFP   S W  G  L EP    L+  +   FR+       VSVV  +T+  DL ++ + +W+G+V TG  L+ L +   F   E D+   L+ +
Sbjct:  550 PGFYRLSVFVRDYEKSELKFQNAANFLLHCKGKVFHVDELFPPNLGSACGPGTRTAQAGLSKFSHNASVVSTQQGKCNITFHNQRDLELHCT-----------LSRDESKAPAVPLSRHLLCTY-TDTKVTVSISLPEVGVYRLGLYARVG----PGGEFSPM-CDFVLRNSCALPG---PPFPCLYSAWRKGCVLFEPRAGLLDPLSRVHFRVRVPGALRVSVV-GETR-TDLTLNKSRVWEGEVFTGDALQQLKLAACF--RESDDMAVLMTF 800          
BLAST of SWIM-type domain-containing protein vs. Planmine SMEST
Match: SMESG000060198.1 (SMESG000060198.1)

HSP 1 Score: 2790.37 bits (7232), Expect = 0.000e+0
Identity = 1575/1576 (99.94%), Postives = 1575/1576 (99.94%), Query Frame = 1
Query:  118 MSFNNSHHIENVKLFTNRFPRKSQEKIYHXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVILDDYTTLKTELKNNQISPSILKRLXXXXXXXXXXXXHPLLSTKTKSLPIIFXXXXXXXXXXXXXXXXXXNEXXXXXXXXXXXXVLANEMNSKNSNEILILNQSNSSEITNNSYQNSVSQLQHNQPIRIKKTNSIDSSNKISPALLIVDDNSNNDFKMCDSLNGNQTTMCNNNATTLHTHNSSSIADLDMAHQFIGVPEWTKINKSSNSLSQSTELIFNKRTPRFPVKNNSNTVENSENKHLLIPDQFECENTMKNYXXXXXXXXXXXXXXEKLENNNLRISNKIPPNETPNETILDHQKKPPVGRKPKNEKEHTEPTTDLDDLIEGHHRXXXXXXXXXXXXXXXXXGGNEPAKTESYFKKEMLKNYTKTDLIIMPIKTQQNSASNNRLYEKKQDQGKVENTKTKPSETIGLLSYQKDSPSKRSQELVGSVVKMDKTINRVTNNIERIDNAIDKLSQFNKAYMSNLETMSDSELSIDFETHSIGAQTDLSNPNYHEKSSENSNKVQEXXXXXXXXXXXXITPXXXXXXXXXXXXXXXXXXXXXXXVALKPSPVHQIIDKPIIKFRXXXXXXXXXXXXXILDSKTDGNKFFRTSNLAHTESDVSSLPESSVCENPETRDLVGKVKYFQRQIIKSSGLYKKPPNIEPPKKLVVEEPHLKVQSSQRPIPKPRNSIDYALRRMXXXXXXXXXFDFNGKTLSNSNNHTQISPSPGNSDSGSIISLGSNHLERKFQKGAGASARYNTKSKPNDKWGTVGSRRSQKSKPEEECASLSGRPMPNKNQMKIYMXXXXXXXXXXXXXXXXPDEKSKYGSLAALNKNYGLQDINSLCDIIRQNLNLNNHDKIRNIFNALIIENEHDKIDVIIDNFXXXXXXXXXXXXPDNHYTSKDAESIFDMTMSRTDLHNHLRPGLSMSSLSDAYYQHTLDNDRMVYWRADIEELLXXXXXXXXXXXXTNLLKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTEPMECIYRLLIDCKRAQERIPPFPRQTSRWVGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVNTGQELENLSVYGKFGINEDDEFIKLLDYVLIAKSNK 4845
            MSFNNSHHIENVKLFTNRFPRKSQEKIYHEEIEDFDSSESSESSYDCTSDGSSSSDEFVILDDYTTLKTELKNNQISPSILKRLSKNQKSNKKNVNHPLLSTKTKSLPIIFERSDESSVSSQSTLELSENESTLSDCSTSSSSVLANEMNSKNSNEILILNQSNSSEITNNSYQNSVSQLQHNQPIRIKKTNSIDSSNKISPALLIVDDNSNNDFKMCDSLNGNQTTMCNNNATTLHTHNSSSIADLDMAHQFIGVPEWTKINKSSNSLSQSTELIFNKRTPRFPVKNNSNTVENSENKHLLIPDQFECENTMKNYQYQQKKPPVSVKPVEKLENNNLRISNKIPPNETPNETILDHQKKPPVGRKPKNEKEHTEPTTDLDDLIEGHHRNSNESLELSSSSASHSSGGNEPAKTESYFKKEMLKNYTKTDLIIMPIKTQQNSASNNRLYEKKQDQGKVENTKTKPSETIGLLSYQKDSPSKRSQELVGSVVKMDKTINRVTNNIERIDNAIDKLSQFNKAYMSNLETMSDSELSIDFETHSIGAQTDLSNPNYHEKSSENSNKVQENSNNKYPKNSSKITPENESSSSDESSTEKETSSESENSVALKPSPVHQIIDKPIIKFRSSSPGYKSSPSKPILDSKTDGNKFFRTSNLAHTESDVSSLPESSVCENPETRDLVGKVKYFQRQIIKSSGLYKKPPNIEPPKKLVVEEPHLKVQSSQRPIPKPRNSIDYALRRMSNSSSESSNFDFNGKTLSNSNNHTQISPSPGNSDSGSIISLGSNHLERKFQKGAGASARYNTKSKPNDKWGTVGSRRSQKSKPEEECASLSGRPMPNKNQMKIYMNQSRSYNNLNSLNSKNPDEKSKYGSLAALNKNYGLQDINSLCDIIRQNLNLNNHDKIRNIFNALIIENEHDKIDVIIDNFEENERNILLELIPDNHYTSKDAESIFDMTMSRTDLHNHLRPGLSMSSLSDAYYQHTLDNDRMVYWRADIEELLPPPMKPPPKPMPTNLLKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSR QELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTEPMECIYRLLIDCKRAQERIPPFPRQTSRWVGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVNTGQELENLSVYGKFGINEDDEFIKLLDYVLIAKSNK
Sbjct:    1 MSFNNSHHIENVKLFTNRFPRKSQEKIYHEEIEDFDSSESSESSYDCTSDGSSSSDEFVILDDYTTLKTELKNNQISPSILKRLSKNQKSNKKNVNHPLLSTKTKSLPIIFERSDESSVSSQSTLELSENESTLSDCSTSSSSVLANEMNSKNSNEILILNQSNSSEITNNSYQNSVSQLQHNQPIRIKKTNSIDSSNKISPALLIVDDNSNNDFKMCDSLNGNQTTMCNNNATTLHTHNSSSIADLDMAHQFIGVPEWTKINKSSNSLSQSTELIFNKRTPRFPVKNNSNTVENSENKHLLIPDQFECENTMKNYQYQQKKPPVSVKPVEKLENNNLRISNKIPPNETPNETILDHQKKPPVGRKPKNEKEHTEPTTDLDDLIEGHHRNSNESLELSSSSASHSSGGNEPAKTESYFKKEMLKNYTKTDLIIMPIKTQQNSASNNRLYEKKQDQGKVENTKTKPSETIGLLSYQKDSPSKRSQELVGSVVKMDKTINRVTNNIERIDNAIDKLSQFNKAYMSNLETMSDSELSIDFETHSIGAQTDLSNPNYHEKSSENSNKVQENSNNKYPKNSSKITPENESSSSDESSTEKETSSESENSVALKPSPVHQIIDKPIIKFRSSSPGYKSSPSKPILDSKTDGNKFFRTSNLAHTESDVSSLPESSVCENPETRDLVGKVKYFQRQIIKSSGLYKKPPNIEPPKKLVVEEPHLKVQSSQRPIPKPRNSIDYALRRMSNSSSESSNFDFNGKTLSNSNNHTQISPSPGNSDSGSIISLGSNHLERKFQKGAGASARYNTKSKPNDKWGTVGSRRSQKSKPEEECASLSGRPMPNKNQMKIYMNQSRSYNNLNSLNSKNPDEKSKYGSLAALNKNYGLQDINSLCDIIRQNLNLNNHDKIRNIFNALIIENEHDKIDVIIDNFEENERNILLELIPDNHYTSKDAESIFDMTMSRTDLHNHLRPGLSMSSLSDAYYQHTLDNDRMVYWRADIEELLPPPMKPPPKPMPTNLLKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRLQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDVGVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTEPMECIYRLLIDCKRAQERIPPFPRQTSRWVGFRLVEPLCQHLELNTPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVNTGQELENLSVYGKFGINEDDEFIKLLDYVLIAKSNK 1576          
BLAST of SWIM-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061907.1 (SMESG000061907.1)

HSP 1 Score: 160.999 bits (406), Expect = 3.137e-39
Identity = 99/327 (30.28%), Postives = 162/327 (49.54%), Query Frame = 1
Query: 3172 PESLIHVDNMVIEVMLLEPTTFTELVLYLT-KDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAVGVSVKLE-----NRTDGTILRGLTLARILDGQMIVVTASPSQPGKFYLSIYV------NEDWKSEDNMEMACSFQV 4116
            P     VD   I V      TF +L+  L  +    D+EK R IFRW+T  D+  ++F  + PN     VL ++K  + S    F  MC YAG+ C  ISG++KG  Y+PG   K +  F + W  +++  +W+ ++ +W  RYLTS        G     +   QY       D+FYF+ + +Q ++ HFP+K  WQLL +P+TL+QF  LP+ KS FF   + F+  +  V+ +K G + + +   +    + KL+     ++ +G  LR   L   ++ Q+      P+  G FYL+I+       N+    E+    AC +++
Sbjct:   35 PYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPNGP-EEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDE-FNHTWNVIHLQNSWQLIDAHWATRYLTS--------GKNTQDSIVYQY-------DDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDENKDQFEGVSLRYYVLQETVNNQINFFFRFPTA-GVFYLTIFAQELNEHNQPVTQENTFRAACEYKI 343          

HSP 2 Score: 157.532 bits (397), Expect = 4.580e-38
Identity = 87/259 (33.59%), Postives = 133/259 (51.35%), Query Frame = 1
Query: 3166 ISPES----LIHVDNMVIEVMLLEPTTFTELV--LYLTKDCSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLEN-KIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMPQAV 3921
            ISPE        VD   ++V   +   F +L+  L   ++ + ++EKVR IF W+ T D+  +NFD     D+   +L  I+ G+ +  ++F  +CRYAG+HC+ I GY+KGA Y PGM  +  R   + W AV + G WR ++C+W AR L  +  +                 EN +   D FYFL +  Q I+ HFP    WQLL   I +++F +L  VKS FF  NL    +   V+QT   +  ++I  P+ +
Sbjct: 1135 ISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFD-NIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQ-GRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKP----------------ENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGI 1375          

HSP 3 Score: 68.5514 bits (166), Expect = 4.540e-11
Identity = 73/299 (24.41%), Postives = 129/299 (43.14%), Query Frame = 1
Query: 3979 LARILDGQMIVVTASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPDV--GVLGS-TPASQNLGIIANPGVDPFVLWDERST-LKLNIAIRPGLRVGQKMMSYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPDLPDTEPMEC---IYRLLIDCKRAQERIPPFPRQTSRWV-GFRLVEPLCQHLELN-TPYR--FRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVN-----TGQELENLSVYGKFGINEDDEFIKLLDYVL 4827
            L R++     ++       G++ L +Y N+  K+ ++      + +  S  +   +V+G  P +  G LG   P   + G+      DPF++ +     ++L       +R+  +++       N +   S   LQ        + +R P +GF+   I+A      LP +E  E    ++  LI+  ++ +    FP+Q  +W  G  L EP    L  N  P +  FR+   +  S++VV ND  W  L  SS+G+W G V+            LSV G FG+  D  +  +L YV+
Sbjct: 1540 LQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTAS---IVSG-LPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLI---HCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFA------LPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWTGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVI 1825          
BLAST of SWIM-type domain-containing protein vs. Planmine SMEST
Match: SMESG000080370.1 (SMESG000080370.1)

HSP 1 Score: 133.265 bits (334), Expect = 4.128e-31
Identity = 80/276 (28.99%), Postives = 135/276 (48.91%), Query Frame = 1
Query: 3190 VDNMVIEVMLLEPTTFTELVLYLTKDCSKDV-----EKVRAIFRWITTYDIKSVNFDPAA-PNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMP----QAVGVSVKLENRTDGTILRGLTLAR 3987
            +D + I +     ++F  L+ +L  + +  +     +KV A+F W+TT ++  + F      +D+   VL  I  G+ +  ++F  +CRY G+ C+ I GY+KG  Y+PGM +   +  ++ W AV V   W   +C+W AR              L+ +T  S  +  K   D FYF+T+  Q  + HFP ++ WQL  + ITL++F  L +VK  FF  NL    +   VL+ +  K+ + I +P    + + ++  L     G I  G  L R
Sbjct:   95 LDELAITIGKHSFSSFIPLIYHLIYNRTDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAAR-------------RLMGKTINSDRI--KYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD-KLVLMIKLPIELVEKICLTFTLTLEGLGEIYEGSNLTR 354          
BLAST of SWIM-type domain-containing protein vs. Planmine SMEST
Match: SMESG000073008.1 (SMESG000073008.1)

HSP 1 Score: 131.724 bits (330), Expect = 1.551e-30
Identity = 76/265 (28.68%), Postives = 129/265 (48.68%), Query Frame = 1
Query: 3151 LKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKD---CSKDVEKVRAIFRWITTYDIKSVNFD-----PAAPND---TLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMP 3912
            ++ + ISP S  + D + + +   +  TF  LV  L  +      D++K RA+F W+T  +    +FD         ND   + +  L  +  GQ +  + F  +CR+AGI C+ + GY+KG  ++PGM ++  +  ++ W +V ++G W   + +W AR L  R+               +Q  +N  + D FYFL       + HFP  K WQL+  PI+L+ F  L IVK  FF   LSF   +  +++T    + +++  P
Sbjct:  108 IEQSRISP-SEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRN--------------SNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKT-NNDIKIELKFP 356          
BLAST of SWIM-type domain-containing protein vs. Planmine SMEST
Match: SMESG000073008.1 (SMESG000073008.1)

HSP 1 Score: 132.109 bits (331), Expect = 2.168e-30
Identity = 76/265 (28.68%), Postives = 129/265 (48.68%), Query Frame = 1
Query: 3151 LKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKD---CSKDVEKVRAIFRWITTYDIKSVNFD-----PAAPND---TLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMP 3912
            ++ + ISP S  + D + + +   +  TF  LV  L  +      D++K RA+F W+T  +    +FD         ND   + +  L  +  GQ +  + F  +CR+AGI C+ + GY+KG  ++PGM ++  +  ++ W +V ++G W   + +W AR L  R+               +Q  +N  + D FYFL       + HFP  K WQL+  PI+L+ F  L IVK  FF   LSF   +  +++T    + +++  P
Sbjct:  734 IEQSRISP-SEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRN--------------SNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKT-NNDIKIELKFP 982          
The following BLAST results are available for this feature:
BLAST of SWIM-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
KY5.027e-2826.38kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
KY5.200e-2835.68kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
KY4.858e-1637.90kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ltd-17.347e-5631.85Lim and Transglutaminase Domain [Source:UniProtKB... [more]
ltd-13.711e-5432.21Lim and Transglutaminase Domain [Source:UniProtKB... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hil2.665e-6434.68gene:FBgn0050147 transcript:FBtr0086255[more]
Hil2.665e-6434.68gene:FBgn0050147 transcript:FBtr0086256[more]
back to top
BLAST of SWIM-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ky2.639e-2326.73kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE... [more]
ky4.905e-2026.19kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cnpy11.701e-3126.85canopy FGF signaling regulator 1 [Source:Xenbase;A... [more]
lmbr12.478e-3026.28limb development membrane protein 1 [Source:Xenbas... [more]
ENSXETT00000026106.14.207e-930.13kyphoscoliosis peptidase-like [Source:NCBI gene;Ac... [more]
ENSXETT00000026111.15.101e-729.46kyphoscoliosis peptidase-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ky3.102e-2835.06kyphoscoliosis peptidase [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q0E908|HIL_DROME2.671e-6334.68Hillarin OS=Drosophila melanogaster OX=7227 GN=Hil... [more]
sp|Q8NBH2|KY_HUMAN1.515e-2826.19Kyphoscoliosis peptidase OS=Homo sapiens OX=9606 G... [more]
sp|Q8C8H8|KY_MOUSE2.287e-2735.06Kyphoscoliosis peptidase OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DV763.057e-16143.53Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E9541.285e-15744.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G4V65.219e-15744.02Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EBZ45.366e-15744.02Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A430QMV62.620e-15647.16Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ky1.708e-2626.20uncharacterized LOC103044048 [Source:NCBI gene;Acc... [more]
ky1.708e-2626.20uncharacterized LOC103044048 [Source:NCBI gene;Acc... [more]
ENSAMXT00000032424.15.393e-2224.58pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000040397.17.038e-2224.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009155.11.058e-1627.72pep scaffold:Pmarinus_7.0:GL483885:156116:165500:-... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SWIM-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO400378.285e-1121.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326094.251e-1021.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ky1.945e-2424.34kyphoscoliosis peptidase [Source:NCBI gene;Acc:101... [more]
ky7.697e-2424.76kyphoscoliosis peptidase [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of SWIM-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060198.10.000e+099.94SMESG000060198.1[more]
SMESG000061907.13.137e-3930.28SMESG000061907.1[more]
SMESG000080370.14.128e-3128.99SMESG000080370.1[more]
SMESG000073008.11.551e-3028.68SMESG000073008.1[more]
SMESG000073008.12.168e-3028.68SMESG000073008.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026870 ID=SMED30026870|Name=SWIM-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5032bp
AGTTCATGCTCCGGAAATTTTCATGAAAATAATTCAGTAGTTGTCTTCAT
TTTATCTTAATTGTAATTTAAAAGAATTATGTACAGTTAAGGTTGATTTA
AGCTCAATTCATTAACAATGTCATTTAACAATTCTCATCACATTGAAAAT
GTCAAGTTATTCACAAATCGCTTTCCCAGAAAGAGTCAAGAAAAAATTTA
TCACGAAGAAATCGAAGATTTTGATTCATCAGAATCATCTGAATCTTCTT
ACGATTGCACTTCCGATGGCTCGTCAAGTTCTGATGAGTTCGTAATACTG
GATGACTACACAACTCTTAAAACAGAATTAAAAAATAATCAAATATCTCC
AAGTATCCTAAAACGTCTTTCCAAGAATCAAAAAAGCAATAAAAAAAATG
TCAATCATCCTCTGTTATCAACTAAAACAAAATCTCTACCAATTATTTTC
GAAAGATCTGACGAAAGTTCTGTCAGTTCACAAAGTACACTAGAGTTATC
AGAAAACGAATCGACGCTTTCTGATTGCTCAACTTCATCATCTTCAGTAT
TAGCCAATGAAATGAATTCTAAAAATTCGAATGAGATATTAATTCTAAAT
CAATCCAATTCTTCTGAGATTACAAACAATTCATACCAAAATAGCGTTTC
ACAACTACAGCATAATCAACCAATCAGAATTAAGAAAACCAATTCTATCG
ATTCCAGTAATAAAATATCACCTGCTCTTTTAATTGTAGATGATAATTCT
AATAATGATTTTAAAATGTGTGACTCATTGAATGGTAATCAAACGACGAT
GTGTAATAATAATGCTACGACATTACACACACACAATTCTAGTTCAATTG
CGGATTTAGATATGGCACACCAATTTATCGGTGTGCCAGAATGGACCAAG
ATCAATAAATCATCAAATTCATTATCTCAGTCAACAGAGTTGATTTTCAA
CAAGCGAACTCCGAGATTTCCAGTGAAAAATAATTCCAATACAGTTGAAA
ACAGTGAAAATAAACATTTATTAATACCGGATCAATTTGAATGTGAAAAT
ACAATGAAAAATTATCAATATCAGCAGAAAAAGCCGCCTGTCTCTGTGAA
ACCCGTTGAGAAATTGGAAAACAACAATTTGAGAATTTCAAACAAAATAC
CTCCAAATGAAACTCCAAATGAAACTATTTTGGATCATCAAAAGAAACCA
CCAGTTGGAAGAAAACCGAAAAATGAAAAAGAACACACCGAACCAACTAC
GGATTTGGATGATCTGATTGAAGGCCATCATCGCAATTCTAATGAAAGTT
TGGAATTATCATCGTCTTCAGCCAGTCACAGTTCCGGTGGGAATGAACCG
GCAAAAACTGAGAGTTATTTTAAAAAGGAAATGTTGAAAAATTATACAAA
AACCGATTTAATAATAATGCCCATTAAAACTCAACAAAATAGCGCTAGTA
ACAATCGTTTATATGAGAAAAAACAAGATCAAGGTAAAGTGGAAAATACG
AAAACGAAACCTTCTGAAACAATCGGATTATTGTCGTATCAAAAGGATAG
CCCAAGTAAAAGATCTCAGGAACTTGTGGGCAGTGTTGTAAAAATGGATA
AAACAATAAATCGAGTAACAAACAACATCGAGAGAATTGATAATGCAATA
GATAAATTGTCTCAATTTAACAAAGCATACATGTCCAATCTTGAAACAAT
GTCAGACTCTGAATTAAGTATAGATTTCGAGACCCATAGCATAGGAGCTC
AGACAGATTTATCGAATCCAAATTACCACGAAAAATCATCAGAGAATTCT
AATAAAGTTCAAGAAAATTCAAACAATAAATATCCAAAGAATTCCTCGAA
AATTACCCCTGAAAATGAATCTTCCAGTTCCGATGAATCGTCTACCGAAA
AGGAAACAAGTTCCGAAAGTGAAAATTCAGTCGCATTGAAACCGTCTCCA
GTTCATCAAATCATTGACAAACCGATTATAAAGTTCCGTTCCAGTAGTCC
TGGTTACAAATCATCTCCTTCTAAACCGATATTGGATTCAAAAACTGATG
GGAATAAATTCTTTCGAACTTCAAACTTAGCTCACACAGAATCTGATGTT
TCCTCATTACCAGAATCATCTGTGTGTGAAAATCCAGAAACCCGAGATCT
GGTTGGCAAGGTGAAATATTTTCAAAGACAGATAATAAAATCATCGGGCC
TCTACAAAAAACCACCAAACATTGAACCGCCGAAAAAATTAGTCGTTGAA
GAACCACATCTGAAAGTTCAATCTTCTCAACGACCGATTCCTAAGCCTCG
TAATAGTATAGATTATGCTTTACGTCGCATGAGCAATTCTTCATCGGAAT
CATCCAATTTTGATTTCAATGGAAAGACTCTCTCGAATTCCAACAATCAT
ACACAAATTAGCCCTTCCCCAGGAAACAGTGACAGCGGATCGATTATAAG
CCTAGGCAGTAATCATTTGGAACGTAAATTTCAAAAAGGTGCTGGAGCAA
GTGCTAGATATAATACAAAATCCAAACCAAATGACAAATGGGGAACAGTT
GGATCGAGAAGGTCTCAAAAATCAAAACCGGAAGAAGAGTGTGCTTCTCT
GTCTGGTAGACCGATGCCAAATAAAAATCAGATGAAAATTTACATGAACC
AAAGTCGATCATACAATAACTTAAATTCCTTAAATTCGAAGAATCCCGAT
GAAAAATCAAAATATGGAAGTCTGGCAGCATTAAACAAGAATTACGGTTT
ACAAGATATCAACAGCCTTTGTGACATAATCCGCCAGAATCTCAATCTCA
ATAACCATGACAAAATAAGAAACATTTTTAATGCTTTAATCATTGAAAAT
GAACACGATAAAATTGATGTCATTATTGATAATTTTGAAGAAAATGAAAG
AAATATTTTATTGGAATTAATTCCCGACAATCATTATACTTCGAAAGACG
CCGAGTCGATCTTTGATATGACAATGTCTCGAACAGATTTGCACAATCAC
CTGAGACCGGGATTAAGCATGTCCAGTTTGAGCGATGCTTATTATCAGCA
TACACTCGACAACGATCGAATGGTTTATTGGAGAGCTGACATCGAAGAAC
TTTTACCCCCTCCCATGAAACCGCCCCCTAAGCCAATGCCTACCAACCTT
TTGAAATCAGCTATCATTAGTCCAGAGTCATTGATTCATGTTGACAATAT
GGTGATTGAGGTGATGTTATTAGAACCAACCACATTCACAGAATTAGTGT
TATACCTTACCAAAGATTGTTCCAAAGACGTGGAAAAAGTTCGGGCTATT
TTTCGATGGATAACTACATATGACATAAAATCTGTTAATTTTGACCCAGC
TGCCCCTAATGACACTTTGGTGGGAGTTTTACGTGCAATAAAATGCGGTC
AAATGAGTAATAATGAATTATTTTTTCGAATGTGCAGATATGCTGGAATA
CATTGTCAATTTATATCTGGTTATAGTAAAGGTGCTGGTTATCGGCCGGG
AATGGCTATTAAAGATAACAGGATGTTTAGAAACGTTTGGACTGCTGTTT
ATGTTGCTGGTGCTTGGCGGTTTGTAAATTGCAATTGGGGTGCTAGATAT
CTCACAAGCAGACATCAAGAACTTCCTTCTAGTGGAACTCTCTTATCTCG
TACATCTCAATCTCAGTATTTGGAAAATAAAATCCGTAGCGATGAATTCT
ATTTTCTCACCGACGCCAAACAACATATATTTGAGCATTTCCCAGATAAA
AAGCGATGGCAGTTACTTACAAGACCAATAACACTTGATCAATTTATGGC
TCTTCCCATTGTAAAATCACCGTTTTTCAACGCTAATTTGTCTTTCAAAC
GAAATTATGCTGAAGTTCTTCAAACAAAAAAAGGAAAAGTTACTGTTAAA
ATAAATATGCCCCAAGCTGTTGGAGTCAGTGTAAAATTAGAAAATCGCAC
TGACGGGACGATTCTTAGAGGCTTGACTTTAGCTAGAATTCTCGACGGTC
AAATGATTGTAGTGACTGCTTCTCCGTCTCAACCGGGAAAATTCTATTTA
AGTATATATGTGAATGAAGATTGGAAATCTGAGGATAATATGGAAATGGC
ATGTTCTTTTCAAGTTCATTGTTCTGAACATAATTATGATCGGTTGGTTA
CTGGGAGATTTCCGGATGTTGGTGTTCTAGGTTCGACTCCTGCATCGCAA
AATCTCGGAATCATTGCTAATCCTGGAGTCGACCCTTTTGTTTTATGGGA
TGAGCGATCTACACTGAAATTGAATATTGCAATTAGACCTGGTCTTAGAG
TAGGGCAAAAAATGATGTCTTATGATAGGTCTGGTCAAAATTCAGCTCCT
TGTGATAGTTATGCGTTATTACAGTACCAAAGTCAAGGCCGTAGTCAATA
TCATCTGAGATTTCCAATTGAAGGATTTTATTGTTTAACAATTTATGCTG
GAGTTGATGATCCTGATCTTCCAGATACCGAGCCAATGGAATGTATTTAT
AGACTGTTAATTGATTGTAAACGAGCTCAAGAACGAATACCTCCTTTTCC
TCGACAAACTAGTCGCTGGGTGGGATTCAGATTAGTTGAGCCTTTGTGCC
AACATTTAGAGCTCAACACTCCTTATCGGTTCAGAATTTTAGCTGCACAA
TGTTCATCGGTATCAGTGGTGATTAATGACACCAAGTGGGTGGACTTGGC
GGTTTCTAGTAATGGGCTGTGGAAAGGCAAAGTTAATACTGGGCAAGAGT
TGGAAAATTTATCGGTTTACGGTAAATTTGGCATCAATGAAGATGATGAA
TTCATCAAATTGCTGGATTACGTATTAATAGCGAAATCGAACAAGTGATT
TATTATTCATGGTGGCGATGTTCGTGTTTACATGTACATATTTCTAATTT
TCACATATCTGTTCCAAACATATCATTCCTTCCAGACGATCAAATGCTCT
TTTTAGAGGATTATGTTAATCATTTTGTATTTATGAAATAAATGTATCTA
TTTTTTTCAATAAATCATTGTTAATAACTGGC
back to top

protein sequence of SMED30026870-orf-1

>SMED30026870-orf-1 ID=SMED30026870-orf-1|Name=SMED30026870-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1577bp
MSFNNSHHIENVKLFTNRFPRKSQEKIYHEEIEDFDSSESSESSYDCTSD
GSSSSDEFVILDDYTTLKTELKNNQISPSILKRLSKNQKSNKKNVNHPLL
STKTKSLPIIFERSDESSVSSQSTLELSENESTLSDCSTSSSSVLANEMN
SKNSNEILILNQSNSSEITNNSYQNSVSQLQHNQPIRIKKTNSIDSSNKI
SPALLIVDDNSNNDFKMCDSLNGNQTTMCNNNATTLHTHNSSSIADLDMA
HQFIGVPEWTKINKSSNSLSQSTELIFNKRTPRFPVKNNSNTVENSENKH
LLIPDQFECENTMKNYQYQQKKPPVSVKPVEKLENNNLRISNKIPPNETP
NETILDHQKKPPVGRKPKNEKEHTEPTTDLDDLIEGHHRNSNESLELSSS
SASHSSGGNEPAKTESYFKKEMLKNYTKTDLIIMPIKTQQNSASNNRLYE
KKQDQGKVENTKTKPSETIGLLSYQKDSPSKRSQELVGSVVKMDKTINRV
TNNIERIDNAIDKLSQFNKAYMSNLETMSDSELSIDFETHSIGAQTDLSN
PNYHEKSSENSNKVQENSNNKYPKNSSKITPENESSSSDESSTEKETSSE
SENSVALKPSPVHQIIDKPIIKFRSSSPGYKSSPSKPILDSKTDGNKFFR
TSNLAHTESDVSSLPESSVCENPETRDLVGKVKYFQRQIIKSSGLYKKPP
NIEPPKKLVVEEPHLKVQSSQRPIPKPRNSIDYALRRMSNSSSESSNFDF
NGKTLSNSNNHTQISPSPGNSDSGSIISLGSNHLERKFQKGAGASARYNT
KSKPNDKWGTVGSRRSQKSKPEEECASLSGRPMPNKNQMKIYMNQSRSYN
NLNSLNSKNPDEKSKYGSLAALNKNYGLQDINSLCDIIRQNLNLNNHDKI
RNIFNALIIENEHDKIDVIIDNFEENERNILLELIPDNHYTSKDAESIFD
MTMSRTDLHNHLRPGLSMSSLSDAYYQHTLDNDRMVYWRADIEELLPPPM
KPPPKPMPTNLLKSAIISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKD
CSKDVEKVRAIFRWITTYDIKSVNFDPAAPNDTLVGVLRAIKCGQMSNNE
LFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAW
RFVNCNWGARYLTSRHQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDA
KQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEV
LQTKKGKVTVKINMPQAVGVSVKLENRTDGTILRGLTLARILDGQMIVVT
ASPSQPGKFYLSIYVNEDWKSEDNMEMACSFQVHCSEHNYDRLVTGRFPD
VGVLGSTPASQNLGIIANPGVDPFVLWDERSTLKLNIAIRPGLRVGQKMM
SYDRSGQNSAPCDSYALLQYQSQGRSQYHLRFPIEGFYCLTIYAGVDDPD
LPDTEPMECIYRLLIDCKRAQERIPPFPRQTSRWVGFRLVEPLCQHLELN
TPYRFRILAAQCSSVSVVINDTKWVDLAVSSNGLWKGKVNTGQELENLSV
YGKFGINEDDEFIKLLDYVLIAKSNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR001678MeTrfase_RsmB/NOP2
IPR002931Transglutaminase-like
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002931Transglutaminase-likeSMARTSM00460TG_5coord: 1087..1157
e-value: 0.0081
score: 23.6
IPR002931Transglutaminase-likePFAMPF01841Transglut_corecoord: 1045..1150
e-value: 1.0E-5
score: 25.9
NoneNo IPR availableGENE3DG3DSA:3.10.620.30coord: 1018..1162
e-value: 6.4E-6
score: 27.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 795..815
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 546..644
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 546..587
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 336..352
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 336..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 353..392
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 626..644
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 31..50
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 393..412
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 791..837
NoneNo IPR availablePANTHERPTHR47020FAMILY NOT NAMEDcoord: 278..1268
coord: 1275..1567
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 1040..1160